2FF7A

The abc-atpase of the abc-transporter hlyb in the adp bound state
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
243
structure length
243
Chain Sequence
HHDITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A structural analysis of asymmetry required for catalytic activity of an ABC-ATPase domain dimer.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Alpha-hemolysin translocation ATP-binding protein hlyB
total genus 71
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ff7A00
5DI3A 4UXIA 4ABYA 1G18A 4LGMA 3GLFA 2B8TA 3CX6A 2W2VA 3PFIA 4EUNA 3GLIB 3U3KA 4P33A 2XZLA 1CRQA 3WYFA 1ZNWA 1PJRA 3I1FA 3KXKA 3PEYA 4Q4AA 2CCGA 1JXMA 3T1TA 1JR3D 1U0LA 3E70C 3QPWA 5KOYA 1IY0A 4C0LA 1GILA 4N1AA 1XEWY 5SZJA 4LV5B 5FH9A 2XX3A 3CX7A 2JDIA 2WPDD 4Q66C 2A2ZA 1XWIA 2R65A 2D62A 4G1UC 3L2OB 4P4TA 3H2YA 4JLKA 2G0NA 4WBSA 1XU4A 1QHXA 3TR0A 5JEDA 1E2PA 5G40A 5J40A 5E95A 3AV0B 2BWJA 2ZETA 3Q7QA 3IIJA 5HCIA 2ZRKA 5J4LA 1W36D 1XTIA 1M7BA 3WBKA 2WV9A 4DCUA 1KI9A 4EQ6B 4IOKA 4DCNA 3U5ZB 2QZ4A 1UF9A 1QHGA 2O8FB 3LQRA 1VYTA 2AWNA 3RLFA 5SZKB 1A2KC 4B75A 4OQLA 2OLKA 1YJ5A 3W6OA 3MWKA 2O8BB 4Q9KA 4DT1B 2UZ3A 4O2RA 2QTFA 1EESA 4AYWA 3IEVA 2VHJA 1NBMA 3H4MA 1BS1A 1EWQA 1KNQA 1EWRA 1II9A 2G0TA 5BN4A 5EP3A 1ESNA 2QNRA 3EWAA 3HP1A 3E1SA 3FMFA 1XJQA 2BIFA 3DL0A 4KFRA 1OPXA 3IPYA 3WRXC 4PSAA 1Z6XA 2J0UB 3LLMA 4PX9A 1F2UB 1Z0KA 1XX6A 2BJVA 3GLHA 4FCTA 3RRMA 3ZIAA 1KKLA 4BZXA 1PLLA 3ND8A 1F3OA 4RY2A 3U6BA 2ORIA 4AKEA 3SS8A 4LJ6A 3GJ6A 3NIBA 3EZ9A 4I1UA 4LBZA 2RKOA 1FUKA 3QE0A 2O8DB 2WSSD 4BECA 3ADBA 1ZC4A 5FL7A 4ZPXA 5FBVB 1QHHB 3U44B 2GESA 2F9MA 5AK0A 2ZSDA 3EG5A 4W7SA 2D7CA 2ZYUX 4JLPA 3VR4A 5AWFC 5L3RA 1KO1A 2XTZA 3RSOA 4PO8A 4LJ7A 3UXMA 2ZRPA 3WRYC 3ZVLA 2R8RA 4Q7KA 2VP2A 4UJ3A 1XD9A 1JJ7A 2IS6A 2ZRLA 2EW1A 3ASZA 1UADA 4CEHB 4OHXA 2BC9A 2GETA 3CNNA 4WA7A 5CM8B 4D4KA 1UBGA 4V0MA 1LS6A 1QDEA 1I4LD 1Q0UA 1KI6A 1Z6AA 1P4SA 4I81A 1AZTA 4Q9IA 2CJWB 1G21E 3THYB 4F4JA 4M1KA 1YR6A 1E0SA 2QE7A 1PV4A 4EFLA 2OT3B 4Z8XA 5FL7D 3EZ6A 1HT2E 4OQNA 1KK2A 1MO3A 5JECA 2ZUBA 1E4YA 3CWZA 1O3YA 3CW2A 4X8HA 5TY0A 5JMTA 2NQ2C 3IUYA 1S4QA 3KKPA 2FZLA 3GJ0A 3EPJA 1II0A 1KMHB 1MOZA 2CEAA 1JJVA 2F1JA 1G8PA 2OFOA 4TYWA 4EFNA 4PZZA 5FOWA 3E2IA 4RZXA 2WAXA 2WKPA 3AVYA 1DAFA 3LH5A 5DH9A 2EVWX 3RWMB 1M2OB 4GMDA 2J0SA 3FKSA 4MKHA 3IPXA 3PR1A 3EPLA 1HA3A 3D31A 2ZS8A 3K70B 4AKGA 1KSJA 4P3YA 2DBYA 2G3YA 3K0FA 1MH1A 4OQMA 2XAUA 1Q1EA 1OH5A 4TLAA 3CM0A 2BHRA 1G5PA 1JI0A 2FH5B 2OSBA 4ARZB 3W90A 4LJ4A 4NYMR 1E2NA 3Q9LA 4Q03A 3ZDQA 3AVWA 4FI3C 4BLTA 5L3SB 4AURA 3AF2A 1CKEA 2QAGB 1TEVA 2E1RA 4NYIQ 1RRFA 1LV7A 4JVNA 5FBWB 5CDFA 1GTVA 2GZDA 3MD0A 4LRWA 1CXZA 2BMJA 3G82C 1RYFA 4JIMA 1AJEA 1Z0JA 2YYZA 5KHOC 1S2MA 4D81A 4KFTA 1SXJB 4TL8A 5J5CA 2Q21A 2YOGA 1AS0A 1OB5A 1GL9B 2BMEA 2H16A 2WIBA 5DIFA 1NLYA 2IF2A 4P4SA 2A30A 3A1SA 4JKIA 3VHXA 2CNWA 4XSGA 4DLWA 1DBSA 2RGGA 2X1VA 1N6RA 1NN0A 1TU3A 2HCJB 1M74A 1W4BA 4HUTA 1AM4D 3OFND 1KDRA 1B0UA 4GRAA 4QBFA 2HCBA 5DLQC 4ASUD 4XTRA 1NI3A 3I8SA 1W1WA 4YMTA 4OI2A 2HJVA 4Q5IA 4D0NA 4M53A 1P6XA 1PLJA 2XGJA 1EGAA 2WKRA 4TSFD 3GJ8A 3LDAA 2Q3MA 4BFVA 2XJ4A 3FVQA 3THWB 3GMTA 3VR5A 2A3RA 4URUR 3FMOB 4QHTA 1FX0A 2AD5A 1UM8A 4L16A 2ZRFA 1XF9A 5LB2A 4OK5A 4B43A 4Q21A 2YHSA 4C0AC 1NG9A 2GXQA 1AQUA 4NKRA 3UPUA 1YU9A 3QNUA 4B3GA 5KDLA 2DCUA 1WXQA 2ZRNA 2GILA 2GWHA 4IEEA 4YXWD 1KY2A 2KBEA 1SKYB 2X19A 3GLGB 3IIMA 1LS1A 3CPHA 1M7HA 2BEJA 2CE2X 3MAAC 3LY5A 2GEDA 4E07A 3I72A 2VPPA 1Y63A 1ZAKA 3TSZA 3FMPB 3DPUA 3Q3JB 1MR3F 2VF7A 4JBXA 2F6RA 2FG5A 4DEXA 1H8HD 4KITB 3U3OA 3AF0A 1GITA 1P73A 3QVUA 1IN7A 1DOAA 4EPXA 2YJTD 3AVTA 4F38A 1IAQA 2ZRMA 2E9SA 5FFMA 1D6JA 1FP6A 3L0PA 1ZM3A 1A5TA 2CLDX 3IBYA 4IHQA 4M8NE 2ASEA 4W5JA 5DE3A 2J45A 2QROA 3DM5A 5DN6D 1W0JA 4ZO4A 1Q22A 5DHAA 4QRHA 3SN6A 1US8A 4DLVA 2D4HA 2IYQA 4S35A 4UKDA 4DLZA 4NE2A 3NC1C 4LJ8A 3TR5A 3ZVRA 2ZI4A 2WTUA 3FHOA 2ATVA 3GEEA 4Q1CA 1JECA 1GL7A 4M2LA 5BXQC 4KYUA 3B2EA 1RRPA 1GFIA 1HQCA 4Q1FA 2QN6A 3OEED 3VR2A 3CO5A 3L0IB 3KQLA 2Z83A 4M1MA 1W2GA 3KL4A 4GZMA 3SHWA 2ZTSA 1KSGA 3M1IA 2EYQA 2JAQA 1QBKC 1ZMXA 2RGEA 4RZUA 3MRSA 4MH0R 1Z2AA 2P5TB 2J7KA 4QJ3A 1N0WA 1Q1QA 2DHRA 4TQ9A 1SVIA 4DZZA 5JWOA 4MUBA 3R9WA 2CLSA 2XZOA 2ONJA 421PA 2IXGA 1HH4A 2I1VB 2Q3HA 4BGDA 2CK3A 4KFUA 1E2LA 3CF6R 3F8TA 3SC3A 2ZU6A 2ZSFA 1OXUA 4XWOA 3K09A 4Q4JB 2AHOA 1CBUA 4TMVA 1U8YA 2JLSA 2JLYA 1KO5A 3HPRA 2QEQA 4Y0AA 2MSDB 2VBCA 4XOIA 4WXRA 3P4XA 4NH0A 3RAPR 3R7WA 1MABB 3R9IA 1XD2B 2PJRA 3ZVMA 1Q1ZA 2A5FA 3F5FA 5EE5B 5J47A 221PA 4A92A 4XVUA 4DLYA 2WJYA 4E03A 2FMXA 2PT7A 4IFEA 3N2IA 4G5GA 1WP9A 2DR3A 3QXXA 4J0QA 3BRWD 1F60A 1R2QA 1GRNA 2J59A 2ZE8A 3TE6A 1US8B 4Z54A 5EE9A 4NBSA 1G5TA 3OAAA 4Q02A 4AC9A 3T5GA 1TNDA 4RCZA 1PUIA 4JL5A 3DZ8A 4BFYA 4M21A 4M9QA 1XZPA 1XXHA 3SI7A 2B7BA 2GEUA 5KSOA 3VFDA 2F43B 4V03A 5CJPA 1LNZA 2EFCB 3BH6A 2C03A 2IHBA 2VP9A 2XZPA 2ZYVX 3SFVA 2IS1A 3FPAA 1OIWA 3K8YA 3CR7A 4QG7A 3LA6A 4I4LA 2ZYTX 2IEYA 4K46A 4FIDA 3RYTC 4AYXA 1XTKA 3AP2A 1ZM4A 2QA5A 4BZPA 4NYJQ 2OXRA 3PG5A 4CEIA 5DN6A 1ZU5A 1DTSA 1DARA 3T06B 3MG9A 3QKSA 4MYCA 1NN3A 3AB3A 4PPFA 1E1RD 1FPMA 1WCV1 4JVMA 3VU9B 1QHSA 3GLGA 1W0KD 1KNXA 2ZJAA 4I1VA 4I1OA 1A1VA 2ZRJA 4D4MA 3OIYA 3C7KA 1DAMA 1M1YE 3ZGXA 2PZFA 1Z06A 3A4NA 2CVHA 5DGXA 3AUXA 2ZE5A 3AVVA 4B3XA 1Z5ZA 4UXHA 4QM7A 3IO3A 1KK1A 4BWYA 1IN4A 2REXB 3OESA 4ZDIA 2BKUA 2HEIA 5A0FA 4DDUA 5LPNA 5KYKA 4DLXA 1OXXK 3T12A 2MSEB 2Z6VA 4UQOA 1LF0A 1SVWA 1G7TA 1DS6A 1T5IA 2NZJA 3GFPA 1G8HA 1KHTA 2Z4SA 2WHXA 4RFSA 3QVVA 1TAGA 2YC4C 4O2LA 4BFUA 2C98A 3GJ4A 2DFNA 1GNRA 4BLQA 1IHUA 3B9PA 3SQWA 1K8RA 1OYWA 1Z47A 2TMKA 1E79A 1U0HC 2RMKA 1EX6A 2Z5FA 3BB1A 4JLMA 4ON9A 4CRWB 2IK8A 4OHZA 4JT4A 1W4AA 2O8CA 4A82A 4KI0A 3QEOA 2AR7A 2P2LA 1YRAA 1QHNA 2HV8A 4LHYA 4A2PA 4YMWA 4LUCA 4PC3A 3UK6A 1NF3A 1EFTA 3B5JA 4BLOA 3KJEA 3GLFE 1KJWA 2YOFA 2ZI6A 3FGNA 4HEJA 2P67A 3BB3A 1T3LA 1TF5A 2LWIA 2JGNA 2F3TA 1W0KA 2QAGA 2V55B 3LLUA 5L3SA 1GSIA 4B74A 4HAYA 2F7SA 3V4RA 5HTKA 1DAHA 4E22A 3TUZC 2NO0A 1IXSB 2QM7A 1KDTA 2REBA 4LBYA 2GZAA 4JLDA 3SBDA 4BFWA 4RD3A 2JLZA 3C5HA 1ZBDA 4KV9A 3X1DA 3B6EA 4KLZA 1N5IA 3K0SA 2W58A 1W48A 3HYTA 4PAQA 1CJTC 3LBNA 2ODWA 1XCMA 4Q9HA 2R6DA 1MO6A 3QBVA 1ZW6A 5CJ2A 3BH7A 3B85A 4HLUC 4TWZA 3U7GA 5CITA 1RRCA 3QOFA 5M04A 4MQBA 3J81k 1FOEB 2C5LA 2OAP1 2B6HA 4H9GA 1KMQA 4EKDA 3KQKA 1YZKA 1R8QA 4TLDA 3U7EB 5A4JA 2GJ8A 1X8LA 5F9FA 5BW8A 1E32A 3IO5A 2ZJ5A 3X1ZA 2C95A 1KI2A 3AVOA 5J4HA 1TF7A 3T34A 2KWIA 2QQEA 1B23P 2J7PA 2JATA 3FMIA 5JRJA 2P3SA 4HSEA 5DO9A 1S96A 1S0UA 4HAVA 1RW4A 2LKCA 4JYCA 4A0HA 2W0MA 4UNQA 3UMSA 5C18A 2HYDA 3SHFA 2JJ2D 5HZKA 1KI6B 2WWFA 1RJ9A 2YWFA 4GP6A 4X8OA 1HE1C 3QKRB 5CYPA 3WBJA 2Z0MA 1UKZA 4TMKA 4V0ME 4DJTA 3UATA 2ODEA 3QXSA 4HAUA 4JZKA 1FP7A 3TVDA 4B3FX 3LX8A 2EFDB 2O8CB 2ZSAA 3M6AA 1ZUIA 1OIVA 1JEEA 4DLRA 4G5QA 3MLEA 3QXCA 3PENA 1KK0A 2C77A 3EX7C 1IQPA 4P32A 1VIAA 3U4QA 1SKQA 2HLDA 2V3CC 2IYRA 3ZD7A 3R20A 2GBLC 4IKEA 3QUSA 5DYIA 1GG2A 4RD1A 4LWZA 5EXTA 2OLJA 4CZ2A 1L8QA 3SEAA 2ZUCA 1X6VA 2GCNA 4NCJA 3AEZA 4WOPA 1PUJA 2ZJ8A 1XP8A 4LJ5A 1TADA 3SJBA 3TSOA 1QHHA 1E2MA 5FR1A 1XMSA 3IBGA 3U60B 1WA5A 4PO9A 3AH8A 1KO7A 1OXVA 2OXCA 1W7AA 4GPTA 1AKYA 2BM1A 3OZXA 3ZZ0A 2WWIA 4ZCIA 1W0JD 3T1QA 3KQUA 3OE7D 1Z0FA 2OBMA 5F2EA 5EXSA 4PPQA 1OHHD 2EWVA 4AYTA 4ITRC 5FPSA 2J0UA 1D2MA 1DAGA 1E2EA 4NCNA 3GJ7A 2RCNA 3VU9A 1ZJ6A 3UWKA 5SZIA 2VSXA 4KSCA 1D8TA 2QT0A 2Q9BA 3QKSB 4CW7A 5DSZA 5BN5A 2MSCB 4ZCMA 4QGGA 4C2UA 5HE8A 3OEHA 2QMHA 3EC1A 1I2DA 1OFHA 4KCGA 121PA 1ETUA 3AKCA 2FGJA 2QUZA 3SU8A 4IOMA 2OE2A 2VL7A 4YDSA 1M7GA 4QHSA 1UEJA 3A58B 1LB1B 3CRMA 5FUVA 4B6FA 5FTKA 4ZIRA 4Q18A 4M1WA 2ZAMA 2O8FA 3DMDA 2G88A 2VF8A 2W6JD 4ACBA 1T3SA 3FWYA 3Q72A 4PQRA 3PITA 4M1SA 4AG5A 3VNUA 4KBGA 1KO4A 2AXPA 1E9CA 2ONKA 3LXXA 4LJYA 1IJFA 3T1OA 3GP8A 5B2ZA 1JR6A 3NBZC 4KYIB 2QPAA 1Z29A 4F93B 1JXOA 5TV2A 2YV5A 3I61A 3GFTA 1N3BA 3UMFA 1XEFA 2VP5A 2ERXA 3V00A 1R0YA 3I5XA 2F1HA 4YMVA 4UNNA 3LW8A 4YMSA 2IWHA 1GKYA 1YE8A 2WJVA 5AJWA 1G20E 5FTJA 5IK2A 5CM9C 2ZQ5A 1DAIA 4LK2A 5EP4A 2ATXA 3KX2A 3SBEA 2R62A 2VEDA 1CU1A 4EAQA 4XVQA 1G3IA 3EZFA 5AJXA 3V9PA 5JHGB 3TW4A 1GWNA 1NP6A 2HUPA 4DDWA 2GRJA 1MABA 4FN5A 1XFAA 1LFDB 4FWTA 3WYAA 4FMCF 3MJHA 2ZVPX 3C14C 2YVUA 1V43A 3WNCA 2BBSA 2JLXA 2Q9CA 1FNNA 3UG6A 2B8WA 2W0SA 3P27A 4MRPA 4HATA 2R2AA 1E9EA 2FU5C 3PEVA 2ZEJA 1YQTA 2ZSBA 3PEWA 4BLRA 5J4KA 2WSSA 2J0QA 1Z6TA 1SULA 4DC9A 4IOJA 3MMPA 1E2FA 4EFMA 3QPUA 1ZIOA 4IOLA 5TMPA 4A6PA 2PCLA 3DO6A 1E98A 3NBFA 1QF9A 5CK5A 4A0FA 3PV0A 3BGWA 1EX7A 4PFSA 5EUMA 3AKYA 3LBHA 1D2EA 1E0JA 4NZYA 3RVBA 2C9YA 4NDZA 4WVFA 2ZJBA 4M9XA 5EE3A 3NEYA 3REGA 4NYIR 2V7QD 1AIPA 4A8JA 1F5NA 4TMWA 4DLUA 1ZIPA 4G5OA 1A2BA 3NWJA 3QG5A 2VHUA 4B2IA 2ZR7A 1EFHA 2KBFA 5FUWA 2EWWA 3FHCB 1NVUQ 1VMAA 3BORA 1DADA 1G6HA 4IVQA 4DXAA 1JAIA 1MO5A 1E1QD 1HTWA 2WBLC 2WIAA 4IW3B 1OF1A 4TYQA 4NONA 3QF4A 3TK1A 1X3SA 1JQLB 4Q9JA 4C9BA 3RS5A 4V02A 1OH7A 4O3MA 2QORA 5JS8A 2LCFA 2I3BA 3NEJA 5EP2A 4G0NA 1NY5A 4E5UA 3SQXA 2QENA 2ZRBA 1OXTA 2XTNA 5BWMA 2C8VA 5HE9A 1XMIA 3BXZA 2GTPA 2ZE7A 2P65A 1BMFD 2GZHA 2O8EA 2G1JA 4B33A 5K8LA 3KFXA 1GAJA 1AS3A 4LJAA 3EC2A 3PQCA 4TQAA 4ESVA 3LFUA 1IBRA 1L4YA 1E2HA 5FTNA 1GKIA 4C7OB 3N5CA 3ZH9B 4BFZA 2FPLA 4WAUA 5J4YA 3TVTA 2DWPA 2JA1A 2C99A 3T1VA 1XBTA 3Q5DA 1EFUA 1CTQA 1UKYA 3ZD6A 1SHKA 4DKXA 2D2FA 4H1UA 4A8JB 2HF9A 4C0KA 3UG7A 5E3HA 4MKGA 1FZQA 5IDVA 4CF7A 2GF9A 2QP9X 4LI0A 1KI8A 4YLGA 4Z51A 1D9XA 3LNCA 1P62B 2X2FA 4B32A 2RH5A 1P2TA 1G64A 3HR7A 3NTUA 4QGFA 5P21A 3BFKA 3CBQA 1KYIA 3OEEA 4MYHA 2WOJA 2ZPTX 1X8JA 5UKDA 4TMTA 3K09C 2W83A 2PL3A 1F2TA 3IIKA 1N6HA 3RS7A 3ICQB 1XTRA 2GCOA 2WAYA 2H1LA 2ZIAA 2J46A 5L3QA 4JVSB 1T4GA 1KY3A 1N25A 3B8HA 1C4OA 1FX0B 1C9KA 1W4RA 3P32A 621PA 3KFVA 3KB1A 1VHTA 2QY9A 2H17A 2REOA 4LPKA 3CPJB 1SVSA 4PAOA 3K0EA 2HF8A 2N1BA 1TQ6A 4PHHA 3KTAB 1RYHA 1U9IA 2V4ZA 4BFSA 4MYTA 2E87A 4KODA 4QFMA 2PCJA 3KJGA 5FPYA 1N6KA 1P3JA 3B9QA 4OHYA 2F3RA 2FPKA 2FDCA 3GJ5A 2F55A 1SVLA 4F91B 1HYQA 2XXAB 4V0OA 5EXPA 2EQBA 3TJZA 1G3UA 3N2EA 4XJXA 2YNMA 1Z3IX 5LB4A 3AGPA 4OJQA 2FN4A 2V9PA 5JJKA 3AP3A 4V0KA 2IWRA 4IDPA 4IDNA 1WQ1R 5GVRA 5BQ5A 5HKKD 2P6UA 3KXIA 1HEIA 2G6BA 3L82B 4KAXA 1E2JA 3EXAA 1E9SA 5CB8A 5FTMA 4ZCLA 3P4YA 2PLFA 3C15C 4JJZA 3TUJC 2W2TA 3DKPA 4US2R 4UXJA 2IYSA 4URYR 3SDZA 2VA8A 4GZLA 1ZD9A 4W5WA 3L0SA 4XTCS 1ONBA 3RNLA 3W3AA 2WOOA 4Q1EA 3KUCA 4UNRA 1ZNZA 2DWQA 3K9LA 4Q1DA 4ZIRB 4BEBA 5HCNA 1Z2CA 1OLOA 4HB2A 4NCIA 1D5CA 5GJVC 4HZUB 3A1UA 3WHKA 4HUQB 4MRRA 4DEYA 1O87A 1Q21A 2A78A 1JR3E 1YHNA 2RAPA 1CULC 1SGWA 1TU4A 1W44A 2ZVQX 4QKQA 5KDOA 1NJGA 4QBGB 4BQSA 1GNPA 2PX3A 3IQWA 4HZIA 5IT5A 2BKEA 2GCPA 2BBTA 4LOAA 2C9CA 2VP6A 3L8ZA 4PZLA 2IYVA 3GJ3A 1WRBA 1OV4A 2IUUA 1T91A 1ODFA 2X8AA 3CF0A 4IDQA 4ZI2A 2BVNA 1UEIA 3PUYA 3MWYW 3QG1A 4L9SA 3H1TA 4PQYA 4TQUS 3BE4A 2JJ1A 1UPTA 1FMLA 4XD7A 1P9RA 3UANA 1J99A 2KSQA 1KI1A 821PA 5KPJA 2D7DA 1GRRA 1NKTA 5JWHA 1P2VA 4TZ0A 3QJYA 2K5UA 4V0NA 3DDCA 4DSOA 1OIXA 4M1TA 3THYA 3AVQA 1DAKA 5HKKA 2FA9A 1XNJA 1BO6A 3ADKA 3NBXX 4YXWA 4B48A 1BOFA 3VMFA 1UBCA 2V6IA 2ZM5A 4B2PA 3AF3A 3BH0A 2PEZA 2OV2A 3M0EA 2FX3A 4C0JA 1NVXQ 2GJSA 1AQYA 3ZQ6A 5JHHB 2JCSA 4DB4A 3OF5A 2NO9A 1G7CA 4QNMA 4URXR 3ZZTA 4R2IA 4HLDA 1XTSA 2J7PD 1LW7A 4KFSA 4B44A 3TQFA 5GADl 2ZRCA 3VKHA 3QKRA 4FCVA 3HU1A 2NPFA 2ZE6A 1J8YF 4LY6A 4YMUA 721PA 3BJIC 5IF9A 2ORVA 4JYBA 3BFVA 4CT5A 4AY2A 4GI7A 4MYUA 3ZIAD 2V8OA 4R71A 3JVVA 4RZ3A 2WICA 1ZU4A 3RWOA 2FGKA 5JI3E 1W36C 4PPNA 1EFCA 4U7DA 3SFZA 5LDDC 3D7MA 5E7IA 3IQXA 3GFOA 4PQFA 3U44A 4LX0A 2CK3D 1VDZA 4RD2A 3GLGE 1VYVA 4LPSA 1SKYE 4A36A 5JEEA 5FTLA 4QGHA 5CLQA 2D2EA 4A6XA 3B82A 1W2HA 1L2TA 4FCWA 4BLPA 3QQ5A 1DE0A 4N0DA 3GLHB 5FI0B 2QRZA 1MKYA 3IILA 4BRUA 4F4CA 3MJRA 3CONA 1U9IC 1DELA 2AN9A 2NO1A 4FWIB 2PX0A 1IONA 4AWXA 1T5LA 4KU4A 1N0VC 4URVR 2NTYC 1H8ED 1YZNA 1IOZA 2YINC 4US1R 3WYGA 4B35A 1CLUA 3TW8B 1KAOA 2JLUA 4TYYA 1A4RA 1ZVQA 2QSZA 4PO1A 2W00A 2PJZA 1XPRA 5SZHB 2J87A 4HUQA 4L15A 1ZP6A 1IN5A 5E7MA 4B73A 1E69A 3UIEA 3DOEA 4HDCA 1G5RA 4NP6A 4X8LA 3G0HA 1ZRHA 3GEHA 4C2TA 3OIUA 2ANCA 2FWRA 2OUKA 5FOTA 4EPTA 5AJYA 1WE2A 2NO7A 2QP4A 1KI7A 3QXJA 4MITA 1PVOA 3SJZA 5DYGA 3FOZA 3K53A 1Z0AA 3RS3A 3JVUA 5C1BA 1S3GA 3Q85A 1ZUHA 2C96A 1FFHA 2R6FA 5EE1A 1IXZA 1S9HA 2ZI7A 3FHTA 3ND9A 4Q4HA 5KSYA 4RSGA 3A1WA 1G7RA 3EIQA 2R6CA 4ASUA 1CR0A 1GL6A 4Q1AA 2XXAA 3PUXA 4JKYA 3K0CA 1GVNB 2N46A 2EU8A 3I62A 3TIFA 2SHKA 3CRW1 4JSTA 3W6NA 4DSTA 4CYMA 2IS2A 4BLSA 3BIFA 4RFSB 2PBRA 2P5SA 2IX3A 1MO4A 1XEXA 4QHYA 3KTAA 2H8KA 4PPGA 2PZEA 3U3JA 2GK7A 2MMCA 2ZITA 3GLIA 4AKIA 4JVLA 4LBVA 3ADCA 2JLRA 2W6ID 4CGZA 2KE5A 2GJ9A 3NBYC 3K70C 4R98A 1HE8B 1Z6GA 5L3QB 3GJXC 2HXYA 3RDPA 3HR8A 1F2TB 3WXMA 1G3MA 5FBRB 2IYXA 5A5GA 1XDBA 1OFTA 2KB0A 5ELXA 3X1XA 2WVJA 1AK2A 4TMZA 2CE7A 2XNSA 5JJLA 2PH1A 4HDQB 5GVSA 1XXHE 3LQQA 1NMXA 2G83A 2V6JA 4A8JC 5KU1A 3H84A 1CJMA 3X1WA 4Z8YA 4EDHA 2J0VA 1N6LA 3RRYA 4D6PA 1W49A 2P6RA 4CEIB 4LYFA 3K70D 2BMDA 4HAWA 1ZYUA 1JEDA 3CLVA 2AKAB 2Z4RA 3T5DA 4C0SA 2JJ1D 4DB2A 2CLCX 3FDIA 4CT4B 1N6NA 2PEYA 3WNDA 1Q12A 1E1RA 2ZRIA 4C7OA 4OL0A 5CYOA 1WMSA 4TLEA 5IK2D 1SXJD 2XNDA 2RGBA 4Q1BA 4L5BA 5ANRB 2BV3A 3NXSA 1YR7A 2F43A 1NJFA 1R0XA 3EAQA 4M4SA 2A5DA 3DVLA 4LC1A 1XXHB 3CRVA 2A5JA 1SZPA 1DO2A 2KJQA 4A4DA 2O8EB 1II8A 4TT3D 3DOFA 5LBIA 3U3RA 3MCAA 4R9UC 5EZ5A 2NIPA 2DPXA 4X8MA 1WB9A 1BYUA 4G5SA 1E2GA 1EG7A 4KVAA 4MKIA 4MUAA 3CH5A 1R5NA 3DHWC 1KDPA 3C4JA 4TN1A 3JZAA 4A0GA 4S2EA 5F3WB 2ORWA 1ZM9A 2AXNA 1W5TA 1BIFA 2ZI9A 1ZM2A 3X1YA 4O0MA 3CWQA 3WP1B 2WMNB 1TPZA 4JBWA 1XB2A 3QBTA 2HT6A 2VSFA 3OFNA 3L8YA 3RC8A 5FOVA 4LV8B 2CVFA 3PIRA 2Q6TA 2ZUDA 2DFLA 4JJKA 2QE7D 1XPUA 3KQHA 1UJ2A 4D0LB 1NG1A 1PZNA 4LHVA 1S1CA 1Z63A 4PTLA 5KSZA 1GZSA 4LBWA 2I1QA 4TSFA 4D82A 2BBOA 1TQDA 3HU3A 4MA4A 2PT5A 3RSLA 3D3QA 3GLHE 5G3ZA 3EZ7A 4DBLC 5IRCD 3BBPA 3W3ZB 4NCHA 3EWSA 2A5GA 1S1MA 3QENA 2XSZA 1E4VA 1G8GA 3NC0C 4XVRA 5AJZA 4E09A 3VKWA 3MWLA 4MDFA 4N0EA 4LC0A 2FFAA 2ZRAA 3GCGA 5F9HA 1EFRD 4M0LA 2F9LA 5DHFA 3CNLA 3KKOA 3MFYA 4TL7A 2Y8EA 1N0UA 2NG1A 3TKLA 2VH5R 1P5ZB 1Z08A 3THXA 1XTJA 1ZNYA 2BOVA 2CL7X 3KXLA 4JBYA 1VCOA 2GBLA 3B1VA 2GXSA 2ZROA 4RFVA 3U3MA 3R8FA 1SXJE 1TMKA 1YZUA 4B3DA 2YKGA 3B7GA 1VHLA 2QAJA 1VCIA 1XCGB 3VX4A 2ZR0A 5KO2A 2OFWA 4KO8A 2NOAA 2DFTA 4MGKR 5FBLB 3WP0A 4Q00A 4OI0A 2YOHA 4ERNA 4QGAA 1JPJA 1CJVC 1R8SA 1NSFA 4F7WA 4C4PA 5B58C 3IKJA 2F1RA 2IYZA 4JSYA 1W5SA 3BD9A 4BUJA 4NYMQ 3I32A 2OEPA 3CF2A 4KVGA 1MV5A 1ZC3A 5DISB 1W36B 1E2QA 1Z0DA 4A2WA 3VNVA 4HLUA 4PHTA 5D3QA 1NVVQ 2QRNA 5JCPA 3VQTA 1KGDA 1AGRA 3K9NA 4DSNA 2QMUA 1F48A 5C4MA 1PLKA 1AA9A 1E9RA 3TSWA 1YZQA 2WJHA 1U98A 1BYIA 4NCKA 1CRPA 4GOKA 1R4AA 3CIOA 3IEUA 1KO8A 2JLWA 4WZBE 1OSNA 2IYUA 4KSBA 4LYJA 1FW6A 4W9MC 2DFKB 1WF3A 2C2HA 3BWDD 1FQKA 2YWGA 2RGCA 5FPHA 1IM2A 2IW3A 3LVQE 1Z07A 3FFBA 2AD1A 2GF0A 1SXJC 2A9KA 4A2QA 4AIIA 4G3XA 2FFQA 3A37A 1VG1A 4GOXA 1VCNA 4MGYR 4RVCA 3ZVNA 3BC1A 5GJCA 3N70A 1GNQA 2QI9C 2GVZC 3C16C 2WJIA 3VHLB 2XEXA 4R2HA 2VP0A 1JR3A 2IXFA 2NPIA 4W5HA 1IY1A 3T61A 1U0JA 3BERA 1U90A 2UZIR 4Q01A 2RGAA 2ZJ2A 3RS2A 1E96A 4EJSB 5HR5A 2A5YB 1XMVA 1CF4A 2PLRA 3NKVA 2DYKA 3O8DA 4MGZR 2FPMA 2OESA 3OEHD 3I3SR 4TTRA 1Z6YA 4O25A 2FSFA 3MGCA 4D0GA 4M1OA 3RABA 1G8FA 1J7KA 3LX5A 5FUXA 1G3QA 2R6AA 3ECCA 3KZ1E 1S9DA 4D2IA 1A82A 1T0HB 4ZKDA 2YWEA 1I2MA 1K5DA 4ZV4A 3ZQJA 5D3MA 3TGPA 1Y3AA 4I99A 3U4QB 2ZS7A 3OE7A 2FSGA 1N6OA 1KKMA 1E9DA 1COWD 3U61B 4GMXA 1X1RA 1E9BA 3LV8A 3CB4A 4HLQB 2ZYWX 3RRNA 3TMKA 2DWOA 1L7VC 3AVPA 1JPNA 2G77B 4P31A 2D06A 1Q57A 3EPKA 1SXJA 3WNBA 2OFXA 1RJ9B 4U00A 2CHGA 4V0LA 5H70A 3BAFA 1P2UA 4OQFA 1AN0A 3JZMA 4B47A 2VQSA 2C9OA 4Q19A 1UBFA 2EYUA 4NPHA 4A1FA 1N2CE 1XZQA 4UNPA 1CIPA 4XSHA 1K5GA 5JRZA 3VX3A 4PZYA 1Q1BA 4A15A 2HLDD 3NH6A 1YRBA 3U2QA 1ZCBA 3PVSA 4ZDJA 5CB6A 2ZR9A 4URZR 1GP2A 3WMGA 3KJHA 4L8GA 3PCRB 1S3SA 2JIZA 5LD2B 5FOSA 5D3MB 1YKSA 3W8RA 1VPLA 4UJ5A 2JJ8A 4GBMA 3NHBA 1RZ3A 3DM9B 2B7CA 3EZ2A 2VIIA 4OJKA 4LV6A 2JLVA 1AGPA 5G3YA 2H5EA 1ELOA 5EZ6B 2WKQA 4D25A 3RS0A 1NIJA 1KZGB 5JS7A 1DEKA 3O8RA 3EW9A 4GP7A 2IYLD 2P6NA 4WXPA 2X77A 4EJSA 2EFGA 4HB4A 2ZRDA 3P26A 1KMHA 2CCKA 3RS4A 1E94E 4P0TA 4BE7B 2B21A 2GAOA 2AX4A 3CR8A 4U02A 2O0JA 4OHVA 6Q21A 5JSZB 1OHHA 1R7RA 3U7HB 4ZDKA 2R6GA 3CZPA 1E1QA 4QL3A 1LTQA 3QEJA 4PANA 4PXAA 4ACAA 1KAGA 1LVGA 2ZU0C 5FOUA 2BBWA 3D8BA 4LYHA 1D9ZA 3LWNA 1VG8A 4URWR 4ZKEA 4POAA 5AJVB 3BK7A 1QVRA 1ZD8A 1QG4A 3D6TB 4IXMA 3A6PC 4TYPA 1SHZA 4C0BA 4FXPA 1U81A 2OBLA 2RGXA 1ANKA 2VHTA 3GEIA 5KUTA 2XJ9A 5L3VA 3U6KA 2FFHA 2D3WA 2XITA 1DAEA 4ZI3A 2IL1A 2WWWA 3CH4B 1C1YA 1ZM7A 4PC1A 1G1MA 1NMZA 1E2KA 1S8FA 1R6BX 1OH6A 4F92B 1T9HA 4DUGA 2IHYA 2RGDA 1NSTA 3ZS9A 521PA 1YR9A 1XCPA 4TTPA 4CEJA 5CK4A 2CCJA 3AGQA 2GJAA 1CR4A 4DLTA 4WZAE 4RD4A 1W46A 3KQNA 2WWGA 3Q7PA 4JLOA 4I1SA 2GVDC 4QBIA 5JI2E 2CHQA 5KPDA 2XTMA 1SVOA 4AK9A 1XPOA 1CR1A 5CDFE 4U5XA 1DG1G 5FPKA 3RANA 1G3RA 1T6NA 4LSGA 4FW9A 5CIQA 5K8UA 3KUDA 2HDNB 4HB0A 1H8EA 2AK2A 4DIDA 3PXGA 5B57C 3NDBB 1G4AE 1TF2A 4GOJA 4YONB 1G16A 3AUYA 3K9GA 4LDJA 3FKSD 3GQBA 3CRQA 1W4CA 5E4FA 3THXB 3EIEA 1XTQA 4TMXA 1XRJA 4KHZA 3QKUA 2BMFA 4IJMA 1YR8A 2B92A 1JNYA 4JL6A 3FTQA 1HY3A 1VG0B 1Z83A 3NVAA 2FOLA 3I4LA 1P72A 4DT1A 1E0AA 1NNEA 2GK6A 4C0HA 1OKKA 4IEIA 1RIFA 1TEXA 5FR2A 4PHFA 4YC7A 5AUPB 3GLIE 4LHZA 1M34E 2ZI3A 3DEFA 4FINA 3OHMA 3BB4A 4EQ6A 1GRQA 4C0QC 3C5CA 3B60A 1FNMA 3G5UA 4JL8A 5G53C 4M9ZA 3KKQA 1HQYE 4GNKA 4G5RA 4DDTA 4WZ6A 5BYJA 2QM8A 1X1SA 2WM9B 4LJ9A 3CX8A 4JLNA 2VLIA 4N3NA 2AKYA 1ZNXA 3OIVA 1TX4B 4JS0A 2OCYC 2FV8A 2OCPA 1V5WA 3B13B 2DB3A 3A4MA 1AS2A 3TAUA 1UKEA 5K8IA 3AM1A 3CZQA 4D80A 2GHIA 3LW7A 3TLXA 2QSYA 3SR0A 2OZEA 2OM2A 3HJNA 1T0JB 4B34A 2ZRGA 3QI2A 1T8UA 3LD9A 1NMYA 3ZJYA 4Q4AB 1KSFX 2MMGA 1TUIA 2OCAA 1XD2A 5K8TA 4OYHA 3R7WB 2QMOA 2HJGA 4B76A 1KOFA 4LYAA 2WZQA 1CEEA 2VO1A 3I5YA 2ODBA 2IC5A 1OXSC 1UDWA 2EFHB 3A1TA 1GKUB 4GSYA 4Q4JA 5TARA 3REFA 1WBDA 2KI5A 2OO7A 5AUNB 1GIAA 2BDTA 4HAZA 5JZVA 1RE0A 3W5IA 4XWAA 2ZANA 1G17A 3LAWA 5G41A 3ETLA 5GJBA 4XWKA 3R8CA 4NTZA 1M8PA 3SJCA 1XJ0A 4HLCA 4QBHA 3PUVA 3S1AB 4KXFB 3F0TA 4BZQA 5CIWA 1MT0A 4JLVA 5B64A 2HT1A 4BEJA 4ILEA 1U8AA 4EPRA 1NN1A 3IDQA 2JIZD 1OW3B 2F1IA 3NHAA 4US0R 2GDJA 2XB4A 1P2SA 3K0AB 1Q3HA 2CBZA 2PMDA 4CIDA 1TTTA 2J3EA 4IVPA 3W6PA 1KJZA 3WMFA 1E2DA 1EFRA 1HURA 1K6MA 1XJCA 1QG2A 2CHVA 1DPFA 1HUQA 3K1JA 1G8YA 3BOSA 3LO5A 1G41A 1DO0A 2GA8A 2XSZD 2ZS9A 3UMRA 5C4GB 4JMPA 4DDVA 2ZJOA 1WDTA 4EJSC 5GJWC 3B1ZA 5H8WA 3LRPA 1G19A 4GFDA 1VKJA 4OHWA 1Z0IA 3CPEA 2VTKA 4TTQA 4RD6A 1U8ZA 4JLBA 4Q7JB 2QMEA 3QXHA 1KK3A 2H7VA 1CJUC 4LHWA 1E0KA 4QJ4A 1P61B 2EFEB 3W8NA 2QBYA 1XEXB 4H1VA 2J9RA 4Q7MB 1EXMA 1VYUA 3A4LA 2ECKA 1JQJC 1KI3A 5KNCA 4CEJB 4NYJR 4A9AA 1YVDA 1N6IA 4MRNA 4OI4A 4K8OA 1RPZA 3AF1A 2BEKA 5H1YA 1KDOA 1IY2A 1Q3TA 2J5XA 5LD2C 4MDEA 4Q4HB 4F4IA 1LY1A 1UDXA 3IHLA 5JJIA 4OK3A 1CR2A 2HXSA 3VTKA 1E2IA 1NLZA 1UKVY 3AQ4A 3FFAA 4DCVA 3ZS8A 4DUGD 4Q48A 5C2JB 2FFBA 4OKSA 4ZDWA 1UFQA 2O5VA 4GT1A 3B1YA 3IGFA 4BFXA 3AVXA 1NRJB 1G4UR 1NBME 1R5OA 4OBEA 4RZ2A 1FMJA 1Z22A 1A7JA 3H86A 1TUEA 1CS4C 2YC2C 2VRWA 1XEWX 2QQ0A 1RKBA 5JSZA 1X86B 1TL7C 4Z1MA 4PSKA 3LBIA 3MSXA 4QOSA 3TUIC 4DSUA 4LZZA 3RHFA 4TLCA 3QKTA 1OB2A 2NGRA 1YZLA 3THOA 3HU2A 4EPYA 1RFLA 2QPOA 5H68A 1CP2A 1EK0A 1NVVR 2GNOA 2V1XA 2ZI5A 4Q7LA 4QJ5A 3THWA 1Q44A 1YZTA 2Q9AA 4FMCB 4TL9A 2R44A 3OAAD 4L9WA 2YZ2A 1KZ7B 1T8TA 1KJYA 1IXRC 3X2SA 3FYHA 1VCMA 4WIAA 4YQFA 3C8UA 5HZHA 1TQ4A 1UAAA 1E9AA 4QM6A 3O8CA 3CKLA 1OH8A 1J8MF 1N5JA 2WWXA 4L4UA 2CNWD 2FF7A 3QPVA 1J70A 3QIAA 1G7SA 2Q3FA 4Q9LA 1LF5A 1ZD1A 4XH9B 2FSIA 2P0EA 3VR6A 4PC7A 4P4SB 4CVNA 5KNDA 1OFUX 2V7QA 2WWHA 3O8BA 2IUTA 2ODNA 5DNYB 3PUWA 4JLJA 3EARA 1JBKA 1BH2A 1COWA 4Y0VA 3UWOA 3MWJA 3NG1A 3CNOA 3KB2A 4AKHA 3AP1A 3R9XA 3ONWA 2XOKD 1F6BA 2WMOB 2QAGC 3SOPA 4P4UA 3P20A 3B1WA 3FE2A 1IN8A 2OG2A 4NL4H 2BCJQ 3DKVA 2FNAA 4B2LA 2QTHA 3TRFA 1E99A 2IT1A 1AZSC 4AG6A 5FL3A 4R7ZA 4Q47A 2PMKA 2O52A 2UVQA 2C04A 5FI1B 2N42A 2YWHA 4ARZA 4M1YA 5EE0A 3I73A 4HYYA 5JBQA 2QP3A 1KTVA 4PR0A 3K0FB 3QF7A 4HDOB 3M4YA 2LKDA 3SNHA 3TQCA 1VTKA 3RRZA 4C3ZA 2AFIE 4QC2A 3K0CC 1BMFA 5EXXA 2BJWA 1E9FA 3NH9A 5E7JA 4BRWA 3WY9A 3I92A 2JLQA 4LCBA 3TNFA 4DLSA 2G9NA 3VR3A 3ZYCA 2QU8A 1KI4A 1P7CA 1FUUA 5EQTA 2BCGY 2Q0HA 3BFXA 5B30A 5KSPA 1QHIA 4ESHA 1G9XA 2FEMA 2QPTA 1QRAA 5KTYA 4D26A 4GL2A 3ICEA 5KNBA 2ERYA 4G01B 2J1LA 4TZ6A 5KDDA 2IBMA 4HAXA 5FBQB 2X2EA 3B78A 1W47A 1VIYA 1SVMA 2IUSA 1N5LA 3CUEF 5AUOB 4K81B 5JFGA 5L8VA 4DHEA 3Q8XB 2JASA 5JLJA 3UKDA 4PC2A 2CJWA 4JLAA 1E6CA 1JAHA 2VYFA 2ZAOA 3EASA 3P1JA 4BASA 1NN5A 3WMEA 1RVDA 5JCZA 5FPTA 1HT1E 3K9HA 4GDFA 3VR1A 3WHLA 4DCTA 2W2XA 4RD0A 1JB1A 1P9NA 2QL6A 4HZUA 2JDID 2FZ4A 2WPDA 4OK6A 2QGZA 4KBFA 4Z1MD 3SYLA 3W5JA 4BPBA 4CEHA 4DWJA 4AI6A 1QVAA 3ZLJA 3A1VA 2D74A 5EP1A 2ANBA 3EA0A 3HDTA 3ADDA 2QT1A 3SZRA 2RGNC 4KJZA 4RJLA 4FMDB 2OILA 1E79D 4PHGA 4RKFA 5IHPA 1AKEA 3RC3A 2GAAA 1QHYA 4NU0A 2XNDD 4IDOA 1UBEA 1H65A 4JT2A 1OT3A 3HYRA 4A0RA 3BS4A 4UNSA 3C41J 2CL6X 1NVWQ 4MRSA 2V54A 4D4LA 4OI1A 4EPVA 4TT3A 3V4FA 2O8DA 1FL9A 5AR1A 3L0OA 3TBKA 2VHQA 1N5KA 1R0ZA 4FMBB 1XMJA 4WW0A 4EIWA 4EPWA 2NZ8A 4DRZA 3F3YA 5AUQA 1F2UA 5C46F 3TAHA 2PZGA 2IXEA 3SJAA 4B6EA 1VG9B 4CDGA 1JALA 4RKEA 1WBBA 2AL7A 5TXGA 2GKSA 1KIMA 3T35A 3PEUA 1VECA 3W34A 5BYKA 2GXAA 1R0WA 2A7QA 4IFBA 3SYNA 3SYKA 2O0KA 2IF0A 3KKMA 2R9VA 4QXAA 1IN6A 3U7FB 1NBMD 4XIGS 1P9WA 1P60A 1FTSA 3QSYA 1SQ5A 3ZZUA 2IYYA 3AF4A 2OCBA 1BKDR 1I4TD 1YZGA 3DMNA 2GCOB 3KKNA 4TYNA 3EPHA 1NL3A 3KJIA 1H8HA 1RC8A 2O8BA 5FUYA 4HI0E 1MRSA 4Q4LA 3E5HA 1X8KA 3KDSE 2QG6A 2JEOA 1OYYA 1U99A 2GEVA 1T3HA 2IYTA 3L43A 3NDPA 2WWYA 1GM5A 3VKGA 4M22A 2AWOA 2RB4A 2JJ2A 3HWSA 2V1UA 3PUZA 2FE4A 3O47A 3MUFA 1OE0A 3HPQA 4DIEA 2H57A 4XD7D 5J4VA 4MGIR 1OJLA 3LVRE 3W9YA 4YDHB 5DI9A 2ZRHA 1M6NA 4M9SA 4PC6A 3VAAA 3SE0A 2AFHE 2BM0A 1R5BA 2W6JA 2GJKA 4IDHA 2WSMA 3B1XA 3A36A 4II7A 1Z8FA 3T15A 1DG3A 5EJEA 8OHMA 1OFIA 1OKKD 5CLLA 5FOXA 3IHWA 4DVGA 1ZCAA 2VHCA 2VSOA 2IA5A 1FQJA 1E3MA 4NMMA 2H92A 1CJKC 1NIPA 2O0HA 3FB4A 5JWRA 1J2JA 2IS4A 3TH5A 3DZDA 3OIWA 4HB3A 1ZINA 2IYWA 3I8XA 2ZREA 1IJEA 2AK3A 3FKQA 3A8TA 4RCYA 2ZXUA 2Z43A 2XOKA 1ZUNB 4FMDF 2QBYB 2VP4A 3Q5EA 2QTVB 3CRRA 1DVRA 2I4IA 2DY1A 1TQ2A 4OQXA 2WJJA 2L0XA 2GXUA 2G1KA 3GLFB 1G291 1II8B 5DI3B 4IRUB 5TB5A 2XB2A 2OHFA 2NMVA 5F98A 4C30A 3QF4B 3QY0A 4TLBA 2CXXA 1ESMA 1D2NA 2FEOA 1Q20A 4B71A 4NHOA 5BN3A 2FJUA 1L4UA 1QZXA 2J41A 5TDHA 4LHXA 1HV8A 1Z28A 2ZJYA 1U94A 1XD8A 2OBNA 4D4JA 1GDDA 4PSVA 1NLFA 4KLNA 4MKFA 3AVUA 2HYIC 4IVRA 1KSHA 1FTNA 4MRVA 1N6PA 2CMKA 3ASYA 2WJGA 4B3CA 1R10A 1SVKA 3K0AA 2RHDA 3EA5A 1I4DD 4IXNA 2H18A 1RRGA 3AKDA 1NY6A 1U2RA 3H0KA 5HPYB 2UKDA 2NO6A 1GOTA 3GPLA 2CDNA 4DCSA 4PAMA 4FD2A 4TL6A 2RGNA 2FSHA 2ZSEA 3S1AA 1P75A 5TVKA 4QNRA 1G6OA 2C78A 4BFTA 2RHMA 4AD8A 3EIHA 3GD7A 5EUQB 4B3BA 2W6IA 1GUAA 2CL0X 2IEZA 2OAQ1 3AKEA 1NKSA 1J90A 2QGNA 3LXRA 1MRNA 2ZJZA 3PJRA
chains in the Genus database with same CATH superfamily
3VYTB 2FPGA 5MGNA 1SY7A 3TGWA 1DRVA 4LGMA 3GLFA 4JI2B 3HN6A 3QLUA 2B8TA 3NTLA 4W9RA 1LPBB 1TU0A 1X8XA 1ZQ9A 4QRIA 1X1DA 2AFVA 2W22A 1GT6A 2HFJA 4Y1EA 3HI6A 2QTVA 4Y2XA 3WGOA 4D5EA 3CLHA 4DMMA 5IAJA 2BYTA 2PPLA 1ZZEA 3B6KA 3I05A 4X6LA 3P5SA 1JXMA 3T1TA 1BN6A 5IJ9A 2R8EA 1IY0A 4HT3B 3GMSA 3DJFA 1VDMA 2OTCA 1TT5A 4N1AA 2XMQA 5BQ3A 1B3BA 1RAAA 3EQZA 4FLMA 5HBRA 1ZVKA 2XX3A 5SZJA 2P0YA 2X3UA 1MLDA 1RTKA 5BMVA 5IXJA 4LXIA 1P4HA 1UBOS 3MK31 5AW1A 2G04A 2D62A 1MEEA 3L2OB 4G1UC 4N65A 1CNEA 4P4TA 3VU8A 2G0NA 1N5RA 4WBSA 5ECWA 1U5BB 2BP7A 4II3A 4MDYA 5J40A 2NUBA 4PZ0A 4WCFB 4WZAA 4FYVA 4JI6B 3RLIA 4ZJYA 5LLDA 3Q98A 3DZJA 2ZETA 4CG3A 3GAAA 1W94A 2I80A 1ESZA 2INGX 3VJKA 2IHZA 1GPH1 4P7JA 3X1KA 5BY2A 5JPDA 4DCUA 1KI9A 3AFOA 4EQ6B 2VWHA 1HLGA 2IHUA 4DCNA 3U5ZB 2QZ4A 1QHGA 2BFMA 4F96A 1VYTA 2EERA 3RLFA 2B1RA 3KPYA 4NIMA 7YASA 4HWOA 3OCYA 1W87A 2VJCA 3KFLA 5CVCA 5FLYA 5H9VA 3PQ6A 2O8BB 2AJBA 4BKMA 2X1HA 2ZBRA 2OVBA 1RWKA 2QN8A 1AG9A 4RZSA 4DT1B 1BW9B 1W76A 2YW9A 2ZJ7A 4AYWA 4J03A 1NBMA 2JAPA 3AY3A 1BS1A 3CNHA 4BDSA 1G2PA 2A86A 1EWRA 1II9A 2WYVA 4OVKA 1G38A 1XP5A 1M2VA 2NV6A 1GR0A 4C4RA 3E1SA 1K06A 3W9BA 2H85A 3M6MD 2BIFA 1T36B 5JD6A 3DL0A 2JZOA 4Y2GA 1BGXT 1FJHA 3QA3E 3BXPA 3QI7A 4HDNB 2K7ZA 4M7WA 5D84A 1HOTA 5ULLA 1QRUA 4G41A 3D4LA 4Q3OA 1F2UB 1DC4A 2B83A 3GLHA 4FCTA 1R6TA 5PNTA 1E7MA 3SBXA 4BZXA 5GINE 3ND8A 3ICOA 4RY2A 3PC8C 4Z7NB 16PKA 2FW0A 4RVGA 1YRHA 2Y66A 3CZRA 2H3EA 4LBZA 1FUKA 3IQDB 4PSUA 2WSSD 2PR2A 1UT6A 2Q4BA 3ADBA 1MPXA 4HCJA 4ZPXA 3JRXA 1QHHB 3SNKA 2PUFA 3U44B 3NHWA 2GESA 2I6XA 3ET5A 4D3YA 3VR6H 1UJNA 2IELA 2AQIA 1MT3A 2I87A 3CGWA 3II6X 3LQ1A 3N0XA 4JLPA 5IFLA 5IYZF 4XARA 5AWFC 2C7PA 3ZD8A 3PX3A 4X66B 1C4KA 4KOEC 3SIWA 3MTAA 4TM7A 4PO8A 2J9GA 2JH9A 4RTKA 1YNOA 1IBLB 3CJTA 5JDIC 2A4KA 1Z35A 4JUCA 3ZVLA 2VXOA 2C2KA 4ZXFA 5C81A 4LYGA 5IANA 5K7SA 2GI4A 2XF2A 8ADHA 4CF5A 2BKXA 1JJ7A 1B6TA 4LZNA 1C9NA 5TPZA 2I7VA 1WMAA 2OHIA 2WUFA 2AJCA 1UADA 3UUGA 3KPUA 4GXQA 3CNNA 4TXHA 1P2FA 4WA7A 2DX7A 3HKDA 1BWSA 4I3GA 4DA8A 5I7VA 3RD5A 3G8CA 1PS9A 3O31A 4V0MA 4XFKA 4Y1GA 3MBOA 1KPHA 1Q0UA 2Y76A 4BB5A 1U7TA 2WKWA 3WGIA 3KELA 1F2DA 3LFHA 3PXEA 1QVZA 1ZBQA 5EVCA 1AZTA 2W7TA 1UMBB 1XQWA 2P62A 5T4HA 2BL4A 1EBUA 4UM5A 4YJ3A 4M1KA 4XEUA 4F4UA 5AK3A 4K6OA 3NNNA 3DL4A 1M2NA 4AO8A 1XMPA 5EKTA 2W2OA 4EFLA 1PV4A 3DW1X 2OGUA 5FL7D 2DBVO 4N3GA 4OQNA 4HNHA 2XVZA 4CG0A 1B1CA 1YBMA 4F6LA 1E4YA 1NKVA 1JTEA 4X8HA 3EDRA 2V5UA 3IUYA 3FUVA 3A1NA 4CKBB 3EPJA 4XASA 4ZYYA 2M9MA 4GZ6A 3G9UA 1R88A 3IAM6 1N2OA 5H3CA 4YUAA 2JF0A 4TYWA 4BWYA 1M0SA 4FGZA 3QUTA 3VYUB 1SQ6A 3IVGA 1R4NA 2WKPA 1VMDA 1A7AA 2Q5CA 4AJ1A 3GT0A 4DDKA 1L7RA 5DH9A 3NOOA 3LYAA 4ZGBA 3HI4A 1LLQA 4JJEA 4BQOA 1WCYA 1XZEA 2COKA 2UZAA 4X84A 1L8XA 9LDBA 4OLAA 3HADA 3DV0A 4MKHA 5DNEA 3PR1A 1DX6A 3ZLTA 2VNHA 1HA3A 3D31A 1Y1RA 1KEZA 1OGYA 5KNCH 3O95A 2YS6A 3IPCA 1MH1A 1JIQA 2AB0A 4HBGA 1Q1EA 3AIMA 1NX9A 2FH5B 2OSBA 4ARZB 1DEXA 1WU7A 4ER6A 4RIGA 4NYMR 3W90A 4XKJA 1E2NA 4C01A 1U1FA 4Q03A 3ZDQA 4WFKA 1H9AA 2KS6A 3HVIA 3NTRA 1CUUA 3FPKA 1M6EX 4FI3C 4AM8A 1TEVA 7REQA 4DA9A 1RRFA 1LV7A 3MINB 4JVNA 5CDFA 3T0FA 1GTVA 2BTQB 3P8ZA 4FUTA 3WRXA 3MD0A 4LRWA 2H48A 1Y37A 1KGSA 3QVXA 5BNFA 4QUKA 2HADA 1I6WA 1WQ3A 3L49A 3QPCA 2YQZA 5D2CA 3L3BA 1PHPA 1I6KA 4IMJB 2C88A 3TL6A 1Z0JA 1VZ3A 4EECA 2Y67A 4UTNA 5LU9A 3R9XB 1M9NA 4KFTA 4TL8A 3QX3A 5WRFA 1U8EA 1AXGA 4QDZA 3STYA 2YOGA 4Z0NA 1GL9B 2BMEA 2H16A 2OZVA 3UCXA 1KORA 2IF2A 1J4AA 5AI5A 4BAUA 5LDHA 2JI8A 2A30A 3HDHA 3ZHUA 2HBYA 3IERA 4O4LF 1D2RA 3IEXA 3CISA 2RGGA 3QWIA 1NLMA 4GGPA 4HUTA 1PR1A 1WMFA 1LI4A 1XDWA 1KDRA 4Q16A 4QJBA 4WLEA 2H08A 2GPYA 3P9YA 4QBFA 5KX5F 5L53A 1S6YA 4CLRA 1J39A 3D64A 1CYEA 4YMTA 2CUKA 4KR6A 4L0DA 2B5WA 1N2JA 5FAXA 2Q4EA 4D0NA 2XGJA 1C0IA 1EGAA 1PYOA 2AMLA 2WKRA 3PVCA 5A71A 3GRKA 4H4EA 2WLSA 2YJZA 4XR9A 3RJTA 2Q3MA 1XTBA 4HDSA 4BFVA 2HV9A 2FLVA 2PUCA 1EPUA 1GSHA 2DQ4A 3AHCA 3VR5A 3EBPA 4L95C 4URUR 2GFQA 3FMOB 4QHTA 2AD5A 1UM8A 3G6KA 1Z5WA 3AIKA 4OK5A 1T4MA 3HUEA 3L8GA 4Q21A 4C0AC 2GXQA 1AQUA 3CWCA 2YBEA 1WLYA 3KYBA 3N8HA 4CQMB 4GW3A 1P7ZA 2O2SA 2DCUA 3H5WA 1JEAA 4ND3A 2GWHA 2Z1MA 4IDGA 1IDN1 1V7QA 1FRFS 1SEVA 1T9KA 1VJTA 2PANA 3GXBA 5AKLA 1T2AA 2PSDA 1RYEA 5E0OA 5F4BA 3S2FA 5EXDA 5KQRA 1XDDA 3HB9A 3L6RA 3ORYA 1DHTA 5T64A 3TBHA 3MAAC 2P1RA 3LY5A 4Z2YA 3K1AA 3RSFA 5E2IA 2OCKA 3I72A 2Q1YA 2DG2A 3RR2A 4R3WA 3FMPB 4U2GA 3DPUA 3IV7A 2V3VA 4OJYA 3EEFA 1TC2A 4JBXA 2E7ZA 1Y6ZA 3VR2D 2J67A 5F77A 2C54A 4L51A 3L7JA 4U8HA 4AJNA 1Y6JA 2F8MA 3RVJA 4P81A 4JWKA 4EPXA 1O5OA 3L7IA 4F38A 3QPBA 4KXNA 5EHGA 3VH1A 4BOYA 5HJ5A 5FFMA 1C0EA 1D6JA 3MQ2A 4KEAA 4FFLA 1ZM3A 2R8PA 4O4JF 3IBYA 3KSZO 4M8NE 1S3IA 3DOUA 3IJ5A 5E38A 5DV9A 2J45A 4OP1A 5EVJA 1HKHA 2ZJ0A 1U4SA 2Y1WA 3DM5A 1W8DA 1OI4A 3EF0A 3OOSA 4MQFA 1JSLA 4RVDA 5HZMA 2B20A 4EMTA 1Q22A 1XQ9A 4L08A 4RK1A 1OI7A 3JX9A 4CMIA 1QF6A 4QRHA 3CCCA 2XYHA 2YWDA 4OB7A 1TW2A 2PTHA 2FQ1A 3H0EA 3FCCA 4DLVA 1LBIA 1LQTA 2C0QA 2G6TA 3ESBA 4PFJA 5LJLA 5BNTA 4R40A 4DLZA 4FOSA 2QTGA 5BWBA 3TR5A 2SBTA 3L8DA 1MMFB 1M2HA 3MGKA 3PDIA 2QIOA 3FHOA 2ATVA 1JECA 2BR5A 1ZLYA 4EYGA 3G6WA 1K97A 3B2EA 1TQ8A 4LMPA 2ISQA 3JQ8A 3FSEA 4KO2S 3T7DA 2JI6A 3HLKA 3KAKA 2CXHA 3AERA 1EWVA 1JDBB 5DT9A 3WNQA 3CVWA 1XWWA 2QN6A 1N9KA 4ZTUB 5I7RA 1MNAA 3OLQA 4YRNA 2ZT5A 2Z83A 3PB3A 1RM3A 1W2GA 2YIMA 3B48A 1HG0A 2VXCA 4H4CA 4BL5A 3L6UA 4GZMA 3AHJA 3ZG6A 4BVLA 3T7IA 4AP5A 5JS6A 4YCJA 1KSGA 1OI3A 5F3RA 3MGGA 2WJ4A 5EPOA 3H13A 4C7BA 2XOXA 4RZUA 4QNNA 1IWOA 5DU2A 5DTJA 3ZZ1A 4Y1RA 1SHUX 2BH9A 4OB8A 3AY7A 3Q9NA 2OM6A 4ZT4A 3RC2A 2FLKA 1WOYA 2QK4A 1DIRA 1QP8A 2FEAA 3VR6D 5AVJA 2PV7A 3VUFA 4W5QA 1PKXA 2ZUSA 3FJOA 1NJ5A 4UAJA 4DZZA 3GROA 3PU6A 2HRCA 2AXQA 2ZJ3A 4BRZA 3R9WA 1Z0ZA 2Z2ZA 1L4EA 3KVVA 4EWLA 4DJAA 2I1VB 1VPDA 3OEWA 2NSDA 3PD0A 3BA1A 5ES4B 4I9NA 3L7DA 1QO7A 1N4AA 5A4MS 3WL8A 4OUDA 4JCOA 3SC3A 3HJGA 1L5KA 4ADSG 2ZSFA 5ALPA 2NUPA 1G21B 1EEXB 1JHZA 2PRSA 3K09A 4Q4JB 4YFYA 2CXQA 1R66A 3QM1A 4ROSA 2JLSA 4OA5A 3WLRA 4RNCA 4S1NA 2EWMA 3K16A 4XOIA 4CFSA 4JB8A 4TVSA 2E6KA 1AGNA 1XHEA 2PS1A 1CJBA 2GTIA 3LKZA 1XD2B 1HYEA 3V1MA 3GY0A 3ZVMA 3A2LA 4LQDA 2ILTA 1Q1ZA 5J47A 3PQ3A 4A92A 5K0ZA 5DGDA 4P82A 2QRLA 1JVNA 1KIFA 4DLYA 2X3YA 5KEIA 3MWEA 3TSCA 4ZHQF 4MVJA 3ETGA 1E3JA 2XXBA 3W5SA 4LXHA 3ESDA 1T13A 2DR3A 1OA0A 3GA5A 1R2QA 4W6QA 8MHTA 2ZE8A 3WQHA 3FJ1A 1PS0A 4Z54A 3PGJA 4RADA 1R6DA 5KOIA 2JNWA 4XJSA 3CXRA 3RC1A 1G5TA 3SJ7A 4L5JA 2C84A 4AIRA 4HXEB 1BE0A 1PUIA 2DT8A 5C5CA 2J3KA 4X5OA 3SI7A 4K1LA 1AK9A 3KR1A 4TLMB 1H2FA 1L4MA 1AXEA 1Y48E 5DB4A 3QYJA 3RVLA 1OAOA 3VFDA 2Q28A 4IEFB 5CJPA 4NZZA 5DNAA 5EPUA 2LDXA 3UENA 3T3EA 3IR7A 4L5AA 3SX0A 2EFCB 1EHIA 2QW1A 4DNQA 2X0FA 3RFFA 1OIWA 2YFKA 1RLOA 1Q6ZA 1UT8A 5A6SA 4YUWA 5AKHA 2JBWA 1KEPA 3JQDA 2MSNA 1XTKA 4NMXB 4E1AA 4CEIA 5JY1A 3GLUA 4EX6A 1SOUA 2B2NA 1DTSA 4DNPA 4GKKB 3T06B 2HHCA 1NUHA 2VUSA 1TCAA 2WHRA 1TZCA 2D1TA 4CETA 2Q5QA 1KYQA 1O96B 4HTFA 3GLGA 2ZJAA 4I1VA 2ZRJA 3OIYA 1M1YE 3QLJA 5AOBA 3GLKA 2FDXA 5I9LA 4L0MA 3NANA 3X0DA 2J9XB 1A5BB 5DGXA 1ZGGA 2ZE5A 1QCYA 2HLNA 2X9NA 4I50A 4B7UA 4FGUA 4BN5A 2YJ5A 2P9YA 3FZNA 1ZD4A 2FWMX 4ZALA 1IN4A 5LA6F 4B83A 4CMEC 2BKUA 2HEIA 3AJEA 5IUKC 1AUOA 4LE1A 2NXNA 4EQZA 1NBIA 1ESEA 3AWIA 5KYKA 1QP4A 1OXXK 3G0CA 3DVAB 2Z6VA 1VIDA 4AP6A 4DV1B 1ODTC 1PD0A 3EUWA 2B98A 1SVWA 3SYTA 3VDQA 1PU2A 1T5IA 3HP4A 4CTJA 3GFPA 3V6MA 3RVPA 2NZXA 4DOMA 3CZMA 4JOSA 1E1LA 2PKYX 1J23A 3V1LA 3EGWA 2PSHA 2I91A 3ENZA 4GPIB 1T9DA 4MS4B 1PWXA 1K75A 1GNRA 1RQ2A 5JD5A 3B9PA 1SMKA 3SQWA 3L8CA 3HGTA 3OKPA 2GN4A 1HE3A 4KWCA 2Q4DA 2IK8A 4OHZA 8ABPA 4G0WA 4MW9A 2Q2VA 1LTKA 1T2CA 3QEKA 3WL5A 3ZCTA 3FBTA 1P7WA 1SEPA 2AR7A 3LI2A 5J2TF 4A2PA 1V7ZA 4LUCA 4WLFA 4J7AA 4PG7A 1XA3A 4GKVA 1NF3A 3B5JA 1TYEB 2WIGA 2ZI6A 1Y1PA 1XUOA 2BR4A 4QDXA 2XI4A 3BHNA 1SRRA 1T3LA 1TF5A 1JMYA 1GN8A 3VU0A 2JGNA 3SZGA 3WGTA 3ULKA 1OLXB 2PGLA 3WZLA 5L3SA 1M5RA 3TRKA 4B74A 4WE3A 4PIVA 1QYRA 2OHVA 1C1DA 4N6OA 5BW6B 2YJGA 2XB6A 3TUZC 1IXSB 3CVVA 3PKZA 2QTTA 2F1KA 3ZQUA 3COJA 1UZNA 2EJTA 4PSCA 1ZBDA 5CT8A 1CZLA 1CUBA 3RRBA 1SK9A 1Y34E 1FMCA 2BZSA 3B6EA 1YVRA 1I7PA 4BHTA 1JGTA 1H69A 4XIIA 3SX4A 5IZCA 4E11A 5GIPE 3E53A 3PNMA 2PGXA 1PK8A 2SICE 4GUDA 2H3HA 4K6CA 5ILQA 3IHKA 1W48A 1YB4A 2P9EA 3ZWPA 1BH6A 4ENUA 1TRKA 1CB0A 2ZJ4A 3QBEA 4Q9HA 4AJJA 2UYCA 1PG2A 1HZZA 1ZW6A 1TI7A 3B85A 3SQDA 4D8UA 3U7GA 1RRCA 2BY4A 3H2ZA 5M04A 3J81k 1JU4A 1WBJB 1FOEB 1I33A 2C5LA 2VT6A 3IULA 2QL9A 1YFZA 5FCDA 1O0BA 4BVHA 1R8QA 5A4JA 3H19A 4LDAA 1EQUA 3EE6A 1NUPA 3O8OB 3L5KA 2YJ4A 2ZJ5A 4XGQA 3R0JA 3FPEA 2C95A 4J2HA 3AVOA 5LQDA 3AR4A 3GNSA 4GDMA 1TVKB 3FMIA 3HNPA 4MWEA 5E6RB 2BE9A 3OZUA 1AU9A 2P3SA 2XF8A 3AJAA 5DO9A 3ZI7A 1S96A 4HX9A 5K4HA 5GWXA 2V5AA 2LKCA 2WU4A 4UNQA 1HNZB 4NI5A 2JHCA 3HA2A 1KI6B 3STVA 2YWFA 3NCHA 5KYUA 3WBJA 10MHA 2Z0MA 1GXSA 3CYFA 3DBVO 4XGIA 2ODEA 5ARDA 4B6SA 2JFPA 2VK1A 1FXWA 1NVDA 1T4CA 5CVJA 4G5HA 3M6AA 2OORA 1ENZA 2HQBA 4V1CI 2H7XA 3BSWA 4UU7A 5CGZA 5HFJA 2VPWA 4I08A 1J5XA 4E51A 4RHTA 2V3CC 4P53A 3LWDA 4EHBA 1SKQA 1NXQA 1RZVA 2CVPA 2JCVA 2YFQA 2CZQA 3QUSA 4IINA 5EUCA 1JEOA 2XQIA 3BF7A 1RT9A 2HIMA 4DDUA 1I6MA 3C8DA 1DEOA 1XLWA 2OHOA 2OLJA 2VSNA 1C1XA 3B5IA 4KE6A 3SEAA 3QWFA 3U81A 1YSCA 2GCNA 1GQFA 3AEZA 1EFDN 1KWGA 3LQ2A 4FB5A 3IEMA 1XP8A 1SN7A 1TADA 1BJKA 4IMPA 1XU9A 5F7ZA 4D41A 1E2MA 5DGCA 2RHGB 4GVPA 2I9KA 3ND5A 3U60B 3X2EA 2CNOA 3AH8A 3I2JA 5LZ2A 1ZL2A 2YZGA 2UYHA 2G0AA 1LBHA 1LKZA 4B6PA 3LOQA 1UIRA 3I39X 3OZXA 1FCJA 4MW0A 3E58A 1QKJA 2VJMA 1E20A 2YY6A 4DA4A 1SC1A 1XK6A 3KNZA 4W5OA 4B3TB 1OHHD 4BLUA 4ITRC 1TM1E 3Q15C 2J0UA 2ZIFA 3S1SA 1J42A 2VZLA 1D2MA 1E2EA 1O57A 2ZBDA 2XCQA 1V5EA 3KK0A 4ZVPA 1NTOA 3HNOA 2P69A 4PYIA 4FTWA 2IVZA 2RCNA 3TTSA 3EG9A 1TJ5A 3UWKA 1CVIA 1QFJA 3LPNA 2XVYA 3D0KA 3Q3HA 2WM3A 3CT4A 2Q9BA 3OIDA 4IZ6A 4QEKA 5AI0A 4U3JB 5B12A 7MDHA 4C2UA 2JEZA 5CVVA 3SHOA 3OEHA 1CUDA 5C1IA 2PRZA 2Q6KA 1ST3A 3VNRA 3T99A 1ETUA 3GNQA 2FGJA 4YJFA 2QUZA 4J94A 2JRCA 3B7WA 1DQNA 2VL7A 3KQYA 2ATIA 4BNUA 1UEJA 1YWGO 5FUVA 3GDGA 4IZHA 1QCCA 4M1WA 5KYXA 5M34A 1PV1A 2PSFA 2O8FA 2V5VA 3IQIX 2XVAA 1PQYA 2VF8A 4OX9Y 4WY2A 2JD1A 4K6KA 1DQPA 5I7SA 1GCGA 2NXJA 2AXPA 3LXXA 2ONKA 5G4KB 3G5MA 1WEKA 2W2NA 2GZ3A 2GMWA 4WERA 5AO9A 4CKCA 3VPSA 4DMLA 3GP8A 1FFEA 5IM5A 3D0QA 3SIXA 4K9KA 3CE9A 4RGBA 3U4AA 4XA8A 4EGCB 4F93B 5JSHA 3I61A 3FPGA 5GZ3A 5C8XA 2QX9A 4CL3A 1DT3A 3B2QA 1PSDA 2DKOA 3VOAA 4NRDA 2ET6A 2DUJA 3LW8A 4MOWA 1WL8A 4WKCA 5EJ6A 1ODLA 2TECE 3JARB 2IWHA 1GKYA 1Y7LA 3GJZA 4IIBA 3S29A 3C5WP 4F1WA 5IK2A 4LK2A 2R5NA 3L7CA 5IJXA 4N18A 2QD4A 1OILA 1V5FA 1ZOPA 3TSYA 3NM4A 2HU2A 2IP4A 3HZOA 2V9CA 3TDKA 5JHGB 1GR1A 2VDQB 1GWNA 1WEHA 5EJ8A 2ZT8A 2GRJA 1MABA 4FN5A 3DXFA 3P9XA 1XDSA 1LJUA 2E48A 2I62A 5E1BA 3RT9A 3VU1A 4YRZA 4PYRA 5EMJA 1Y3BE 3RUPA 2ZVPX 3C14C 4TV8B 1PKEA 1UK6A 2I2DA 1VFNA 1V43A 3ZWDA 4IRXA 4X0EA 3RG2A 1EB9A 1ZIXA 3ONNA 2B8WA 5JS1A 1EP2B 2J5BA 3LBFA 2NYRA 4EKNB 2FU5C 4O4LA 3LUKA 4OUDB 1EK2A 1BEUB 1OWOA 1YQTA 2ZSBA 3E7PA 3I5MA 3PEWA 2J0QA 1Z6TA 1AK1A 1SURA 1AKVA 1KH2A 2C7GA 2Q7XA 4XGKA 1EXVA 3MMPA 5KAMA 5F5NA 1FTQA 1ZIOA 1R18A 1TUBB 3SPXA 3RQIA 3O4RA 1E98A 2VT7A 5CK5A 3P7MA 3BGWA 4BV8A 1R3DA 4NDZA 4WVFA 4M9XA 5EE3A 3NEYA 2H8GA 3ABSB 1FUEA 3GELA 4NYIR 3R6GA 4A8JA 4TMWA 3SP1A 1ZIPA 4MWCA 3C3DA 2EFJA 1VLJA 2Y4NA 1F8FA 5ABPA 4HMQA 5HKBA 5FUWA 3UFXB 2EWWA 1T9AA 1Z36A 1XZMA 2K2WA 1B8OA 1NVUQ 3PLRA 3GZTB 3KB8A 4HSGA 4XYGA 5TQVA 3I2GA 1UBMS 3MIZA 4RVUA 4RTLA 3VNSA 2JGDB 1DKNA 5BRNA 2IV2X 4IVQA 4DXAA 3F3KA 3RUFA 1PUXA 4QOFA 2WIAA 3LK6A 4TYQA 4DNFA 1CVLA 3TK1A 2BGWA 3ZJ5A 3O92A 4Q9JA 3A27A 3N2GB 2FW9A 3AEUA 2NPOA 4IJUA 3NEJA 3KOYA 1NY5A 3AI3A 3NHSA 4N0QA 5DNVA 4BFCA 4EELA 3IUEA 3ER9A 4BNMA 4TXNA 2QENA 1NPDA 4CMIB 1XQ6A 3GEPA 1XTUA 2GTPA 4OAQA 3RTCA 1O6FA 1BMFD 5EAIA 2HMWA 4QOGA 3JAWA 4GYWA 1VL2A 4MQFB 5KVVA 4ZQEA 2WR8A 2I3GA 3AUSA 3KFXA 4G97A 1P44A 5E1MA 4TQAA 2FSPA 2ZB4A 3V4PB 5HWSA 1NPTO 1L4YA 1J8FA 2ZOSA 3RYHA 4C7OB 2RBGA 2XUFA 4FKMA 1JJBA 2GCGA 2FPLA 2ODQA 1S5PA 3DC7A 4LCEA 2JFFA 1RABA 4I5FA 4OLHA 4CM7A 5KNDH 2D0IA 3U37A 3T1VA 1YAJA 3VR4H 1XBTA 2Q4RA 3I4FA 3Q5DA 1UKYA 1AMUA 2OV4A 2B4YA 3AW9A 5ERGB 5IF3A 3CA8A 1Y1TA 1I51A 4G0QA 3SXUB 4DKXA 1O6GA 2D2FA 2HF9A 1ZQ1A 4D44A 3UG7A 3L1KA 4MKGA 4CF7A 4ZP1A 3W9UA 5CNMA 5L45A 4YAGA 1XZJA 1UXOA 2AKEA 1KI8A 2QX4A 2WTAA 4YLGA 4Z51A 2C61A 4XUCA 4R8KA 1D0IA 3GJSA 2WIFA 1MJ5A 4DQUA 1FSPA 3RGWS 4H60A 2QX8A 2BEUA 3JYQA 1KAHA 3Q3GE 1QU2A 3K94A 2Z04A 4OBXA 1J20A 1G8AA 1CY6A 3K09C 4IBOA 4BNXA 2IYPA 1L5MA 5IT4A 4P2GA 3T4XA 4RSHA 1E1NA 3DA8A 3FUXA 1FFXA 1XTRA 2ZIAA 4UCWA 5DTIA 2WP8J 1Z68A 5FNVF 1T4GA 4ZEWA 1C4OA 1C9KA 4ALLA 3KFVA 5G0TA 3KB1A 1IBSA 4YJ2F 2Q6VA 2OV6A 4M9UA 5MN4A 1G2IA 4OQDA 5EIEA 1QK4A 1TQ6A 3MGAA 4CF6A 4P7FA 3G2MA 3EXEA 2V4ZA 5EJ2A 3RU3A 2E87A 2GN6A 5LXTA 4FHCA 1SCAA 1NNLA 3Q2OA 1YI8A 3B9QA 4OHYA 1K98A 1RLTA 1TE2A 3USZA 2CLFB 3LCUA 2C5AA 3WV5A 4AL4A 2FDCA 4RC9A 2BFPA 5AQEA 4UAGA 2R68A 3RYFA 1QK5A 2RDMA 3IBSA 3LKBA 4IX1A 1NXPA 3IT3A 2VQ6A 1HYQA 4W1QA 5P8WA 2JVJA 2EQBA 1PJ2A 1WUIS 4TTSA 4RQBA 2NTJA 4UEQA 2FN7A 2IEGA 1Z7WA 2YNMA 4XJXA 5LB4A 1TKRA 3NKLA 4GD3Q 3IVXA 2GVNA 4MYSA 1RBZA 4XAQA 2I8LA 1ZRSA 1JYSA 3NAGA 3PWZA 4GI2A 4JXKA 2Z9DA 3BWEA 4QPPA 3SDSA 5CFPA 1X7HA 2P6UA 2A1UA 4IF4A 1OOEA 3JQ9C 4IO0A 4TZTA 4AC9A 4RELA 3S99A 5FTMA 1U9JA 3P4YA 2O20A 2OQRA 1DLIA 2PLFA 3B9BA 1BROA 4FZJA 4M7RA 3TUJC 4QXQA 2G71A 2CN1A 4KLAA 4UXJA 3T9AA 4QFBA 3TXAA 3V42A 2VA8A 1KBOA 1A4UA 4V0SA 3L0SA 3W3AA 4ZIRB 2DM6A 4Q1EA 4UNRA 1QK3A 2DWQA 4Q1DA 4ABTA 2C94A 3BTOA 4KAJA 5JVDB 4BEBA 2XNJA 4CMCA 2FRDA 1Z2CA 1MC1A 2CKDA 5GJVC 4CV3A 1D2GA 4R83A 5M2QA 2D1RA 3NB0A 1NQTA 4DEYA 2A78A 4EW2A 4IG9A 4LZJA 3MMZA 1DJLA 1FDOA 2G67A 3I83A 3WOHA 1NJGA 1H4VB 2R7NA 1A4IA 1GNPA 1XKXA 1A8PA 1QMGA 3IQWA 4GX2A 4HZIA 4MPDA 1Z7EA 1Z4QA 1P1HA 1I3LA 1MEOA 3D3KA 5KWSA 2BBTA 2HA5A 4BNIA 4LOAA 4OHBA 2C9CA 3TJMA 1DCKA 4OTZA 5I8WA 1JUDA 2RAVA 2V74B 3GJ3A 3Q41A 4G1CA 4ZVTA 2IUUA 1CRZA 2NYVA 2X8AA 3E8SA 5EN4A 2BVNA 3NAMA 1DBVO 1RWQA 4UOZA 1ES9A 1C7FA 2IH4A 2Z5VA 1NVGA 4NCAA 3QG1A 4L9SA 5GPBA 3H1TA 3O93A 4D43A 2GAIA 3RUDA 2JD2A 1EUDB 1FMLA 3MJSA 4XD7A 4GVXA 4WNIA 1J99A 3BZWA 2J0EA 3GPDG 4JNCA 3UANA 3H9JA 1TCCA 3EXHA 5C8DA 2LV8A 1GRRA 5JWHA 3D3WB 1KY5A 4RX1A 2EXXA 2Q8NA 3NAZA 1OIXA 1P0MA 3W2HA 3L4JA 4FGSA 5HKKA 2BLLA 2JFVA 2WU8A 1X9HA 1PFUA 3H9QA 4HDKA 4NOLA 5DBEX 5FDFA 1C7IA 2E4WA 4B48A 1A69A 1BOFA 2GPSA 3VMFA 4ALIA 4AZWA 4JUAA 3ED5A 4E6PA 3I4CA 2D1FA 3HSYA 3QYPA 4WXYB 4Z9BA 4BVJA 1DBRA 2D4AA 2FX3A 5HILA 2PZBA 1EMDA 1NVXQ 3UK0A 5JHHB 2JCSA 4M60A 5FO0A 5NULA 5A3RA 4ZCQA 1WB6A 4I4NA 1D2AA 5TPWA 1G7CA 4AJ2A 1B93A 3ANNA 4ZC8A 4R2IA 4Z49A 4DWWA 1WZIA 4ND1A 5KOJB 4NMHA 5ECDA 1NJ2A 4UARA 3MPUA 4KFSA 2RGYA 3IUBA 3VKHA 2E1PA 2E6UX 2ZE6A 1J8YF 1YBAA 2P30A 3JQ9A 3DEHA 1L5QA 1N7HA 4J9VA 2ORVA 5GV8A 3BFVA 3ZDRA 2EDCA 2D0PB 3MYRA 1PJSA 2V8OA 3JVVA 3TINA 3OF3A 2WICA 4ZCSA 4P34A 2ZATA 4R71A 3UJAA 2AG8A 1DAPA 2WG0A 3GT3A 3D7MA 4UHBA 5J43A 5E7IA 3JWEA 2R6ZA 4LX0A 3U7IA 4RIHA 2X5OA 2CK3D 2PFKA 3STTA 5D7BA 4A36A 2XQKA 3DHEA 5DHPA 1SCJA 5JEEA 3RI3A 4WOCA 3BMOA 1SBIA 1W2HA 5KWIA 1L2TA 4ODIA 4BLPA 1PTJA 3QQ5A 2IKQA 2IEAA 4BVBA 2QRZA 1GZ7A 1YB1A 1I1OA 3V2IA 3A3NA 4H77A 4L72A 3D6MA 2I7TA 4AWXA 4DJDC 4KU4A 1R5JA 3M4ZA 1UDRA 3WK5A 2GSWA 2VATA 2YINC 5IAGA 3RM3A 3BXEA 5I4BA 4R2KA 3TW8B 3LTNC 4TYYA 4PSDA 1A4RA 2PWBA 2XKJE 2QSZA 4E5MA 5KC8A 1V5IA 4FQ5A 1WW2A 1C3JA 3AEKA 5DTEA 1GYRA 1V5GA 1PSWA 1RYNA 2J87A 1C3XA 1M1YA 4L15A 4CDNA 5JQGF 1J56A 3DOEA 1ZDMA 4H2DA 1H23A 4HDCA 2QTZA 2NU8A 1UPCA 5CCXA 3G0HA 4LDPA 5FX2A 2Q4TA 2CEKA 2WFAA 3LG2A 2ANCA 1JLMA 3I9FA 5FOTA 3PQDA 1XT6A 1YT5A 2I2AA 2X4IA 3PC6A 5AJYA 5TPZD 2R96A 1WE2A 3TJRA 1PVOA 1M8JA 2G70A 2VK8A 4DLLA 3IMFA 1WQ4A 1N2ZA 4GICA 3HCOA 5LYJA 4IWXA 4PZCA 2REQA 2JFYA 3JVUA 4FUQA 4BO3A 1S3GA 3AHFA 4A0SA 5KOHB 3Q85A 1JS1X 3FNQA 3LY8A 1U5BA 1FY2A 2V7WA 2WJZB 1T8YA 1YOBA 4M6WA 3VVCA 1G4HA 4Q4HA 4O2BA 4Q34A 5KSYA 3A1WA 2C83A 3Q7EA 4O8ZA 4XPZA 2R6CA 3KEOA 3PF8A 5HF6A 2DHEA 2HA4A 2I03A 3PUXA 1RRMA 4MA5A 1TT5B 1NXTA 3DZKA 2ZIWB 4TS3A 4WTOA 3TBFA 2N46A 2GD6A 3DCYA 1NZFA 2WFMA 4D9JA 5C1PA 5IJ9B 4JSTA 2FSUA 2XHEA 4DG5A 5KYVA 1GZVA 3HKEA 2GZMA 4IWNA 2IX3A 4Y2TA 2N0SA 4WX2B 4QHYA 4BGEA 2TS1A 3ZHBA 5BR7A 1NR5A 1HSZA 3CZ5A 3HY4A 3P2IA 5IJAA 3TD9A 4HUJA 3U3JA 5IG2A 3GL9A 3L0BA 5AI8A 4PYLA 2G9ZA 3B6MA 4LBVA 1X9IA 5HCUA 2Y1EA 4MQ4A 4IQ0A 2KE5A 2PGDA 4XIJA 3AUTA 2B82A 1WY5A 5CFRA 3GJXC 1CRWG 3F49S 1WDMA 3OHSX 3RDPA 1J49A 3V4VB 2YY7A 4WNAB 5ADWA 1G3MA 1ZGCA 5FBRB 4AY3A 3PHCA 4CHTA 2DH5A 4P84A 3EWIA 2L69A 1F20A 2WVJA 4U7FA 1NJ8A 1ZJ4A 2W4MA 3K5IA 5JJLA 4HDQB 2X4DA 3LQQA 2W6CX 4YAFA 5HGJA 3RUIA 2V6JA 2EZUA 3EQ8A 1Z25A 1E7YA 2EEZA 3X1WA 2AUMA 2I6GA 1N6LA 2PL5A 5LP1A 1DL5A 3TGPA 2Y6UA 5B6JA 4LYFA 1L5VA 2D7JA 2K2QB 4AJEA 4NQZA 2XMDA 5E1OA 3T5DA 4MPPA 2JJ1D 3KD2A 4N48A 2D5AA 2CLCX 2HN9A 3FDIA 3VSBA 1JKMA 4P9NA 4PYMA 5BUCA 1Q12A 1E1RA 2ZRIA 5K0GA 2DR2A 4TLEA 1CW2B 5MFZA 1SXJD 2IEDA 2K6GA 4CR6A 4HEQA 4L5BA 1P5FA 4K9SA 2F43A 1M6HA 3FUWA 1LX6A 4MULA 3AKZA 1IBKB 1DWPA 1NUUA 3DVLA 4XM1A 1L4GA 2FOIA 1SU6A 2BHSA 2JW5A 3F8WA 3KT3A 3ZJUA 3H04A 3V8NA 2O8EB 4H27A 4CQNA 2D1SA 5LBIA 1QZZA 3N8GA 4RJTA 4PY2A 5EZ5A 2NIPA 2DPXA 1Q6YA 3AYXB 4ZT6A 1BYUA 2G9VA 5I8ZA 3F9CA 4KVAA 1YJ8A 3D8SA 3ZGVA 1VJ1A 3CH5A 3UGJA 3C4JA 4LG1A 4X63A 4RHXA 4GOND 4C14A 1BXZA 1D2HA 1N2SA 2IOQA 2ORWA 2X9VA 4M9CA 4PCVA 4QAQA 4BPRA 5KTTA 2AOUB 4BMNA 4KX3A 1I36A 3D0RA 3EZYA 4KMOA 5COAA 3X1YA 2H2AA 1N5DA 3F90A 5IDXA 1OZFA 2JGDA 1Z5GA 2WMNB 1TPZA 1KC1A 3O4JA 1SBQA 4MR8A 2H29A 1NURA 2X1MA 5DT2A 3WDKA 3EVGA 3Q10A 1I7DA 2OCIA 4OCZA 2VSFA 3ZWXA 4P5EA 5FOVA 3RC8A 1LXCA 3ZCXA 1BTOA 2CVFA 2VN8A 2Q6TA 2FPXA 1EWTA 3ZK8A 1SVNA 3L8FA 4FYIA 2ECQA 3UJPA 4D0LB 3ZW9A 2QZ9A 2UUOA 3V5NA 3EMBA 1S1CA 3HXOA 3L9WA 4KE7A 1MX9A 2C1ZA 1Z63A 1QXSA 2MINA 1GZSA 1L4HA 2XMGA 4IIFA 2O5RA 4LBWA 3H5NA 2RBEA 3T5BA 2PT5A 4RTRA 5TNXA 2QOEA 5EUBA 1UK7A 5G3ZA 3ZW7A 1K9VF 4HY3A 4UBOA 2CHFA 3EOAI