2FF6G

Crystal structure of gelsolin domain 1:ciboulot domain 2 hybrid in complex with actin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
EHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis of Actin Interaction with Multiple WH2/beta-Thymosin Motif-Containing Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/contractile protein
molecule keywords Gelsolin
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 2ff6G00
1C0GS 2MOTA 1P8XA 2W0IA 1ESVS 3FFKA 2NUPA 4Z94G 5IVUA 1PD1A 4PKHB 3FFNA 1NPHA 1WNJA 3EH2A 1V6FA 3TU5B 1NM1G 2LJ8A 1T2LA 5A1MA 1AHQA 1PCXA 4CBXG 2LXXA 1YAGG 1NLVG 1MDUA 4BEX1 4KEDA 2VILA 2HD7A 3A5LS 2MP4A 1DEJS 3FG6A 2XF1A 1D4XG 3Q2BA 5HVKD 2FH4A 1COFA 1M4JA 2FGHA 1EQYS 2NUTA 1Q8XA 5L6WC 1SVYA 1SVRA 1UDMA 1RGIG 5FAFA 5HVKB 1T3YA 4CBWG 5KYUB 3A5OS 3L50A 1F7SA 4KEEA 1CNUA 4CBUG 2NUPB 5DD2A 3EFOB 1WFSA 3FG7A 4LIZA 1P8ZG 1M2VA 1WM4A 1VKKA 3CIPG 3EH1A 3EG9B 2FH1A 3EG9A 3EGXB 1HQZ1 1TMWA 5KYXB 3CJBG 1Q8GA 1M2VB 3DAWB 2FH3A 1X67A 3EGDA 4PKGG 1H1VG 1KCQA 1C0FS 1PD0A 4S10C 3CJCG 3A5MS 1NMDG 1M2OA 2L72A 2FH2A 5KYYA 1AK6A 1T44G 3EGDB 1QPVA 2FF3A 2QTVA 1YVNG 2VACA 2MV2A 4JD2H 3EGXA 1JHWA 1AK7A 2FF6G 1D0NA 2XFAA 5FAEA 2NUTB 3A5NS 1SVQA 2KVKA 1VFQA 5KYNA 5KYUA 2LLFA 5KYYB 2VIKA 5KYXA 5KYWA 2I2QA 1J72A 4PKIG 5KYWB 1TVJA 4KEFA 1T3XA 3EFOA 2D8BA 3CI5G 1CFYA
chains in the Genus database with same CATH superfamily
1C0GS 2MOTA 1P8XA 2W0IA 1ESVS 3FFKA 2NUPA 4Z94G 5IVUA 1PD1A 4PKHB 3FFNA 1NPHA 1WNJA 3EH2A 1V6FA 3TU5B 1NM1G 2LJ8A 1T2LA 5A1MA 1AHQA 1PCXA 4CBXG 2LXXA 1YAGG 1NLVG 1MDUA 4BEX1 4KEDA 2VILA 2HD7A 3A5LS 2MP4A 1DEJS 3FG6A 2XF1A 1D4XG 3Q2BA 5HVKD 2FH4A 1COFA 1M4JA 2FGHA 1EQYS 2NUTA 1Q8XA 5L6WC 1SVYA 1SVRA 1UDMA 1RGIG 5FAFA 5HVKB 1T3YA 4CBWG 5KYUB 3A5OS 3L50A 1F7SA 4KEEA 1CNUA 4CBUG 2NUPB 5DD2A 3EFOB 1WFSA 3FG7A 4LIZA 1P8ZG 1M2VA 1WM4A 1VKKA 3CIPG 3EH1A 3EG9B 2FH1A 3EG9A 3EGXB 1HQZ1 1TMWA 5KYXB 3CJBG 1Q8GA 1M2VB 3DAWB 2FH3A 1X67A 3EGDA 4PKGG 1H1VG 1KCQA 1C0FS 1PD0A 4S10C 3CJCG 3A5MS 1NMDG 1M2OA 2L72A 2FH2A 5KYYA 1AK6A 1T44G 3EGDB 1QPVA 2FF3A 2QTVA 1YVNG 2VACA 2MV2A 4JD2H 3EGXA 1JHWA 1AK7A 2FF6G 1D0NA 2XFAA 5FAEA 2NUTB 3A5NS 1SVQA 2KVKA 1VFQA 5KYNA 5KYUA 2LLFA 5KYYB 2VIKA 5KYXA 5KYWA 2I2QA 1J72A 3DA7A 4PKIG 5KYWB 1TVJA 4KEFA 1T3XA 3EFOA 2D8BA 3CI5G 1CFYA
chains in the Genus database with same CATH topology
1C0GS 2MOTA 1P8XA 2W0IA 1ESVS 3FFKA 2NUPA 4Z94G 5IVUA 1PD1A 4PKHB 3FFNA 1NPHA 1WNJA 3EH2A 1V6FA 3TU5B 1NM1G 2LJ8A 1T2LA 5A1MA 1AHQA 1PCXA 4CBXG 2LXXA 1YAGG 1NLVG 1MDUA 4BEX1 4KEDA 2VILA 2HD7A 3A5LS 2MP4A 1DEJS 3FG6A 2XF1A 1D4XG 3Q2BA 5HVKD 2FH4A 1COFA 1M4JA 2FGHA 1EQYS 2NUTA 1Q8XA 5L6WC 1SVYA 1SVRA 1UDMA 1RGIG 5FAFA 5HVKB 1T3YA 4CBWG 5KYUB 3A5OS 3L50A 1F7SA 4KEEA 1CNUA 4CBUG 2NUPB 5DD2A 3EFOB 1WFSA 3FG7A 4LIZA 1P8ZG 1M2VA 1WM4A 1VKKA 3CIPG 3EH1A 3EG9B 2FH1A 3EG9A 3EGXB 1HQZ1 1TMWA 5KYXB 3CJBG 1Q8GA 1M2VB 3DAWB 2FH3A 1X67A 3EGDA 4PKGG 1H1VG 1KCQA 1C0FS 1PD0A 4S10C 3CJCG 3A5MS 1NMDG 1M2OA 2L72A 2FH2A 5KYYA 1AK6A 1T44G 3EGDB 1QPVA 2FF3A 2QTVA 1YVNG 2VACA 2MV2A 4JD2H 3EGXA 1JHWA 1AK7A 2FF6G 1D0NA 2XFAA 5FAEA 2NUTB 3A5NS 1SVQA 2KVKA 1VFQA 5KYNA 5KYUA 2LLFA 5KYYB 2VIKA 5KYXA 5KYWA 2I2QA 1J72A 3DA7A 4PKIG 5KYWB 1TVJA 4KEFA 1T3XA 3EFOA 2D8BA 3CI5G 1CFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C0G S;  2MOT A;  1P8X A;  2W0I A;  1ESV S;  3FFK A;  2NUP A;  4Z94 G;  5IVU A;  1PD1 A;  4PKH B;  3FFN A;  1NPH A;  1WNJ A;  3EH2 A;  1V6F A;  3TU5 B;  1NM1 G;  2LJ8 A;  1T2L A;  5A1M A;  1AHQ A;  1PCX A;  4CBX G;  2LXX A;  1YAG G;  1NLV G;  1MDU A;  4BEX 1;  4KED A;  2VIL A;  2HD7 A;  3A5L S;  2MP4 A;  1DEJ S;  3FG6 A;  2XF1 A;  1D4X G;  3Q2B A;  5HVK D;  2FH4 A;  1COF A;  1M4J A;  2FGH A;  1EQY S;  2NUT A;  1Q8X A;  5L6W C;  1SVY A;  1SVR A;  1UDM A;  1RGI G;  5FAF A;  5HVK B;  1T3Y A;  4CBW G;  5KYU B;  3A5O S;  3L50 A;  1F7S A;  4KEE A;  1CNU A;  4CBU G;  2NUP B;  5DD2 A;  3EFO B;  1WFS A;  3FG7 A;  4LIZ A;  1P8Z G;  1M2V A;  1WM4 A;  1VKK A;  3CIP G;  3EH1 A;  3EG9 B;  2FH1 A;  3EG9 A;  3EGX B;  1HQZ 1;  1TMW A;  5KYX B;  3CJB G;  1Q8G A;  1M2V B;  3DAW B;  2FH3 A;  1X67 A;  3EGD A;  4PKG G;  1H1V G;  1KCQ A;  1C0F S;  1PD0 A;  4S10 C;  3CJC G;  3A5M S;  1NMD G;  1M2O A;  2L72 A;  2FH2 A;  5KYY A;  1AK6 A;  1T44 G;  3EGD B;  1QPV A;  2FF3 A;  2QTV A;  1YVN G;  2VAC A;  2MV2 A;  4JD2 H;  3EGX A;  1JHW A;  1AK7 A;  2FF6 G;  1D0N A;  2XFA A;  5FAE A;  2NUT B;  3A5N S;  1SVQ A;  2KVK A;  1VFQ A;  5KYN A;  5KYU A;  2LLF A;  5KYY B;  2VIK A;  5KYX A;  5KYW A;  2I2Q A;  1J72 A;  4PKI G;  5KYW B;  1TVJ A;  4KEF A;  1T3X A;  3EFO A;  2D8B A;  3CI5 G;  1CFY A; 
#chains in the Genus database with same CATH topology
 1C0G S;  2MOT A;  1P8X A;  2W0I A;  1ESV S;  3FFK A;  2NUP A;  4Z94 G;  5IVU A;  1PD1 A;  4PKH B;  3FFN A;  1NPH A;  1WNJ A;  3EH2 A;  1V6F A;  3TU5 B;  1NM1 G;  2LJ8 A;  1T2L A;  5A1M A;  1AHQ A;  1PCX A;  4CBX G;  2LXX A;  1YAG G;  1NLV G;  1MDU A;  4BEX 1;  4KED A;  2VIL A;  2HD7 A;  3A5L S;  2MP4 A;  1DEJ S;  3FG6 A;  2XF1 A;  1D4X G;  3Q2B A;  5HVK D;  2FH4 A;  1COF A;  1M4J A;  2FGH A;  1EQY S;  2NUT A;  1Q8X A;  5L6W C;  1SVY A;  1SVR A;  1UDM A;  1RGI G;  5FAF A;  5HVK B;  1T3Y A;  4CBW G;  5KYU B;  3A5O S;  3L50 A;  1F7S A;  4KEE A;  1CNU A;  4CBU G;  2NUP B;  5DD2 A;  3EFO B;  1WFS A;  3FG7 A;  4LIZ A;  1P8Z G;  1M2V A;  1WM4 A;  1VKK A;  3CIP G;  3EH1 A;  3EG9 B;  2FH1 A;  3EG9 A;  3EGX B;  1HQZ 1;  1TMW A;  5KYX B;  3CJB G;  1Q8G A;  1M2V B;  3DAW B;  2FH3 A;  1X67 A;  3EGD A;  4PKG G;  1H1V G;  1KCQ A;  1C0F S;  1PD0 A;  4S10 C;  3CJC G;  3A5M S;  1NMD G;  1M2O A;  2L72 A;  2FH2 A;  5KYY A;  1AK6 A;  1T44 G;  3EGD B;  1QPV A;  2FF3 A;  2QTV A;  1YVN G;  2VAC A;  2MV2 A;  4JD2 H;  3EGX A;  1JHW A;  1AK7 A;  2FF6 G;  1D0N A;  2XFA A;  5FAE A;  2NUT B;  3A5N S;  1SVQ A;  2KVK A;  1VFQ A;  5KYN A;  5KYU A;  2LLF A;  5KYY B;  2VIK A;  5KYX A;  5KYW A;  2I2Q A;  1J72 A;  3DA7 A;  4PKI G;  5KYW B;  1TVJ A;  4KEF A;  1T3X A;  3EFO A;  2D8B A;  3CI5 G;  1CFY A; 
#chains in the Genus database with same CATH homology
 1C0G S;  2MOT A;  1P8X A;  2W0I A;  1ESV S;  3FFK A;  2NUP A;  4Z94 G;  5IVU A;  1PD1 A;  4PKH B;  3FFN A;  1NPH A;  1WNJ A;  3EH2 A;  1V6F A;  3TU5 B;  1NM1 G;  2LJ8 A;  1T2L A;  5A1M A;  1AHQ A;  1PCX A;  4CBX G;  2LXX A;  1YAG G;  1NLV G;  1MDU A;  4BEX 1;  4KED A;  2VIL A;  2HD7 A;  3A5L S;  2MP4 A;  1DEJ S;  3FG6 A;  2XF1 A;  1D4X G;  3Q2B A;  5HVK D;  2FH4 A;  1COF A;  1M4J A;  2FGH A;  1EQY S;  2NUT A;  1Q8X A;  5L6W C;  1SVY A;  1SVR A;  1UDM A;  1RGI G;  5FAF A;  5HVK B;  1T3Y A;  4CBW G;  5KYU B;  3A5O S;  3L50 A;  1F7S A;  4KEE A;  1CNU A;  4CBU G;  2NUP B;  5DD2 A;  3EFO B;  1WFS A;  3FG7 A;  4LIZ A;  1P8Z G;  1M2V A;  1WM4 A;  1VKK A;  3CIP G;  3EH1 A;  3EG9 B;  2FH1 A;  3EG9 A;  3EGX B;  1HQZ 1;  1TMW A;  5KYX B;  3CJB G;  1Q8G A;  1M2V B;  3DAW B;  2FH3 A;  1X67 A;  3EGD A;  4PKG G;  1H1V G;  1KCQ A;  1C0F S;  1PD0 A;  4S10 C;  3CJC G;  3A5M S;  1NMD G;  1M2O A;  2L72 A;  2FH2 A;  5KYY A;  1AK6 A;  1T44 G;  3EGD B;  1QPV A;  2FF3 A;  2QTV A;  1YVN G;  2VAC A;  2MV2 A;  4JD2 H;  3EGX A;  1JHW A;  1AK7 A;  2FF6 G;  1D0N A;  2XFA A;  5FAE A;  2NUT B;  3A5N S;  1SVQ A;  2KVK A;  1VFQ A;  5KYN A;  5KYU A;  2LLF A;  5KYY B;  2VIK A;  5KYX A;  5KYW A;  2I2Q A;  1J72 A;  3DA7 A;  4PKI G;  5KYW B;  1TVJ A;  4KEF A;  1T3X A;  3EFO A;  2D8B A;  3CI5 G;  1CFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...