2FFAA

Crystal structure of abc-atpase h662a of the abc-transporter hlyb in complex with adp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
243
structure length
243
Chain Sequence
HHDITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A structural analysis of asymmetry required for catalytic activity of an ABC-ATPase domain dimer.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Alpha-hemolysin translocation ATP-binding protein hlyB
total genus 72
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ffaA00
2YHSA 1QVRA 4G5SA 1H8ED 1YR8A 3GLGB 1KO8A 2FNAA 2C8VA 4WOPA 3CH4B 3GLHA 2VP4A 2W2TA 3C8UA 1CBUA 1P9WA 2MSCB 3ZD6A 2FFBA 2CDNA 4DDTA 2F1JA 4DCSA 2QMHA 1GM5A 4HAWA 2X8AA 3KKQA 4TYPA 2IUUA 1NRJB 2JGNA 1FUUA 1EFCA 2FV8A 1T0HB 5JJKA 4DCUA 1P62B 1KDOA 1NMXA 4NTZA 3EA0A 3BGWA 1Q57A 1OXSC 1CIPA 3NG1A 3ZVRA 1I4LD 3CRRA 3U3RA 4MRVA 5C1BA 5LPNA 4Q7LA 1J99A 3FB4A 1OT3A 2PBRA 1XRJA 4JLMA 2ZANA 3RS4A 5C4GB 4EIWA 1OXXK 4CW7A 2IXEA 3CKLA 1CJVC 2YVUA 4F4IA 1JXMA 5K8IA 4A2QA 4W5JA 4QG7A 1XEXA 2GXQA 3CR8A 1E9CA 5C46F 4DLTA 3B7GA 2HF8A 2Q3FA 3AQ4A 4H1VA 1Z0JA 2EW1A 1LV7A 1DEKA 1W5TA 2WAYA 5SZJA 1PVOA 5EXXA 2XTNA 4JLDA 1BO6A 2RHDA 5BN4A 1S9HA 2R65A 4TMTA 5LD2B 3U6KA 4OHVA 1IXRC 1AS2A 4JVMA 5GVRA 4LJ5A 3P32A 5A4JA 1VHTA 5G3YA 1UKEA 3VR5A 1Q12A 3FE2A 5AJYA 1E2JA 3RSLA 3L82B 3QKSA 5GJVC 4TSFD 2VBCA 4BEBA 1M1YE 1R0XA 2XITA 1NKSA 3GJ0A 4RY2A 3SYKA 5EJEA 5GVSA 1Z63A 1UDWA 3IIKA 3WBKA 3OAAA 2AN9A 3JVUA 1FW6A 1GKYA 1M34E 5IDVA 5JZVA 3GP8A 1ZD8A 1ZYUA 2D3WA 2Z4RA 1GL6A 3CW2A 3TGPA 3ICEA 2FZ4A 2ZSFA 3GJ3A 3SHWA 1KJZA 4KSBA 4FIDA 1Q3HA 2Z5FA 1W44A 4WAUA 4R7ZA 3QUSA 2A5FA 4D26A 4NKRA 4YC7A 1NIJA 4D25A 4PPQA 1CULC 2ODNA 1OKKA 2IF0A 4AURA 4IVPA 2RGBA 1U8ZA 2DFLA 4JLJA 3DOEA 2CNWD 2RB4A 1FTNA 1KSJA 1NL3A 2WKRA 4XSGA 2P0EA 721PA 1SXJB 1S4QA 2DWOA 5B64A 1F2UB 1U2RA 5DYIA 6Q21A 3P4YA 3PEVA 3QKSB 4UNPA 1GWNA 2V1UA 2BMDA 1ZBDA 2XZLA 1E9BA 1DG1G 5HCNA 3ZZUA 1YR7A 2ZJOA 1GG2A 3K0FA 4Q00A 1QHHB 2KJQA 1E2LA 2QMUA 1TMKA 4V0KA 3AF4A 2QT0A 3KB2A 3A1TA 1TADA 4CRWB 5JCPA 1P2UA 1OIVA 2J5XA 4KODA 3AF0A 1FTSA 2JIZA 1YZGA 1KSHA 2JAQA 2YWFA 2ZR7A 3B5JA 3KQHA 1DS6A 2I3BA 2QU8A 1R5NA 2V6JA 1Q44A 2ZRKA 1Z83A 3Q8XB 1OHHA 5J4VA 4AKGA 2PX3A 3QF4B 2OV2A 2ZJBA 3LDAA 3R9XA 3IILA 1MH1A 2VHUA 3IQWA 1UDXA 4NHOA 3QEOA 5ANRB 2GCPA 1YZUA 4HUTA 3LO5A 3QY0A 1BYIA 3AF1A 1W2HA 3KFVA 1XEWX 2DPXA 2ZEJA 1G8PA 3RNLA 4DBLC 3F3YA 2ZS8A 4RZ2A 4JS0A 2GXAA 5JFGA 2GZHA 3NHAA 1XX6A 5FR1A 4BLSA 5JSZA 2QM7A 4PHHA 4KSCA 3SJCA 1KI1A 4JVSB 3W8RA 3RYTC 4GOJA 4C3ZA 2J45A 3QF7A 4HB0A 4AYXA 2QAGA 4BE7B 3TRFA 2O52A 2QTHA 3LVQE 4A0GA 4KO8A 2AK3A 2W6IA 2ZRDA 5HPYB 1D6JA 3T06B 3AKEA 5EZ6B 2VH5R 1ZCBA 1ZUIA 4C0AC 4A8JB 4LV6A 4I1UA 1P2VA 1GSIA 2GEDA 1YZLA 4M9ZA 3A58B 1ELOA 2AKAB 1JBKA 3CF0A 4KAXA 4ZO4A 4X8MA 5KSOA 4GL2A 1DAIA 1KNXA 5CDFE 3BERA 3KKNA 2ANCA 3TSOA 1XCMA 5JHHB 4KLNA 2GRJA 3U3KA 4A0HA 4OI0A 3FKQA 1TUIA 3HU1A 4TT3D 4UNQA 2QE7A 2RGDA 2IXFA 3AGPA 4IDHA 4C0SA 4DSOA 4DT1A 2QI9C 2IYWA 3U61B 2HLDA 1CR2A 1KKMA 3NC1C 1YRAA 3MGCA 2VPPA 4Q7JB 4LYAA 4ZDIA 4CVNA 1OE0A 2VL7A 4P4SB 3K9LA 1DAMA 4LBVA 3UATA 1DPFA 1W7AA 3UMSA 4DRZA 3SJAA 1GZSA 3GLIE 2F6RA 4RD1A 5DHFA 5L8VA 2OAQ1 2ONKA 2EWVA 5DN6D 1XD2B 3FPAA 3MFYA 4PQFA 4IXNA 4RKEA 4US1R 4FI3C 3GJ5A 4TLDA 3UPUA 4JYCA 2RGEA 2ERYA 2OFOA 2QBYB 4DB2A 1FMJA 4MYTA 3SE0A 2W0MA 1N25A 2XNDA 4V0LA 4ZI3A 2WPDD 4U5XA 5D3QA 2WWGA 2KB0A 3K0AA 4RD0A 2HCBA 4LJ9A 3K09C 4L4UA 3ZQ6A 4F4JA 2RMKA 1N0VC 4L15A 3BS4A 3FWYA 5HE9A 5EE9A 3A1SA 4F4CA 1SKQA 3BD9A 2O8BB 1ZUNB 4NP6A 4PPGA 4DEXA 1EFRD 4XWKA 1VCOA 4Q9LA 3SBDA 3DMNA 4LX0A 4URZR 4LJ4A 3FKSA 1E79A 3BB1A 1W46A 4KFTA 5JEEA 3O8RA 4C0LA 1HH4A 5LB2A 1JR3A 1WRBA 4MDEA 2A7QA 2WOJA 1G3IA 1Z0FA 3MCAA 5JI3E 3U4QA 1N5JA 1NY5A 3FKSD 1E2FA 3CX7A 1ETUA 1I4TD 2FPKA 3FYHA 4OK3A 2O8CA 4UXIA 2ZXUA 4QJ3A 4CEHB 4JT4A 5DO9A 3UMFA 5FH9A 4PAQA 2BMJA 2X77A 3WYGA 3BC1A 4G0NA 1Y63A 4CEJA 4KCGA 3SQWA 4KBGA 3I3SR 3OEHA 2B8WA 5FFMA 4NZYA 3RS7A 4GMXA 1EWQA 3SN6A 4NYIQ 3ADCA 5BN5A 2JJ1D 4GP7A 1FP6A 2V9PA 1AJEA 1RYHA 1VPLA 2Q6TA 2HT6A 4QGFA 4Q1FA 3C16C 4FD2A 4UQOA 3O47A 1RZ3A 2LCFA 1EX7A 2GCOB 4M9QA 1G8FA 2A2ZA 4GPTA 2PEYA 3W3ZB 1TQDA 3AF3A 1DBSA 3K70C 1P2SA 2QMEA 5FPSA 4MGYR 3O8DA 4CYMA 5JWRA 4JLVA 3RRZA 4OHZA 1KI4A 3EZ9A 1IXSB 1E79D 1NVVR 3ETLA 3NBZC 4LPSA 3BB3A 4G1UC 1MO5A 5FTMA 2FF7A 5CDFA 1P6XA 1YZQA 3P4XA 1JAIA 4TT3A 3B13B 2AK2A 2IYZA 4XWAA 3AUYA 4J0QA 2O8DA 4URWR 4Y0VA 3GLIA 1YZKA 3I72A 3T5GA 3AVXA 1YE8A 2E87A 4ACAA 2JLWA 1RRPA 4AY2A 5H8WA 2ZYTX 5F3WB 2VP9A 1KO7A 2VRWA 2VF8A 3KXIA 1NN5A 4MA4A 3CRW1 4A8JC 1ANKA 2H8KA 4NU0A 3QVVA 2GXSA 3QQ5A 1JPJA 1XMJA 3RC8A 2XTZA 1TTTA 4LJ6A 1Z07A 2BCJQ 1SXJD 1D2MA 1XJQA 4GNKA 3U7HB 5DNYB 2Z83A 3QVUA 1T3HA 2ZYVX 4LC1A 4RD6A 3T15A 4LJ7A 1M7BA 3CPHA 4YDHB 5BYKA 4G3XA 1VIYA 4Q4LA 3C15C 4MYHA 421PA 3NHBA 5JHGB 1R2QA 4PAOA 3B2EA 3X1DA 3HR7A 5CK4A 3ICQB 1NVUQ 1D2NA 1LS6A 3LV8A 2IYVA 4ESVA 4IDQA 3THWB 2PCJA 3GLFA 1HE1C 2UVQA 5AUQA 2OLKA 3R9IA 3L2OB 2J1LA 3TLXA 5FI1B 4JIMA 4BUJA 1GRQA 4V0ME 5F98A 1OV4A 4HATA 4LDJA 4OHYA 1BMFD 2AR7A 3LWNA 4PO9A 4IKEA 5CLLA 4M0LA 5BYJA 4B2IA 3OZXA 1D8TA 1XD2A 1G18A 1JECA 4L9SA 4Z1MA 5G41A 2N42A 3WNBA 3GJ4A 4RD2A 1WXQA 4ARZB 2EYUA 1KJWA 3LRPA 1II0A 2ZRPA 1TF5A 1KI8A 1DVRA 2GEVA 2OBMA 1EFHA 1G20E 3TSZA 4AYWA 1VCNA 2BCGY 3BFKA 1ZUHA 1KSFX 4MITA 2LKDA 4DT1B 1HYQA 1QRAA 3P20A 2VF7A 2WJHA 4A0FA 1CJKC 4BFTA 3AVWA 1W0KD 3N2EA 2Z0MA 2P5SA 1IN7A 4M1SA 1KNQA 4OQXA 1AA9A 1HQYE 4IEIA 4U02A 3Q85A 2P6NA 3ZH9B 2K5UA 4PXAA 3QOFA 4Q01A 4BGDA 4MH0R 2V6IA 1M7HA 4GMDA 2Q3HA 4HUQB 5FL7D 5JECA 4V0NA 2PT5A 2AXPA 3D8BA 2FN4A 4B2LA 2C77A 1N5KA 1F5NA 1KDRA 2F9LA 2IHYA 4TL8A 1Q1ZA 2CLCX 4KFSA 1P73A 2WWYA 2G1KA 3EWAA 1C1YA 1S2MA 4AKHA 1E4VA 3GLFB 5EP3A 4IRUB 2ATVA 2QP4A 1OIXA 5TARA 2GKSA 2W00A 1SKYB 3QEJA 3EIQA 1PJRA 2FFHA 4ILEA 4URXR 4JKYA 1CJMA 5A5GA 3AP3A 3B9QA 4QBFA 2BKUA 1TF7A 4JLNA 1VDZA 3SBEA 2D4HA 1JI0A 4GOKA 3RS0A 3KJGA 3W5IA 4QM6A 2QNRA 2QSZA 3UK6A 1FQJA 1BOFA 3EPLA 1Z2CA 2FU5C 4R71A 2W6ID 1N6LA 1UPTA 2QSYA 4QFMA 4DJTA 1WQ1R 5L3SB 4TTPA 4DCVA 1X86B 2QGNA 3K53A 4JYBA 2P67A 3VNUA 3AV0B 2FX3A 2QRNA 3VKHA 2HYIC 4LV8B 1EXMA 3T35A 2XNDD 2ZIAA 4Q4HA 2ZVPX 3I92A 1CU1A 1JQLB 2GZDA 4MUAA 1HEIA 1KO1A 2CCKA 1OFTA 1OXTA 2CCGA 1GVNB 3GLHE 2CK3A 3MRSA 2WHXA 2OFWA 3QBTA 1G4UR 4Q4AA 4RKFA 3U7GA 4JBWA 1TF2A 4YMUA 2J41A 4OL0A 3VTKA 5DGXA 2J59A 2YNMA 2WAXA 2WWFA 4RJLA 4UJ3A 3IPYA 3PENA 1OH7A 3VR6A 1FPMA 3U7EB 1G4AE 5EZ5A 4EFLA 3PUWA 5KTYA 2OM2A 2ZRFA 4IOJA 1N6HA 4AD8A 4Q66C 3J81k 4Q7MB 1K6MA 3U3OA 3C5CA 2ORWA 4N0EA 1QHIA 3Q7PA 5FPYA 2Z4SA 3I8XA 5BXQC 3PJRA 4PX9A 4MKHA 3FFAA 3W3AA 1ZRHA 5UKDA 2KBFA 4Q4HB 3EZ6A 2F43A 1R0ZA 5IF9A 1SHZA 4BASA 3K9NA 4OI1A 4QGGA 3KX2A 1VYUA 4C2UA 2OCYC 2IS4A 4JL5A 2OILA 2CMKA 2G0TA 5L3SA 4ZV4A 3OEHD 3QE0A 4O0MA 3ZS9A 2DBYA 3CRQA 3SZRA 3R9WA 1IXZA 1DELA 3B1ZA 2Q21A 2XNSA 4Q1AA 3RANA 2EFCB 1G6HA 2VA8A 2NOAA 3QKRB 4LV5B 4QGAA 3T1TA 2A5JA 1SGWA 3KZ1E 2W83A 3T1QA 1V5WA 2Q0HA 5E95A 4WW0A 4TMVA 1LF5A 5TY0A 3PEUA 4URYR 2EWWA 1XMVA 4G01B 4LYJA 4Q7KA 1ZP6A 4IFBA 3QJYA 2X1VA 3GMTA 4TZ0A 3THXB 4EPXA 3WY9A 2JLSA 2IXGA 1J2JA 4BZPA 4RSGA 3VR4A 1DE0A 5DI3A 3SJBA 4ZDJA 2GVDC 3HDTA 1YRBA 1QHSA 3T1VA 2BJVA 4M9XA 1D5CA 5J47A 1II8A 2WIBA 4TL6A 1KI9A 5CLQA 1AN0A 4B3CA 4DWJA 1JJ7A 2GK6A 4ASUA 2DCUA 1IN5A 4M1WA 3B8HA 2JATA 4MGIR 5FR2A 5TVKA 3T34A 2XTMA 5AK0A 1M74A 4QJ4A 2RGNA 1N5LA 3I1FA 5FUXA 2CL7X 3Q5DA 4GBMA 2GXUA 3QXHA 4KYIB 4NCJA 4Z8XA 3Q7QA 2QRZA 1G41A 1ZINA 3OFNA 1KYIA 4JT2A 3GLFE 2JLXA 3TAUA 4BPBA 1CKEA 4B6EA 2B92A 3NBYC 3HP1A 1UF9A 1J90A 3TAHA 1P60A 2G83A 3KFXA 1P3JA 4ZPXA 3SNHA 2ZSBA 3IDQA 4ZIRA 1KDPA 2ZUBA 4L9WA 4W9MC 3W8NA 2B8TA 3DVLA 2C03A 2C96A 3KQUA 4HLUC 3UG7A 5FBQB 1VYVA 1E0SA 4ERNA 4EDHA 2LWIA 3QENA 2IUSA 4TL7A 2QG6A 4W5HA 4TZ6A 1ZNXA 2WBLC 3VX3A 4EJSB 3ZGXA 1S3GA 2CL6X 3OE7D 4PQRA 1JEEA 2ZR0A 2H17A 2WMOB 3RC3A 1T8UA 1CF4A 1C9KA 1KI6A 2F1HA 2IYUA 3WBJA 2ZRIA 2D2FA 2REBA 3QPWA 2J7PA 5HKKA 5HKKD 1KY3A 3QPUA 2YOGA 4R98A 4BLRA 3C7KA 3R20A 1UFQA 2W2XA 3CF6R 2RGCA 5SZIA 2VP2A 1LW7A 1E99A 3ZS8A 1T6NA 1HY3A 4C0KA 4ZCIA 4I4LA 1IN4A 3HU3A 2HEIA 2PLFA 2JLQA 1WBBA 1KY2A 3LXXA 1R5BA 1GRRA 2ZI9A 4PHGA 2QQ0A 4M8NE 4LI0A 3MJHA 4US0R 1Z3IX 2BC9A 1D9ZA 1IY0A 1C4OA 4PO1A 4S35A 3NBFA 3ZVLA 2XGJA 3QKTA 1N5IA 2ODWA 2NTYC 1TEXA 1T4GA 2B7BA 2VLIA 2YZ2A 1FNNA 4U00A 3UIEA 4D80A 2IS6A 3CPEA 1W1WA 2CHVA 2JIZD 1UBGA 1E1QD 5FL7A 3EZ7A 5DI3B 3NH6A 3VU9A 4LHZA 4M21A 4XVQA 3ECCA 1UBFA 2PMKA 4NONA 1IONA 4LRWA 2MSEB 3B1YA 1LS1A 1AK2A 1NVXQ 3I4LA 4EKDA 2XZOA 1T3SA 4DLYA 1RJ9B 1E1RA 1OYYA 1XTKA 2G9NA 3T12A 4OHWA 2P3SA 1XWIA 4HEJA 2IYYA 4LJYA 3UMRA 2ORIA 4LK2A 4EQ6A 2HV8A 3U6BA 1XD9A 5EXTA 3CZPA 3O8CA 2KSQA 2A3RA 1H8EA 3U60B 5KSPA 3TW4A 2E1RA 2D74A 2IEYA 1E2IA 3L0SA 1G21E 3LY5A 3REGA 2PX0A 3GQBA 3EWSA 1N3BA 2I4IA 2OESA 3THXA 2BEJA 2ZJYA 3N2IA 4HB3A 3KQLA 3I61A 3RWMB 4FMDF 1E3MA 5M04A 4O25A 1BH2A 1E2MA 3CNNA 3CR7A 5K8UA 4MRSA 4NL4H 1JNYA 121PA 1X1SA 5IHPA 1FUKA 1FNMA 1W36D 4OQMA 3I5YA 2J87A 3B60A 4B6FA 2V7QA 3THYB 3PQCA 2O8FB 4Q03A 2JLVA 1XTJA 2GJSA 1MRSA 3E1SA 1E1QA 1G19A 1NY6A 2FPLA 1F60A 4AWXA 4Q4JA 2ZJ8A 3QKRA 4OKSA 5IT5A 2XB2A 1TQ2A 3QG5A 4LBYA 2CE2X 1OXVA 2O8BA 4UXJA 5FI0B 2OXRA 4IXMA 4B3BA 4B48A 2EFHB 2R6CA 4XJXA 4TQUS 1E4YA 2ZR9A 5EP2A 1XCGB 1KJYA 4D4KA 4D0LB 4M1TA 1JJVA 1G6OA 2D2EA 4KV9A 3RRYA 2PCLA 521PA 2F43B 1K5DA 2E9SA 2WIAA 4ZIRB 5GJBA 1EX6A 2GAOA 5EUQB 2A9KA 3K0AB 5F2EA 1BYUA 5DLQC 4YQFA 1QHYA 3LH5A 1RRFA 2XB4A 1I2MA 5KDDA 2N46A 2R8RA 3L0IB 2OZEA 1OXUA 4OK6A 2Y8EA 2G88A 3NDBB 4PC6A 3FFBA 2WWHA 4LY6A 1COWD 1A2BA 1XZPA 4PTLA 3M1IA 4NE2A 1E2NA 3WYFA 5TMPA 2WICA 2Q9CA 4WXRA 4K8OA 2J9RA 3K9HA 4S2EA 4UNRA 1XB2A 1BKDR 2BBSA 3OE7A 1KI3A 1XNJA 2D62A 4JSTA 4UXHA 4B3FX 4GOXA 1R5OA 1XMSA 2IWRA 4KVAA 4EJSC 2ZTSA 4M9SA 3ZVNA 4FMDB 1YZTA 4M2LA 3M6AA 3P27A 4LBWA 4A82A 1RFLA 2QAGC 1E0KA 2IA5A 2O8FA 3IQXA 1EG7A 3VKWA 3ASZA 1U99A 3IHWA 1SHKA 1VECA 4KI0A 1VCMA 2FGJA 1E2HA 2H5EA 2YWHA 4V02A 4WVFA 4DSTA 1A1VA 2H1LA 4L16A 3DPUA 4DZZA 3MWYW 4GRAA 2D7DA 2D7CA 4PSVA 1J70A 3R8CA 2HXSA 4EFMA 1DG3A 4MRNA 1W5SA 4GZMA 2GVZC 3IBGA 3GFOA 4HLCA 3LXRA 4X8LA 3H2YA 5KPJA 3BFVA 4BLTA 5FOWA 1TNDA 3D3QA 3AF2A 4XH9B 3LA6A 4C0JA 2GJAA 3Q3JB 1G3UA 3ND8A 1U0HC 3CNLA 5JSZB 4FXPA 3GD7A 3LAWA 3WYAA 1GTVA 3DDCA 1UEJA 5JCZA 5B58C 3OIYA 4BFWA 2OCBA 3CRMA 1Z2AA 1E96A 3FMOB 4OJQA 2HCJB 4KBFA 5LBIA 1E0JA 4MGKR 4WA7A 1EFTA 2QENA 4AKIA 5HE8A 2DWQA 3T5DA 5CIQA 2KWIA 3AM1A 3LFUA 4JJKA 1KTVA 5CIWA 3BH7A 2O8EB 2QA5A 5B57C 3PVSA 4B3XA 3DO6A 1FP7A 3G5UA 1E32A 2ZI6A 4ACBA 3VHLB 4DSUA 2IBMA 4TMKA 3OHMA 2P6UA 2FFQA 3LW7A 4PANA 1P72A 5D3MB 4IDNA 1G8YA 3KJHA 4QNRA 1U0JA 4EPRA 1N6PA 1W4BA 3QIAA 5IK2D 1CS4C 5KPDA 5KU1A 2R6GA 2WPDA 3NBXX 2ZAMA 2O5VA 4Q4AB 3FHOA 2W58A 1XEWY 5GADl 1XPRA 2ZS9A 1Z6YA 4RVCA 5L3VA 3KQNA 1SXJA 1S1MA 1RIFA 1ZIPA 3WRYC 3E5HA 1PLJA 3A36A 1IN8A 4UJ5A 3KUDA 4E22A 3A6PC 4KYUA 1AS0A 1T91A 1IQPA 1WB9A 3PV0A 1QG2A 3THWA 3QG1A 1BIFA 1BMFA 1NBME 1DAEA 3PUYA 3BORA 2RCNA 1TUEA 3Q9LA 3WMFA 3TBKA 1E98A 1W0JD 3LLUA 3ASYA 1RRCA 2FSGA 4RD4A 4AKEA 1KAOA 4PSAA 2EFDB 3I73A 4UKDA 4YLGA 1XU4A 2IYRA 1IHUA 4NCHA 3PITA 1CR1A 3WNDA 3NEJA 3G82C 1PZNA 1IJEA 5JBQA 2GJKA 1QHNA 2GBLA 2F1IA 1XEFA 1VTKA 1W0JA 2IYLD 2AKYA 3K1JA 2EYQA 1CR4A 1NVWQ 1JXOA 2OFXA 3MJRA 4QXAA 3LQQA 3E70C 3BK7A 1J8YF 1HQCA 1W2GA 2GK7A 2FEOA 1M7GA 2C9OA 3MD0A 4GZLA 4AC9A 3DMDA 3KXLA 4JBYA 4A6PA 4BRWA 1OSNA 4I1SA 2ZRLA 4D0GA 5J4LA 1KHTA 1M6NA 2OG2A 4JMPA 1COWA 4URUR 1WE2A 2VO1A 2QUZA 1DAFA 2YWEA 4TLAA 4M4SA 1EESA 2O8EA 3UWKA 1NLYA 1G7SA 1QZXA 4PHFA 4TYNA 3GLIB 4A0RA 2ZUDA 3A1WA 3RS2A 621PA 4OBEA 2GCOA 1S9DA 2JJ2A 5EE0A 4DLXA 1NG1A 1SVSA 2QPTA 2XXAA 2GESA 3VFDA 1FX0A 3UWOA 2ATXA 1ESMA 3SOPA 2J0QA 2R44A 3QNUA 4HLUA 3DOFA 5CK5A 2G77B 1SQ5A 3MMPA 2WV9A 2J0UA 3L0OA 4B76A 4LHXA 2H16A 1KOFA 4G5RA 4HZUA 3KQKA 2QEQA 4NDZA 3PUXA 4PSKA 1H65A 4NYMR 4PFSA 2JASA 3W6PA 2MSDB 2JJ8A 3SS8A 1RRGA 2DYKA 3H0KA 2VHJA 4N1AA 4YMTA 3KB1A 4NBSA 4CEHA 1A82A 1XCPA 2CL0X 1NI3A 3AEZA 2O8CB 1R4AA 2GCNA 3QSYA 1ZJ6A 3FHCB 4PO8A 1XF9A 2W0SA 5JRJA 3FGNA 3DKPA 1S1CA 1Z29A 1CEEA 2ZU0C 2XJ9A 1XBTA 1YHNA 2V54A 2ZREA 4ESHA 1CRPA 5KDOA 3FOZA 3GLGA 1OB5A 4C9BA 1W48A 3MAAC 4KU4A 1PLKA 1GNPA 2JDID 3CWQA 1O3YA 4RFSA 2BBWA 3PUZA 2RGAA 4HSEA 4O2LA 5TDHA 3AH8A 4PQYA 2RAPA 4M1YA 3WP0A 1W4RA 4IHQA 2ODEA 5KSYA 1CJTC 1ONBA 3V00A 3X1WA 4JVLA 2ODBA 2ZE5A 3EASA 1HURA 4HAUA 2KE5A 2R6FA 3ADKA 3GPLA 3JVVA 3MSXA 4TYQA 2REXB 3NIBA 3FMIA 2P6RA 1OH8A 1DO0A 5DN6A 3PEYA 1NJFA 4H1UA 3SDZA 4F91B 4JSYA 5DISB 3B6EA 4A92A 5A0FA 1FFHA 2BVNA 2BKEA 3U5ZB 3TK1A 5HZKA 1Z6GA 2V55B 3MLEA 1H8HD 1ZNZA 2RHMA 5EXSA 5KNBA 4RZXA 4F7WA 3NDPA 1W47A 5EXPA 5L3QA 2VHQA 2JLRA 3GJ8A 1MO3A 3QBVA 3U2QA 1IAQA 1KO4A 2VP0A 4JVNA 5L3QB 3X2SA 2GNOA 3EAQA 4TSFA 1Q1BA 1VYTA 1R0WA 3SR0A 1HTWA 1KK3A 1VG1A 2DHRA 2Q3MA 1GNQA 4WZAE 2WWIA 3DEFA 1IM2A 2A5GA 1Z6XA 4MUBA 5FTJA 3SI7A 1Z0IA 4DDVA 2QBYA 5C18A 3R7WA 5FPTA 1KK1A 1N6IA 2VP5A 2ZS7A 3LW8A 3I32A 4U7DA 4W5WA 2AFHE 1HT2E 2ZJZA 1VCIA 2G0NA 4PZLA 1HV8A 3NTUA 2OBNA 2ERXA 3CLVA 4PC7A 1DARA 4B3DA 2WVJA 3F5FA 3KUCA 4L5BA 3WMGA 4PHTA 3THYA 2F9MA 5KOYA 1P4SA 1S8FA 5EP1A 3KXKA 3VQTA 4CT5A 2HDNB 2GZAA 4OJKA 1T0JB 1I4DD 1VKJA 4WZ6A 3GFTA 2TMKA 4EFNA 1G9XA 3CB4A 4LHWA 4RFSB 1NF3A 2NO1A 1Y3AA 1RC8A 1QG4A 2DFNA 1NIPA 2QAGB 2GBLC 4LJAA 4CEJB 3GJ7A 3HYTA 4DLZA 4Y0AA 4MYUA 4R2HA 4XWOA 4KLZA 5TB5A 1XZQA 4IVRA 5D3MA 4HLDA 3NWJA 1DOAA 3AP1A 3KKMA 3TQFA 1AQUA 4XVUA 1NSFA 1ZC4A 4HB2A 1Q1EA 4B47A 3U3JA 5HZHA 4PPFA 4YXWA 1KSGA 2JLYA 2C95A 2LKCA 5LD2C 3RAPR 4KJZA 3AVPA 3PXGA 3BJIC 4MKFA 3KJEA 5GJCA 4BRUA 821PA 1P9RA 3TQCA 4ZKDA 2IT1A 4IOLA 2HT1A 5JWOA 4QOSA 3WXMA 4OK5A 3DHWC 4A2WA 2FPMA 3ZYCA 1KZ7B 1TX4B 1M2OB 2CLSA 1E2KA 3EW9A 5C4MA 1NNEA 5KYKA 3D7MA 5LDDC 4TMZA 1XJCA 2IHBA 2FEMA 2OSBA 4OQNA 1Z06A 5EQTA 5E4FA 1X8KA 5FBWB 1X1RA 2WKPA 5JWHA 3PUVA 1QHXA 1G5PA 1QDEA 4DXAA 2IS2A 2GETA 4B74A 4BLPA 2V3CC 5J4YA 1KMHB 1MR3F 4LUCA 1T8TA 5E7JA 2FJUA 4C0HA 1ZVQA 4JZKA 4GSYA 2ZUCA 3MWJA 2XX3A 1OHHD 5FBVB 5ELXA 4K81B 3HPQA 1P61B 1XP8A 1NMZA 2B21A 4G5GA 4PPNA 5FOUA 3TH5A 2WSSD 2CLDX 4RCZA 5EE1A 2XZPA 3VX4A 4DIDA 4Q1CA 1AZTA 4Q1BA 1GIAA 3C5HA 3SHFA 1KI6B 2WJIA 1SVKA 5AUNB 1XDBA 3BH6A 3DM9B 3QXSA 1XMIA 5IRCD 1G64A 2IL1A 2WJYA 4ON9A 2FWRA 1CP2A 1GAJA 1N6OA 4B34A 3IIMA 3B78A 4II7A 3TR5A 1Z0DA 4EAQA 1IN6A 2YINC 1KO5A 1X3SA 2BBTA 1MV5A 3AVTA 5E3HA 1TU4A 3BOSA 4OHXA 4CZ2A 2CJWA 5E7IA 5FUYA 5EE5B 1W36B 2CNWA 5BWMA 1ZNWA 5CITA 1JALA 4BQSA 2OLJA 5JRZA 1MRNA 3OEEA 1WF3A 4ZCLA 3QXJA 2WSMA 4Q1DA 3TUJC 1OLOA 4YMVA 4FN5A 5FPKA 4D4JA 4DUGD 1GOTA 5GJWC 2IWHA 3WHLA 3L8YA 3K8YA 1PV4A 2IYXA 2AXNA 3A4NA 3H84A 4TMWA 5FBLB 4EUNA 2W6JD 2RH5A 1NN0A 2WKQA 2Q9BA 2FMXA 3NH9A 1K8RA 3PG5A 2CVHA 2QT1A 3KDSE 1TQ6A 3QXCA 3K70B 4WZBE 4XD7D 5FBRB 5AJWA 4KFUA 2HLDD 1WCV1 4ZCMA 2JEOA 3LX8A 3Q72A 1S0UA 5DHAA 1T3LA 4LZZA 1A4RA 3UG6A 1MT0A 3AB3A 3U7FB 4TWZA 5EUMA 1ZMXA 1II8B 5FTKA 3KL4A 4HB4A 4TYWA 2EU8A 2NO7A 1Z6TA 1JR3E 4HAVA 3AKCA 3A4MA 3IPXA 4IJMA 3QPVA 1JR6A 1VG0B 2RGNC 3K9GA 5JEDA 2J46A 3C4JA 3L8ZA 4CEIA 1OYWA 1US8B 1G8GA 1AQYA 1OPXA 1VMAA 4JJZA 1EFUA 3IUYA 5FUWA 1P75A 5J40A 2YOHA 2CE7A 4OQFA 1J8MF 2O0HA 3IEUA 4JLBA 4LHYA 3RLFA 4B44A 3GFPA 3K0FB 2CHGA 5AJVB 3WNCA 2BMFA 2IW3A 2IYTA 4YMWA 2QTVB 1RKBA 5J5CA 4Q1EA 3K0SA 2J7KA 3I5XA 4DHEA 3BAFA 1Z5ZA 3NEYA 1T5LA 4TQAA 3PFIA 4Q9IA 2AD5A 2OAP1 3CUEF 4IDOA 4A36A 3W90A 2NQ2C 3L43A 4RZ3A 1P5ZB 1YVDA 3BH0A 1XTSA 3QKUA 3X1ZA 2PZFA 1YKSA 5CJPA 1ODFA 4WBSA 5AWFC 1ZC3A 2ZRCA 2H92A 5P21A 3KTAB 4CT4B 1HA3A 2OCPA 3SEAA 4ITRC 2DY1A 2Z6VA 1A5TA 5HCIA 1EWRA 4DUGA 3EIHA 4MRRA 5BN3A 2MMGA 1XXHB 4D4LA 4DKXA 1TPZA 4MYCA 1SVWA 3H1TA 4DVGA 3FHTA 3NKVA 4LPKA 1E2PA 3AVVA 2ZITA 1G7TA 3SYNA 3LVRE 4LCBA 4P31A 5CB6A 3K70D 4Q9HA 3U44B 4QBIA 4TYYA 3SQXA 4IOKA 2JDIA 3SC3A 1Q21A 4PC1A 3ADBA 2FSIA 1XXHE 2QAJA 4W7SA 4XOIA 1E1RD 4HAZA 2ZRMA 4LYFA 4I1OA 4Q9JA 3PCRB 3CBQA 4A4DA 3W5JA 4ARZA 3ZLJA 2ZRGA 4Q9KA 1CRQA 2VSXA 3THOA 1U81A 4BFXA 4CIDA 2FDCA 5DE3A 2IYQA 1PLLA 1SZPA 2J3EA 2WJVA 1OFIA 1WP9A 1MKYA 4IDPA 1OH6A 1E9EA 1Q1QA 2ZETA 4M53A 1B0UA 4Q21A 1AM4D 4LGMA 1VG8A 1N6NA 4NCKA 4DC9A 1E0AA 2GA8A 1SKYE 2NZJA 4P3YA 3VNVA 4QBHA 3EG5A 4P32A 4QNMA 5DH9A 2A5DA 3FTQA 3WMEA 3B1VA 3ZIAD 4P33A 5JJIA 1RYFA 1G1MA 3CNOA 2VYFA 4BFVA 4ZDWA 1E9RA 2ZJ2A 1KZGB 2KI5A 3CPJB 3QI2A 4D81A 3JZMA 4Q4JB 4XTCS 1E2GA 2B6HA 3TKLA 3SFVA 2ZJ5A 3UXMA 1OF1A 3A8TA 2PL3A 3N70A 4D82A 1CXZA 4ZI2A 2FG5A 5E7MA 2C2HA 4GT1A 4Q02A 1NN3A 1NN1A 1DAKA 2ASEA 2ZRAA 3KKOA 4TLEA 3DKVA 4BFSA 1OB2A 2YJTD 5JMTA 3SU8A 4WIAA 1LFDB 1UJ2A 4QGHA 1L7VC 5C2JB 3RRNA 5H68A 2RKOA 4CF7A 4DLSA 4FCWA 2W2VA 3C41J 3GLHB 4WXPA 1GFIA 3TIFA 4B2PA 4DLUA 2NO9A 4AIIA 3T1OA 4B33A 4E07A 5G53C 1ESNA 3R8FA 3HWSA 4PAMA 1W4AA 5TV2A 1KMHA 3G0HA 1KGDA 4M1OA 1F2TB 1G16A 1YR6A 3VR1A 3LX5A 2NO0A 2JCSA 1Z22A 3TVDA 4EQ6B 4MGZR 1ZM3A 2WMNB 1AS3A 3ND9A 4B43A 1P9NA 5AJZA 2QGZA 1NJGA 5K8TA 2ZE7A 1HE8B 3HJNA 2I1QA 4F38A 2XJ4A 1R6BX 1V43A 4P4UA 4EPWA 5FTLA 3K0CC 2GDJA 4BLOA 1H8HA 2GWHA 2XOKD 4QHTA 3A1VA 1GITA 4FW9A 1L8QA 1ZM9A 4R9UC 2C99A 2JLUA 2GEUA 4NCIA 1E94E 4M1MA 2GF9A 2ZE6A 2IC5A 5CM9C 2W6JA 4E5UA 2ZYWX 3RHFA 4D6PA 1L4UA 1S3SA 1W0KA 1MABB 1ZW6A 2QM8A 4V03A 4A1FA 3RS5A 5DYGA 2WWWA 5F9HA 2YKGA 4JL6A 1F2UA 4E03A 1L4YA 5JI2E 1B23P 4QBGB 4KXFB 5IK2A 2F3TA 3KJIA 1N6KA 3CIOA 4C7OB 2NO6A 3WRXC 3GEEA 4Z1MD 3ZJYA 4MKGA 3H86A 2C98A 2VQSA 1RW4A 4NYJR 2J0SA 3DL0A 4POAA 4AYTA 3ZZTA 2RGGA 4IW3B 3GEIA 5KO2A 3ZQJA 4HYYA 2VIIA 4MQBA 1U8AA 2HJVA 3QXXA 1LTQA 2ZRNA 3W34A 4BFYA 5B30A 3ZDQA 4G5OA 2JA1A 4TTRA 2A30A 2EVWX 2VSOA 4JKIA 4H9GA 2G3YA 4YMSA 1CLUA 5CJ2A 3AKDA 2X2FA 4EJSA 1G3RA 2OHFA 1R10A 3R7WB 1FZQA 3L0PA 2ZRJA 3ZD7A 2QMOA 2VHTA 2AWOA 2DFTA 2CVFA 4OI2A 3CX6A 1TU3A 4NYJQ 1IJFA 4B73A 2BOVA 4C30A 3UKDA 1DAHA 3AKYA 5FOSA 2CK3D 4JLOA 1T5IA 2OEPA 2NMVA 5JS7A 1W36C 1U8YA 5EP4A 3VMFA 1TAGA 3PR1A 1VIAA 1ZD9A 5G3ZA 1U90A 5KSZA 4C0BA 2BHRA 3CX8A 3EIEA 4I99A 5SZHB 4HLQB 5FL3A 1US8A 3H4MA 5CB8A 3RSOA 1QHGA 5J4KA 1R0YA 1NSTA 1U9IA 3B82A 3LBNA 2HUPA 1IY1A 2WM9B 3ADDA 3VAAA 8OHMA 4HUQA 2IYSA 1XD8A 1FMLA 2PH1A 1BS1A 2FOLA 3OIWA 1XEXB 3P1JA 1E9AA 2IEZA 1Q20A 3C14C 2QZ4A 3OIVA 1U9IC 4Q5IA 3BBPA 2QP3A 4YXWD 1S96A 2GJ8A 2H18A 2OBLA 2J0UB 1NKTA 2FSHA 3CRVA 3CH5A 4GDFA 4LOAA 2XSZD 3NXSA 5L3RA 2DWPA 5H1YA 1WDTA 2Q9AA 1CJUC 2OCAA 2YV5A 4XTRA 2RGXA 4NPHA 1AIPA 1Q0UA 2R6AA 2ZSEA 2ZSAA 4QM7A 3EXAA 2V4ZA 2QTFA 4Z51A 4DB4A 2B7CA 4QKQA 1FL9A 4FMCF 3A4LA 3HPRA 4BECA 3S1AB 2EQBA 3MWLA 1X6VA 4D0NA 5J4HA 1UKYA 1Z47A 4LHVA 1AGRA 1TL7C 3U4QB 2ONJA 1AKEA 2SHKA 1RVDA 4BZXA 1P2TA 4KITB 1OFUX 2VEDA 4PZYA 2ZQ5A 3DZDA 4FCTA 4C0QC 3MWKA 1GRNA 2C78A 2QP9X 1TQ4A 2HF9A 1HUQA 2BM1A 4AG5A 2O0KA 3LD9A 4AK9A 1G17A 4Q47A 4Z54A 2OUKA 4QC2A 3EC2A 2NIPA 4EPYA 1GKUB 3VR3A 4X8HA 1W4CA 3TMKA 4TL9A 1L2TA 2X19A 4CDGA 1JR3D 1GILA 3NC0C 2VHCA 1M8PA 5G40A 1ZU4A 1E9SA 4Q19A 4TLBA 4BEJA 5KNDA 2R2AA 2DFKB 2OO7A 1UM8A 2JLZA 1F6BA 4OYHA 4HI0E 1G3QA 2QN6A 4DIEA 2AFIE 4DSNA 1QVAA 2VSFA 2X2EA 4HDOB 4P4TA 5JJLA 221PA 2FH5B 1ZNYA 4PC3A 4X8OA 4I1VA 1N6RA 3EA5A 2FSFA 4EPVA 2V8OA 4F93B 3RDPA 3IHLA 3X1YA 2JJ2D 4B75A 1XTIA 5FPHA 3TJZA 4E09A 3LQRA 4BZQA 2GAAA 3AUXA 4P4SA 5H70A 1A2KC 4QHSA 1W49A 5SZKB 4A9AA 1EGAA 2F1RA 1KI2A 2OT3B 3GLGE 4XSHA 3PEWA 1Z8FA 4OI4A 3Q5EA 1KK2A 2FE4A 3E2IA 2R6DA 2R62A 1Z28A 1N0UA 5KDLA 4FMCB 2F55A 2DB3A 4TTQA 4DLWA 3CWZA 1XTQA 2CXXA 1CR0A 3T61A 1R7RA 3EZ2A 4JL8A 4NYIR 3CZQA 4BLQA 4RD3A 5AUOB 5AUPB 4V0OA 1U94A 2OXCA 1D2EA 3EX7C 3GJXC 2C5LA 1OIWA 4CGZA 1PUIA 3M0EA 4LYHA 1KAGA 2C04A 3IBYA 3HR8A 4DEYA 3AVQA 3EPJA 4US2R 1YQTA 2HXYA 2AHOA 2IK8A 2IX3A 1JB1A 1NBMA 2H57A 1NVVQ 5FUVA 2O0JA 2HJGA 2WJGA 3F0TA 1JEDA 3TUIC 1OH5A 2ZE8A 1ZAKA 2XSZA 3BRWD 1D9XA 3AGQA 4IVQA 3BXZA 2O8DB 1UEIA 2VP6A 1SVOA 5HTKA 4DDUA 4C2TA 3X1XA 2ZI7A 3WHKA 1E9FA 2GHIA 4P0TA 1LB1B 3CM0A 4GFDA 4FWIB 4QRHA 1F48A 3TVTA 2ZI3A 1R8QA 1MABA 4EPTA 3S1AA 1RJ9A 2ZRHA 1XTRA 4FWTA 5KUTA 4QL3A 2J7PD 4A15A 2REOA 2CEAA 1X8JA 5JS8A 4B3GA 1R8SA 2PZGA 1ZM4A 3B9PA 3AVOA 1E69A 5KHOC 2GF0A 2R9VA 3ONWA 3FVQA 1AKYA 1ZM2A 2IF2A 3CO5A 4HDCA 3DZ8A 1SXJC 2P65A 1UKZA 3W6OA 2YC2C 3KKPA 1RPZA 2IUTA 4GP6A 2V1XA 2BMEA 1FX0B 2UZ3A 1X8LA 4A2PA 4Q18A 3HYRA 1NLFA 2ZPTX 4FMBB 3ZIAA 4MKIA 1GP2A 2KBEA 3EPHA 1U98A 4G5QA 4UNNA 1LF0A 1QF9A 4NMMA 1E6CA 1NBMD 1G5RA 3MUFA 2BJWA 3RABA 1KKLA 3RS3A 4HZIA 1T9HA 3HU2A 3CF2A 2G6BA 3F8TA 4B35A 3U3MA 3B1WA 1U0LA 2G1JA 2V7QD 3OFND 2BDTA 4IOMA 1SXJE 3M4YA 2EFGA 3RVBA 2DR3A 1G7RA 5K8LA 4DLRA 1G8HA 1WBDA 1ZU5A 3BFXA 1XJ0A 1UBEA 1FOEB 2JJ1A 2XAUA 3A37A 2FZLA 2BWJA 2Z43A 1EK0A 3I8SA 2MMCA 2BEKA 3WP1B 3A1UA 3B1XA 2ZROA 2QROA 3P26A 2UZIR 2ANBA 2CJWB 4NYMQ 1JQJC 1Z6AA 2HYDA 4GI7A 3TNFA 1G7CA 1Q22A 5AJXA 2BM0A 2ZJAA 1E2EA 1Q3TA 1KDTA 4LSGA 5FOVA 2ZI4A 3UANA 1Z0KA 1OKKD 1SVMA 1WMSA 3LBIA 4JLPA 5AR1A 5HR5A 4KVGA 2YOFA 1J7KA 1G3MA 1IY2A 2WJJA 2NG1A 4N0DA 1E2DA 1YR9A 2ZRBA 4RZUA 1XFAA 2XEXA 5FOXA 3CONA 4B71A 3NVAA 2GILA 4KHZA 1Z0AA 2I1VB 5LB4A 1UBCA 2QQEA 4Q48A 4LC0A 5KNCA 4YONB 3TW8B 4R2IA 2XOKA 4JBXA 1NP6A 4NCNA 2CCJA 3GJ6A 2PLRA 5BQ5A 2ECKA 3BIFA 2ZVQX 3BB4A 4TMXA 4TQ9A 3EZFA 1AGPA 2PEZA 3IEVA 2QE7D 4C7OA 4UNSA 3W9YA 2WTUA 4A6XA 4URVR 4TLCA 2AL7A 4LBZA 2F3RA 1DO2A 4DLVA 3V9PA 4HZUB 3IIJA 1UKVY 3JZAA 4LWZA 4O2RA 2WZQA 1PUJA 4M22A 1KIMA 1N2CE 3O8BA 4BFZA 4ZDKA 4ABYA 3I62A 4KFRA 1LVGA 1SULA 3B85A 5JLJA 3K0EA 3GEHA 3K09A 2XXAB 3GCGA 4IFEA 1MO4A 3TE6A 4XIGS 2CHQA 1UAAA 1NLZA 1G5TA 4ZKEA 3TSWA 2YWGA 4O3MA 1GNRA 4TN1A 3BE4A 1DAGA 3VU9B 2ZSDA 3LNCA 4QHYA 1TEVA 2C9YA 1JPNA 1MO6A 1ZD1A 3IGFA 4A8JA 3AVUA 4MRPA 3KTAA 5FOTA 1I2DA 2OE2A 2QPOA 4HAXA 3RRMA 2GJ9A 1ZM7A 1II9A 1QHHA 2ZU6A 3LBHA 1GUAA 3MG9A 4M1KA 1OJLA 4B32A 2H7VA 1RE0A 4AG6A 4BFUA 2QL6A 4XD7A 1F2TA 2N1BA 2PJRA 2A78A 3IO5A 2ZM5A 4JLAA 4PC2A 4DCNA 4JLKA 5DSZA 2BIFA 4D4MA 2EFEB 2P2LA 1VG9B 1CTQA 3VR2A 2FGKA 1KI7A 4BWYA 3EARA 1UADA 2UKDA 1HT1E 1OFHA 4PR0A 3REFA 2PT7A 3RWOA 1F3OA 2AX4A 1ZCAA 3OAAD 4XVRA 3D31A 5DI9A 2QORA 3OEED 3QF4A 3D6TB 5BW8A 1E9DA 4CEIB 2WOOA 2GTPA 1KMQA 2NGRA 3IO3A 4Z8YA 2AWNA 1LNZA 2ZYUX 4YDSA 4D2IA 3AVYA 1O87A 2YYZA 4V0MA 3OF5A 2P5TB 2VTKA 2FFAA 2BBOA 5CM8B 1N0WA 2L0XA 1LY1A 3BWDD 3V4FA 2BV3A 1NG9A 3SYLA 2IS1A 3EC1A 4DDWA 3TUZC 4FCVA 4AI6A 2YC4C 4MDFA 1JAHA 2ZI5A 1GKIA 2AD1A 5CYPA 1E2QA 2PMDA 3FMPB 4PZZA 4RCYA 2J0VA 3VKGA 2CBZA 3EPKA 4ASUD 1SVLA 1WA5A 1YU9A 2ZAOA 3VHXA 3ZZ0A 4I81A 3N5CA 2A5YB 2PZEA 2PJZA 3IKJA 5EE3A 3SFZA 4OQLA 4IEEA 1OW3B 4HAYA 5CYOA 1A7JA 1GL7A 2WSSA 2NZ8A 1KK0A 1VHLA 5FTNA 3V4RA 4RFVA 5B2ZA 1IOZA 4N3NA 4C4PA 4HDQB 1K5GA 1AZSC 1FQKA 4QJ5A 2NPIA 5DIFA 1XPOA 2D06A 1IBRA 1YZNA 4L8GA 3ZVMA 1YJ5A 1MOZA 2FA9A 1DTSA 1NMYA 3TR0A 1EFRA 2WWXA 4DCTA 3AP2A 3FDIA 3OESA 1GDDA 3LLMA 2ORVA 1P7CA 1QBKC 3U44A 3FMFA 3SJZA 5TXGA 2QY9A 4FINA 4F92B 1Z08A 2NPFA 3DM5A 1DADA 1GL9B 1XXHA 3OIUA 4K46A 2QPAA 1ZIOA 2F7SA 3K0CA 2C9CA 3W6NA 1XPUA 5F9FA 4NH0A 1SVIA 1G291 4LJ8A 3PIRA
chains in the Genus database with same CATH superfamily
3MMXA 4AW9A 2HGSA 1FLVA 3PE6A 1VE5A 5JPIA 1KS9A 1NXTA 4WOPA 3CH4B 3GLHA 4NQRA 4EHJA 3K6JA 2UZ1A 1YTUA 2QXYA 3C8UA 1CBUA 2AMYA 1W5EA 3LSTA 4RE6A 5KHLB 2FUEA 4L73A 3E9EA 4B3RB 2UZ1B 4LDAA 3R7SA 2QMHA 1GM5A 1YE5A 3WGYA 3EG9B 1KGSA 4Z0NA 1YJQA 4AZ0A 2FV8A 1YHZA 1QBGA 3GT3A 4L5YA 5JJKA 3W5VA 1ACMA 2YHUA 2RG7A 4J0CA 4PBSA 1XO1A 1OXSC 1U9CA 2HZ7A 1CIPA 1TC1A 3G9QA 3NG1A 3ETNA 1UJNA 1DRKA 3SS9X 4EFKA 2X5XA 3ER8A 4OH7A 1PR2A 3DGEC 3I9V6 1H2HA 1OT3A 4MI1A 3A3YA 3AWDA 4MUXA 1ZVMA 1CEQA 5B1DA 5C4GB 1T2NA 2JD0A 1OXXK 1CJVC 1PF7E 4A2QA 5MGNA 2I1WA 3AFNA 4W5JA 3A3NA 2GXQA 2W42A 4MUEA 5KTOA 1YOVA 3A32A 4HEA1 1QG0A 1ZD2P 5A3SA 1KS2A 2EKDA 3VBCA 4BMSA 1EAYA 1H22A 4C6RA 5BRJA 2QRLA 4LMPA 1QH8A 3L1UA 1K7FB 1LV7A 1W5TA 2CVQA 1H3NA 3ROTA 4BB0A 2KLBA 3S5JA 4FOLA 5IJ0A 1BO6A 4WNAB 1FFAA 4OCZA 1K08A 4OU5A 3WJAA 5ECGC 1AS2A 3BHNA 1M6VA 5GM2A 2PBLA 1Q12A 3G7UA 4DYVA 2V9CA 2J33A 2BGTA 1HSZA 3D02A 2OG1A 3QKSA 4HGRA 1L3CA 3JQAA 3NBKA 3MIZA 4TSFD 5GJVC 5T67A 2LDXA 2AF4C 2YR0A 5FI3A 4Q6BA 3JQEA 2NPOA 1RCFA 3SYKA 3LWZA 2CV0A 4CLEA 1XCBA 3NBQA 2X1LA 3E1GA 4TV9B 3WBKA 2AN9A 1XZBA 3JVUA 1BC5A 3L07A 2H31A 5BQPA 6ADHA 4HX2A 4LDRA 5JZVA 5BN1A 3GP8A 1C29B 3JATA 1ZYUA 2D3WA 4LMAA 1ZH6A 2OOSA 2Z4RA 4PVCA 4PX3A 1PZGA 5E2BA 3TGPA 2FZ4A 4ZQFA 5JQGB 3CLTC 4IX9A 3FPHA 3SHWA 1ABBA 4G89A 1Y8CA 3N1UA 1Q3HA 1P7ZA 5KAMA 4WAUA 1TMYA 1EXDA 1A0OA 4N48A 1WV1A 1RCUA 4NJMA 1XC7A 3Q3GE 4U7PB 4Y6PA 3K0KA 3OKCA 5U1PA 2QTWB 1QK5A 3KEMA 1CULC 3ROGA 3P9QA 1OKKA 4WVLA 1HRDA 3JQ8A 2DPLA 4WADA 2HXGA 1U8ZA 3RK4A 3CLSD 1FNSA 3DOEA 5ADWA 4DUZB 2CNWD 1P5FA 1QGYA 4ERXA 1RQRA 2WKRA 2P0EA 1ZK3A 2JFNA 3C1OA 4K6GA 1HFJA 2EEPA 3DAOA 3U40A 5B64A 4MA5A 4QTTB 4A73A 1K8QA 4P82A 4GO1A 1XCLA 4N5NA 5DYIA 4R3UC 3L8MA 1TVKA 4BMOB 6Q21A 2G70A 2JF0A 1QX3A 3QYPA 5FDFA 3NRBA 2XZLA 1XDGA 4I5IA 1R8XA 1DG1G 2QTVA 5HCNA 3ZZUA 4CG0A 1U1CA 2AW3A 2Q1UA 1JKXA 1GG2A 3PFKA 2KJQA 3O03A 3TGLA 2R7AA 1TMKA 1IAVA 3KOZA 4V0KA 4X62B 2VXYA 3LQFA 2JI6A 4FZ5A 4LTNA 1ZSVA 1EFLA 1JLHA 5JCPA 4Z2YA 4WJKB 2CXNA 3CVVA 1ZRNA 1B7GO 2YYYA 3MCVA 4RZHA 2QK4A 2OBYA 1O0BA 2Y4OA 4XI9A 3B5JA 4Y2XA 5AQ1A 1VKHA 4QQNA 4QUHA 3NAMA 5TE9A 1Q44A 3HGTA 4YAIA 1X39A 1EB9A 4UQPA 2Z58A 5FORA 4U9HS 2Y2UA 3E4DA 4QU0A 1U2EA 1MH1A 3WLFA 1B3BA 4Q7EA 2BYTA 3DYIA 4IP0A 4MWSA 4H1TA 4AFNA 5ANRB 2GCPA 1YZUA 4Q3CA 3CTMA 1MXFA 1BH6A 1M76A 4HJXA 1EP2B 3NR2A 4QDOA 3KFVA 2DPXA 2H52A 4P4LA 5FKJA 1QQ5A 5KTTA 2ZS8A 2D4AA 1UOQA 3GWZA 4JS0A 2RK6A 1GLGA 2GUGA 5JFGA 5JSUA 1BMTA 1KEEA 3NHAA 2D8MA 3BXFA 4BLSA 5JSZA 1EX1A 4IGAA 1IN1A 2XGGA 3T5CA 1E5VA 1E92A 1KI1A 1TMGE 2GFIA 2J9YB 1XCOA 4JB8A 2B25A 2DLCX 1JB9A 4PWYA 1E6WA 3EMDA 2QAGA 1E6MA 2VJKA 1GPUA 2O52A 1JKJB 4WWHA 2PR7A 2BZGA 4O2BA 1C9JA 4UAGA 3D5TA 3GVHA 4CNQA 2AK3A 3DF9A 3ORSA 1K7XB 2IHNA 3MRTA 2B34A 4KNVA 4GOLD 1A7UA 1D6JA 3I4FA 4RA9B 2R0QC 1X42A 5HF8A 2D7JA 4WCFB 1JPUA 3SM9A 5TRTA 2YXDA 5DHSA 3SYTA 4S04A 2R3SA 3D9QX 3M1AA 5EPOA 1YZLA 1UM9A 4EI7A 4X61A 3EBPA 1ELOA 4CV1A 4AECA 1KJ8A 4ZO4A 4ZK6A 2PUWA 2FMUA 1KNXA 4H6PA 4N65A 4YUWA 3FD8A 2A5LA 1PVDA 3D8UA 3PS9A 2D2IA 1H1TA 5AKEA 4YPVA 1YUBA 4FP9A 1VL6A 2GRJA 3GNTA 3JALA 5B1HA 1KETA 4WA8A 3U3KA 1FMCA 3U81A 3UK7A 4D3SA 2XTAA 3TB4A 1D09A 2IXFA 1N7GA 1BEZA 2WF8A 2B1GA 2P0AA 3P5SA 3VOBA 1DXQA 1EM8B 4DSOA 1YU6A 1XL1A 2HWYA 3N2YA 2ZTMA 4MNTA 3U61B 3CLUC 3EAFA 4CLDA 4AN4A 3P71T 3OCJA 3LX4A 2IFTA 4Q7JB 4RZIA 2OENG 1CZLA 3UAVA 8ADHA 5K20A 4Y1FA 3K9LA 3UATA 4CQLB 3FVWA 1DPFA 1W7AA 1H2EA 2MIIA 4GYWA 2XT0A 1ECGA 1ZCFA 2JHCA 3H5VA 4N7RA 2OZLA 4DRZA 1GZSA 2B0JA 2FSPA 4EB6B 2UUAB 3DO8A 1QQAA 4PQFA 2WD7A 3IMKA 2IUYA 2CD7A 4JU8A 4TLDA 2A6PA 3L3BA 2RGEA 3NVKI 4WJZA 1TPYA 2GN8A 2ZT8A 3DD5A 2X0JA 2Q4OA 4YAKA 3NORA 4MYTA 5F3DA 2W0MA 3HKBB 3ETDA 3PWSA 3DNFA 4JQZA 3SE0A 3L8HA 2XNDA 4BVHA 5C53B 3C4VA 1BJRE 4ZI3A 4IMJB 1QO0D 3VPAA 3W4KA 3OZ7A 2HCTA 3OLXA 3DFIA 2VAXA 3C3EA 1OUMA 4KBYA 4GE0A 1C0LA 1MVNA 1SIOA 1UBMS 3Q3IA 4UTOA 4DTIA 4O4LA 4HXEB 1N0VC 4A1OA 4L15A 4WV3A 1U7DA 3BMNB 4ZQGA 2SBTA 4HFJA 4E14A 2ZFUA 3Q8KA 5EE9A 3A1SA 4X1YA 4FR5A 4IMRA 3B53X 3K05A 1SKQA 4ALNA 3BD9A 2D0PB 1S89A 2JIDA 2O8BB 1ZUNB 1DQRA 1PT8A 2O57A 2CVZA 2Q4EA 4XEHA 3TSYA 1IDOA 2XQFA 4G9BA 4KXLA 3ZUGA 2G1AA 3IX7A 4U3JA 3QLJA 5BRNA 3VR6H 3BB1A 4YUAA 5LB2A 4CLRB 4B8ZA 4Y9TA 2Q7DA 4WPGA 3IUNA 1P2BA 4MDEA 3ZHYA 2XEDA 1PWEA 4P36A 1ULSA 3MCAA 4Y98A 5JI3E 2Y76A 1T34A 2Y9MB 1N5JA 1J0EA 4F4HA 1E2FA 1V7ZA 3ZDZB 1I4TD 3P9RA 5FHQA 3ERCA 2O8CA 2QTLA 3TBHA 1L5YA 3IDFA 1A98A 4JT4A 5DO9A 4CEHB 3UMFA 3IKLA 3G8YA 4H2DA 4L57A 3S2FA 5FH9A 5A06A 2BMJA 2X77A 2P3LA 1GAEO 4AICA 4D9NA 4WESA 1CWUA 2X3YA 1PZEA 1DC5A 4KBGA 4BNYA 2VOJA 3TSCA 1VKRA 2C31A 2Z08A 3OLCX 3CV3A 1PDOA 4RTKA 4YAWA 3UMVA 1LDGA 1JUDA 4IYRA 1X38A 4GP7A 3BULA 4RPIA 2V9PA 5AW6A 5J2UA 3LY8A 1P0PA 4FT2A 1MOPA 1AJEA 2HT6A 3SX2A 3UC9A 1HDCA 5JMWA 4ZT7A 3A04A 1GNVA 1QXSA 2C7VA 3O47A 1NJ5A 1RZ3A 1PR0A 4I6GA 4WFQA 3CY6A 2GCOB 3W7VA 1SUBA 1BSVA 4RTRA 1C50A 1P7PA 1XLWA 3LT2A 3RJMA 1CUXA 4IZIA 4DDHA 1L7QA 1EG2A 3BE5A 2GSDA 2WSLA 1DBSA 3PDJA 2Z9CA 1Q11A 1P2SA 2QMEA 2R86A 2WQZA 3JD3A 5FPSA 4BEWA 1JR2A 1ZWKA 3O8DA 4CYMA 4N7JA 1JGTA 4BQEA 4ZI7B 4P93A 3RRZA 3RVRA 1L8XA 1KI4A 2BM9A 1UBRS 3I1IA 5JD6A 2AG8A 3NBZC 2BKXA 4LPSA 4RHFA 4HTAA 4G1UC 4GC5A 3L5KA 4MB2A 2XB9A 5MHTA 5THXA 3FOWA 4E51A 4FYYA 1EXVA 5I01A 1P6XA 1P1JA 2JJYA 1USWA 4KKVA 3USCS 4TT3A 3VZPA 5BQOA 5JS6A 5K3FB 5EZSA 3GLUA 3V4SA 1YZKA 3U4CA 4N7BA 4DV1B 4OB6A 2OWDA 2IHTA 1YE8A 3AVXA 2VVTA 4M0PA 4KLCA 2CB0A 3QKWA 4W9RA 2YDXA 3GXOA 3PFHA 4OFXA 1T1SA 5F3WB 4UEJA 2VP9A 1KO7A 2VF8A 2MSWA 3BJMA 3LM8A 4FR2A 1NN5A 1OI3A 4MA4A 2NUBA 1IBCA 1OAOC 4H08A 2HIAA 3C8DA 3BA6A 4NU0A 3A9VA 1LLFA 1KPGA 1NU6A 3C6XA 4QPNA 4DFDA 3ZWDA 1MMFB 5K4GA 4LJ6A 1TTTA 3K20A 1XQYA 3DHEA 4XX0A 1AQNA 1BN7A 3F98A 1D2MA 4L5JA 1XNRB 3WJ1A 2J4CA 3VA7A 2LBPA 3CZAA 1XJQA 3EVGA 3U7HB 3I76A 3DLIA 3GF4A 1J42A 1T3HA 2ZYVX 1A27A 1XQ1A 4E4TA 1KQFA 3HXTA 3M5DA 3CPHA 4ER0A 4BNZA 1C0PA 4FS8A 4Q4LA 1YFKA 1XT6A 2HO4A 4YJKA 4PYOA 3S68A 1UZLA 1ESEA 3SC4A 3GH3A 5EN4A 3BD7A 3BGSA 3GN1A 1F0NA 3NHBA 5LOVF 3T9BA 3ZR4B 2PRIA 3PD0A 4ENQA 2VYNA 4LTDA 4ND4A 3LZ6A 1HKUA 2QS9A 4XUEA 4XPIB 1UCFA 3MT8A 4LXGA 3V7UA 2WB2A 4OYRA 5KSWB 3U37A 2IYVA 4NFHA 2B0CA 1GDHA 2I9PA 5HZMA 2PCJA 1VJ5A 2N47A 2UVQA 5ALVA 1DNPA 1GZ6A 1QKJA 4BLWA 1U28A 2PS0A 5EIBD 4IDCA 4MEAA 5FI1B 2GN6A 4BUJA 2YWBA 4HN2A 3WDKA 4DCPA 1ABEA 3BQMB 1AU9A 3LT5A 1SIWA 1LBIA 5AXCA 4Q93A 4IKEA 4X64B 1O0CA 4B2IA 3OZXA 1D8TA 5D5PA 1EDOA 4BNVA 3CNQS 1G18A 1JECA 4MV6A 4Q39A 3ZDCA 1WDLA 1TVCA 2XDWA 2N42A 4NS4A 5CB0A 1D2AA 3KOOA 3ABQB 2W6ZA 3HV2A 1FLNA 4HDAA 1II0A 2I6QA 1T4CB 1X7DA 1D04A 3B6IA 4UZSA 1EFHA 1G20E 5B1EA 4JI4B 3KZXA 2NYRA 3FUWA 2DQYA 3FTDA 4DT1B 2VJCA 1SNYA 4EMTA 3OM9A 3NOVA 1NVDA 1SQ0A 3DLPX 2X7JA 4GVXA 1DG9A 3LGAA 1FJHA 3GARA 3T1YB 9ABPA 2Z0MA 2DGDA 2IQ5A 2P5SA 2VPIA 3MB8A 5KBYA 4MSUA 1AA9A 4U8HA 1NHGA 3IBFA 5CB4A 4U02A 5IFKA 1FJ2A 2E4WA 2K5UA 3O8QA 5M2QA 5KKNB 3UJHA 2GBGA 2HQOA 5TQVA 5AJHA 1EK6A 2WPNA 2BTEA 3BZUA 1WZCA 4YQYA 4V0NA 2QVXX 3SE7A 5I5EA 2PT5A 4JKOA 1NC3A 1R4NA 2C77A 3O93A 3Q3CA 4LOLA 4HNUA 4YMLA 3L7IA 1EYZA 3U17A 4Z7QB 4ONEA 3G2KA 4O29A 3R5JA 1JDZA 2WWYA 5CNKA 1XZDA 1YRLA 2J9XB 3PDIB 2OC9A 3T7RA 5EIAA 4AKHA 1E4VA 3A3PA 2ATVA 1SWVA 3IT0A 1OIXA 4DTCA 3I6YA 1U4SA 3ZWWA 3IAM6 3IT1A 3IURA 4UEKA 5TQ2A 4NXMB 4LYDA 2BMAA 3CW9A 2Q8NA 4XFDA 4QJBA 3FSJX 1WL8A 3VR4H 1YR2A 4D9CA 4EEKA 4URXR 2Y1LA 4ID9A 4W5NA 3RFUA 1NBHA 1RR6A 3REOA 1YCHA 4QBFA 3NV9A 1TF7A 2O06A 1VDZA 4TRNA 2D4HA 4GOKA 4ZANA 3ILXA 2XYPA 2QNRA 3AERA 3T3EA 3EPLA 1BOFA 4R71A 1B2LA 1HT0A 2GKOA 3N0TA 1N6LA 2XA1A 2QSYA 4J6EA 1NW8A 1TCBA 4QFMA 1D7OA 3BFPA 3TTTA 5C8YB 1X86B 4MA0A 3R9XB 3H3XA 2P67A 3VNUA 3HFRA 1OX6A 3DZFA 3OZVA 2XHZA 1LLQA 1T8SA 2G08A 2XNDD 4FDTA 2ZVPX 4OGFA 4FEGA 4MUAA 1CUYA 4U7JA 3PGVA 5LWQA 3IT2A 1Q6ZA 3MT0A 4N3AA 1OXTA 3R09A 4R54A 2BMVA 1K1EA 1IMOA 1EUDA 3MRSA 2D1RA 2OFWA 1OLUB 3QBTA 1G4UR 1XTBA 5E9WA 3U7GA 2PZLA 3E03A 1ZOOA 4U2DA 2Z56A 3W6UA 3LCRA 1K8XB 3GUCA 5DGXA 2WAXA 3U31A 3PENA 3CINA 3OJCA 1SPXA 2B1JA 4FNGA 4NARA 1MEOA 4K9PA 3CUVA 2XT9A 2ZB8A 1H94A 4LXXA 5EIOA 4C7XA 4F9GA 2ZXEA 4L28A 4XYMA 2OM2A 1E3JA 3AM5A 3JR7A 1I14A 1DAPA 4AD8A 4O4JA 4Q66C 4S12A 2I7VA 1PBNA 3C5CA 4E5NA 4JJ8A 2M9MA 3FVVA 4A03A 3RYIB 4ABYA 4HN9A 4N0EA 1XPJA 1AQ6A 1QHIA 3IAFA 1UXHA 2BFMA 3ZTYA 5FV4A 5EKSA 5FPYA 1O5IA 1WCXA 1Z6PA 2JJQA 3FGPA 3I8XA 4JFRA 5DGHA 4QLOA 2V5VA 4H3KB 3PJRA 3T9AA 4I50A 2PBZA 1C3OA 3FFAA 4P3OA 1SC1A 4DJ5X 2V59A 4ZQCB 3WIDA 4CMGA 3EZ6A 3FYDA 4R81A 3WK5A 1TUBB 2NU8B 1SHZA 3QUCA 3WWEA 3M1LA 3QPAA 4DXDA 4E21A 3IEKA 3KX2A 3V8MA 4OOEA 4ALKA 5CDSA 2C2BA 1XGKA 2HIMA 5L3SA 4XSVA 5LXTA 3GYBA 3OEHD 4O0MA 5ENZA 2DBYA 3SZRA 4KR0A 1K0FA 1DJNA 3R9WA 1JFRA 2BP7B 4D9FA 1V6CA 4MTCA 3EIWA 3O2SB 2EFCB 1ES9A 1G6HA 4WLUA 5AK5A 5LN1A 1WXDA 4RPCA 2FX5A 1SGWA 4RVGA 5DGCA 5TPWA 3R77A 1KXJA 1I01A 3AG6A 3G8BA 3T1QA 2BKVA 3M6XA 1V5WA 1NR1A 4B31A 1CZOA 1LF5A 1Z4OA 4EKGA 3R0XA 4DCNA 5DNEA 5JSYA 1TCCA 3ZHTA 4EEXA 1IH8A 2VBFA 1XMVA 1YZYA 2Q07A 5AM2A 1IZ7A 3GFQA 4G01B 4PF1A 1VLVA 4JUBA 2X2OA 2G40A 3CVWA 1M72A 4RVOA 2QMYA 3NAGA 4MVJI 4NWIA 4RESA 2X58A 4TZ0A 2H4HA 4XB2A 2FN3A 2L42A 2JLSA 1M73E 4R2KA 1SCUB 1U6KA 1BJTA 3FUCA 1E7QA 4ZVVA 2RBKA 5HG0A 4BZPA 1SUEA 2IDMA 1TYCA 4C04A 1CZKA 4TQGA 4BCCA 3DZJA 1RWMA 3BRCA 2WJWA 3H9GA 4G24A 3WQBA 1U31A 2BKLA 1CD5A 3U39A 3T1VA 4M9XA 4FFOA 2CNKA 1DQYA 1Q0PA 1KVQA 4B4KA 4N7MA 3VR5D 4KG7A 3GL9A 3NHWA 2HSJA 2DCUA 3VTAA 1H42A 1VP9A 2XRFA 4IIJF 3UQZA 5FWNA 1T9ZA 3GCXA 1HETA 2HK8A 4M1WA 4R1QA 3T34A 2XTMA 4HVAA 2FW7A 1L5OA 1M74A 2PS9A 2HBRA 2RGNA 3AW8A 3I1FA 1XK7A 4QJ4A 3G0OA 4BKUA 1HDIA 3HZHA 1DTWB 1CS0A 5KOJA 3VPSA 1TCUA 1NQUA 4FN4A 3EUWA 2N1MA 3JTEA 4GBMA 4E5SA 4Q9AA 5CM2Z 4BNIA 3GPBA 4OGGA 3N8GA 2ZT5A 4IY1A 4B7XA 1XJ5A 3IMCA 4TTJA 1WW8A 1NBAA 2R1TA 3F6PA 4B6GA 2N9UA 1G41A 2I4TA 4QARA 1KYIA 2VEOA 4G5FA 2QNBA 3TAUA 4FJ0A 2JLXA 1W1UA 1R8YA 3IDZA 3DTTA 1QAMA 1R6XA 1J90A 2HRZA 2PGXA 2W6CX 1P60A 2ZIXA 2G83A 2IIPA 3OECA 3TQHA 1J25A 3FCOA 3KFXA 2GZ3A 4PYQA 4ZIRA 4XJTA 4QLBA 4I08A 3W8NA 1UQRA 4BGIA 2COEA 1L4KA 5CRIA 3UG7A 1NX9A 4ER5A 2EC5A 1K66A 1GTL1 2QVLA 1SU8A 3VR6D 1E0SA 3WADA 4ERNA 2BONA 1X1DA 2LWIA 3QENA 2RARA 1V4BA 3R7BA 2QG6A 1QE0A 3NHJA 4C7OA 2VPZA 3NP9A 2WUGA 3DQZA 2A7XA 3I5MA 5KYTA 4H31A 5B7PA 2CL6X 2BFOA 1JEEA 4J91A 1JBQA 2YWXA 2I65A 2RBGA 1SELA 2WMOB 2HBQA 2GUWA 2IP2A 1C9KA 3LRXA 3RC3A 2F1HA 1DV1A 4KDFA 3LI2A 4C4XA 2ZRIA 1HO3A 4IIXA 4EGFA 5BRAA 3NLLA 1N34B 4QUKA 5JZSA 4HSGA 2YFYA 2REBA 4LOHA 1OBVA 2VNHA 4WN9A 1P0IA 4FBGA 5K01A 1D03A 3UOAB 4R98A 4F46A 5CCXA 2I78A 2CF6A 3FPCA 3HU5A 1ZH0A 2X8WA 3AK4A 2W2XA 3G5LA 2RGCA 3M4JA 4YRFA 4BDSA 4CCYA 1XZCA 1PWHA 2J5QA 4JXZA 3DEAA 4C0KA 3S2GA 4E30A 2SECE 4I4LA 1EA7A 1ONSA 2GD2A 2UUBB 4KH1A 2HEIA 4L0MA 1O96B 1WPRA 2XYVA 3N6VA 2IIBA 2PLFA 2JLQA 1OPRA 3LDHA 1WBBA 1KY2A 5DCUA 1ZGGA 1J5EB 2VHVA 4PQEA 3R0JA 5EOVA 3JSAA 4AZTA 1Z5GA 5CD1A 2FPPA 2E2WA 5JADA 1P4HA 3OZAA 1MX3A 1P0MA 2ISSD 2WM8A 4US0R 5JD4A 3QU5A 1D9ZA 2FE1A 1EK5A 4K88A 4UVEA 3NBFA 3VYSB 4BO9A 3DBHB 5T7BA 2I6FA 5ER9A 1N5IA 4DSAA 3VR4D 2NXNA 5JYDA 1T4GA 1F8UA 2FSUA 3ICOA 1FNNA 3UIEA 1HE2A 3H87A 4E2YA 4EI9A 3U4GA 1HZZA 2IS6A 4QGSA 1USIA 4WDRA 4D6YA 1G8AA 1YBHA 1X1BA 2ZPUA 2FQQA 1UBGA 1E0DA 1E1QD 1UINA 2C2ZA 2F00A 3IAEA 3KVYA 5DTIA 3DCYA 5DI3B 5EUCA 1HFKA 4OHFA 3RRXA 4B7UA 1KMCA 4LDPA 2PTHA 2PMKA 3GO4A 1IONA 3OD5A 3FRHA 3DFMA 3QE4A 5ARBA 2GZ1A 3PXCX 3KE9A 3DV0A 4XQ0A 3V7NA 1ML4A 3CLTD 3GLTA 1PJLA 4DLYA 1RJ9B 2DEUA 1MJNA 3GIDA 4UE6A 5AM0A 1XTKA 3T12A 5C80A 2P3SA 2ORIA 3PGJA 1Z7YA 1FIUA 4YROA 3LUBA 1XD9A 5AICA 5LQCA 2A33A 1JHQA 4QU9A 4DMUB 4EO7A 2QSJA 1KDVA 5EPEA 3ZCVA 1MAVA 4H0FA 2I1LA 1M1NA 2D74A 1E2IA 2LIPA 2PS3A 3KNZA 4X95A 3LY5A 4BJ1A 2ATCA 3REGA 3GFFA 3FROA 2PUBA 2IOFK 3EWSA 1N3BA 5B1YA 3V3KA 4JI0B 3ZJ5A 4EYOA 4O4HA 2ZJYA 5JIBA 1J39A 1GJRA 4HB3A 4D3YA 4HAIA 5FF9A 1PN3A 1BH2A 3O73A 3ZNOA 1V16B 1QGZA 5HIJA 3R3JA 3T4PA 5DTJA 4EO9A 5BUZA 4PAGA 1TK3A 3UT0A 4BE4A 1IXKA 3I5YA 2O6LA 1W36D 4B6FA 5AFSA 4Q03A 2C59A 4QQRA 3Q2OA 1DXHA 2HWWA 1GV1A 2II6A 5AI5A 3RUFA 4I50B 1A9QA 2V7GA 2NT4A 4P5EA 2H1HA 4BN5A 2XGOA 2YBDA 1V11A 3WGJA 1INLA 2LCIA 4KQ2A 2FHPA 4Q4JA 2QRUA 3PUHA 1TZJA 4PLTA 5LKAA 1XDSA 2CE2X 1OXVA 1T4MA 4M49A 2LVBA 3SXUB 1EQ2A 2OXRA 4B3BA 2VTBA 1E3DA 1KAHA 2NUAA 4XJXA 4P0QB 2ZR9A 1OBCA 3HZOA 3Q10A 3DO5A 4K6FA 1JJVA 1NW3A 4KV9A 2WSYB 1QV9A 1K5DA 3I09A 2PYZA 3T5TA 1EX6A 5EUQB 1WMFA 5DLQC 5KQRA 4YGXB 3GRFA 4J1TA 3KSMA 5KDDA 1LPMA 2QR5A 2R8RA 3L0IB 4NZ9A 3ZC3A 2AUMA 3OQIA 1OXUA 3P2YA 5FLYA 3BDVA 4IHJA 4K8RB 4R0VA 1S4MA 4HGPA 4UUNA 1QPZA 3LOUA 1U3TA 2QRMA 3OPVA 2H1OA 3I01M 1GQSA 1COWD 2CGEA 3ZUPA 4ZTUB 1V3UA 3M1IA 3N39C 2C2OA 1C3XA 1E2NA 4NE2A 1I4OA 3GMDA 1F1BA 3HWX1 4Q34A 4YRBA 5B4VA 3PC3A 2G76A 2ZBEA 4WXRA 4K8OA 3K9HA 4S2EA 2C3UA 1U8UA 4Z7JA 3UFXB 2OO3A 2PD3A 3OE7A 3Q40A 3ZV5A 3INTA 1KPHA 5EYPA 1OFVA 2CXQA 4V0QA 3USZA 3TGWA 1F9EA 4M9SA 1J2UA 3P27A 1PD0A 4HX5A 5FBZA 1CIVA 4GYKA 2RAFA 2QAGC 3E7PA 3HCCA 3HWRA 4Y2GA 5HF6A 4YRAA 3ZGZA 2HU7A 3RSHA 3ZI4A 1QE3A 4C89A 2HBZA 2XDAA 1IC6A 2X9NA 3E58A 3PEEA 2V6GA 3IHWA 5JSQA 4X1IB 1GDTA 1V5IA 4HXYA 1VECA 2EERA 3GOHA 2H5EA 4WVFA 3PF9A 4DNFA 1L8OA 2BT4A 2H1LA 1RLMA 2YS6A 3EDYA 5E8RA 3TZKA 1PEAA 1W59A 3GN2A 5HMLA 4C7VA 4DZZA 2H2HA 4OUKX 2D7CA 4XGQA 4PSVA 2G5PA 4YJ3B 2HSEA 4IRMA 4DY6A 2RAVA 1ZXXA 1IG3A 3F6YA 3EDRA 3V4PB 3FB1A 2HXSA 1XTUA 1FP4B 2AVNA 4MPTA 1NASA 4MS1A 5KOHB 1ULHA 5CFZA 1U7HA 1K7CA 5A3QA 3IBGA 3PT5A 3VAZA 4REOA 3UWMA 1P1RA 1YWGO 2XMQA 3BFVA 3VAYA 4BLTA 1YS4A 3MXOA 1KOGA 5GMOA 4BCBA 4KNYA 1M0WA 2XD4A 3BTUA 4FHEA 4C0JA 2EGHA 5FYQA 3TL6A 4QOJA 3O9MA 1G3UA 2I4RA 4FZJA 3DP7A 3D8NA 4FXPA 4UFOA 4L7VA 2P1ZA 1I2ZA 1MC5A 3DDCA 3QBEA 5JCZA 2C94A 2KW5A 3PTAA 4JHXA 5LZ2A 4C5BA 4BFWA 1E96A 1BQEA 3IESA 5B58T 5LBIA 4KBFA 5IT4A 3R3WA 3UJ8A 1SURA 4O2AF 4ER7A 1E0JA 4V2UA 5IXSA 4IZ6A 1WO8A 3KKZA 1C2TA 2QENA 3PHHA 4AKIA 4J3JA 3VO9A 4DG5A 3WYCA 2I54A 2KWIA 1JG4A 1ST2A 3OOHA 4JJKA 4XA8A 2VQDA 4R1UA 3L4JA 3EZYA 4Z4QA 2QA5A 4C78A 1JIQA 3A2LA 4TV9F 3H7AA 1E32A 4JUAA 4F97A 2XV1A 3WSVA 4L0DA 4YV1A 5BV7A 2R84A 4DSUA 1PG5A 2VHXA 2IBMA 3R0QA 3V6LA 1P72A 1VBKA 1R4MA 3F3MA 4IDNA 5FBKA 1V8PA 4KIFA 3STWA 1ADCA 2A0XA 4I9HA 4QNRA 1U0JA 1FBNA 3NB0A 3QIAA 4H77A 1CS4C 3HJUA 3KOMA 1TEZA 5KU1A 5A02A 2EQ5A 2R6GA 5E2IA 2WPDA 3NBXX 3AIKA 4Q4AB 3A2MA 5F78A 2B7LA 2B1RA 4M0DA 2R4QA 1RLUA 3RYFB 3WIUA 5GADl 1XPRA 2ZS9A 5L3VA 1YQUA 2J48A 3GZTB 4KB5A 4DXHA 3KM0A 3K1AA 4L4YA 3DP9A 2W93A 1BVUA 3A1EA 1GYPA 2QVYX 4X90A 4U7HA 2C9BA 5IXYA 4X94A 1IN8A 5CLJA 3ESBA 4KYUA 1XDWA 3MWGA 3MWFA 3ZQ4A 1MOQA 2NTJA 3WV5A 1RM3A 3QG1A 3EMVA 1UJ5A 4YWHA 3PUYA 2M6KA 3L4BC 2RCNA 5ES4B 3PF8A 3TBKA 5AKXA 2QG9A 4IJVA 2O59A 1RRCA 4IIVA 4OXRA 1YS1X 3IA2A 4O1IA 1SUIA 3P2JA 2PD4A 1IHUA 4NCHA 2VZ8A 3NANA 5I7VA 1E3SA 3CUKA 1HZJA 3BXPA 3G82C 4KDCA 3KCNA 4DMLA 5EMKA 1H6DA 1EFVA 1QHNA 16PKA 2FQWA 2FWIA 3DOCA 5HILA 5BWLA 4IF6A 1FSGA 1YB4A 2W2MA 3K1JA 1TVMA 1WB5A 2FQ1A 2E85A 1BWPA 1CR4A 4KPUB 1THTA 2OFXA 4FQ7A 2H11A 1TAQA 2Q45A 3HB5X 1PEKE 1Z5NA 2I22A 2WQ6A 5DTQA 3RAFC 3DSRA 1J8YF 2P62A 4V3CA 1U7WA 3CLUD 2FW1A 1R27A 4RU1A 4GZLA 4XDHA 4AC9A 2JL1A 3MD0A 1LW6E 2MJLA 3KXLA 3Q7RA 2WTEA 4WDQA 3TX6A 5JY1A 3H1BA 4L3OA 3ZHQA 1M6NA 3ZWXA 3KUXA 4TRMA 1BGXT 4CMJA 4JMPA 1COWA 2DY0A 3C74A 4URUR 2RHTA 4TN5A 2QUZA 3T3GA 2CV2A 4EKYA 4HMPA 1CHNA 4RPKA 5TMEA 1ZOPA 3G23A 4PG7A 5AHKA 3F46A 1FX1A 5J9FA 4RETA 5TX7A 1CUDA 4JJAA 621PA 2ZUDA 4K1XA 4RPLA 1UMCB 4OBEA 3AHEA 3D4OA 3MT9A 2GCOA 2ZUSA 5CT9A 5EE0A 1RQ2A 2X15A 4M89A 5FT9A 1XAJA 2ORYA 4DLXA 2GESA 2XXAA 1PNVA 3UWOA 2J0QA 5KX5B 2R44A 3QNUA 4Y2SA 3WIBA 9MHTA 2HK7A 3DOFA 2JFGA 2ERCA 2WV9A 3BWYA 5DNDA 4KN9S 4LHXA 3ES9A 3CH7A 4HZUA 4ZI7A 2A4KA 4M6WA 2I9KA 1UJBA 2C88A 3JQQA 3CG4A 4NYMR 1P7YA 3SF8B 2JCXA 5HZGA 1VGRA 1IRIA 4WESB 3KZCA 2XLCA 3EY4A 3EGDA 2DYKA 3H0KA 3IKMB 3P0RA 1QF6A 1T0UA 2PZKA 3WKBA 1V41E 4UAJA 4IIYA 4CEHA 3K92A 1U63A 2EZTA 2O8CB 1B2RA 1BVRA 4YJGA 3WNVA 4KO3S 3I34X 3K15A 1FNCA 2GCNA 4KPGA 3QSYA 1ZJ6A 4JYAB 3IAUA 4UHHA 3WJ2A 4E7OA 4R6XA 3J7AC 4BATA 5JD3A 1Z29A 2QN2A 1ZJ4A 2QN9A 1DCMA 2ZREA 5EJAA 5DIZA 3I6MA 3BMQA 2QHXA 3AG5A 3GLGA 4OF4A 3ETEA 1OB5A 1W48A 2WVGA 1HNWB 4E2XA 1GNPA 1ZIYA 2HK6A 1TFRA 2GD1O 4K7JA 4YACA 4FB5A 1P31A 4O2LA 5TDHA 1UP7A 3ZEIA 2WU3A 3AH8A 3ZWVA 4K6OA 1L5ZA 2Y1GA 5ENVA 4YCDA 1ODKA 1OZ0A 4FGWA 1BRTA 2ODEA 4TTAA 3RUEA 1NXXA 3T9DA 3C5WP 1G59A 4J43A 3X0DA 5EYPB 1NV9A 4X1OA 4LISA 4O4LB 4JVLA 5JSFA 2ODBA 2IYEA 3H6KA 4HAUA 3PZRA 4DLAA 5DHTA 2KE5A 2R6FA 4J0HA 4Y2YA 2EKBA 4LEIA 2W4IA 3MSXA 3NPMA 4H1WA 3NIBA 3FMIA 1EVIA 2XYRA 4D0SA 2P6RA 3F7MA 4FX2A 3KQPA 1NJFA 2V7EA 4H1UA 3RK0A 4MS3A 4F91B 3E5MA 5DISB 2I8LA 3HLTA 4INJA 4J2TA 1JSCA 2H2GA 4NZNA 1MHPA 1ONOA 4JR2A 4UBOA 5A0FA 1QUFA 3TK1A 4BZWA 1X7XB 2X5NA 5JAUA 1ZNZA 3TPCA 3UV7A 3N59A 4F7WA 3GWGA 3NDPA 1W47A 2JGAA 3HA2A 1O95D 4D8TA 2GK3A 1VE3A 3RIMA 3G17A 2VHQA 4CQLA 1X9IA 4Z53A 2QTRA 3LUGA 2NYVA 1YBMA 2VP0A 1CDDA 4E2WA 4TSFA 5EWMA 3AMVA 1Q1BA 1KMMA 3PX3A 1IMJA 1B73A 1KK3A 3MQFA 3ZE7A 2QKYA 4MUBA 1IM2A 4MJLA 2JRLA 2HLNA 3CW8X 1K92A 3HVHA 4J4TA 4NNJA 3R0ZA 5IAGA 4IIGA 3WL4A 2VP5A 3OM0A 3H2IA 5AK3A 1TYAE 2AYXA 4W5WA 1UH5A 1FC0A 3N28A 2G0NA 3CUYA 5FLKA 2E4AA 2PUJA 3D3NA 4G26A 2W43A 3ZV7A 3CLVA 4PC7A 2YUTA 2WVJA 4L5BA 3KUCA 1P2DA 2VAMA 3I42A 4PHTA 3WMGA 2XWQA 3M82A 5KOYA 1BXGB 1W25A 3OA2A 1Q0SA 4J0EA 4LK3A 3WGMA 4TMFA 1OYOA 2QRPA 2R7NA 2RD2A 4CT5A 1EIZA 3C70A 3O2QB 4UVDA 5ALYA 3IE0A 4F2GA 1AMNA 4DB4A 4WCDA 1T0JB 3PD7A 3KVNA 1I4DD 2FCRA 4F85A 4IZOA 2C42A 4F12A 1SHJA 1ST3A 5IWAB 4XRRA 3DJFA 4LHWA 4RFLA 1NF3A 3RJTA 2NO1A 5K9ZA 4M8IA 1RC8A 1ZZEA 2BR5A 1NIPA 3PLAE 2A67A 2GBLC 1KE1A 4CEJB 3URKA 3FTNA 2NU7A 4L8LA 3AU9A 2HU5A 3KO8A 4O1HA 4QASA 3FJOA 4MYUA 5IKMA 1Y6QA 3GNQA 2PRKA 3LP6A 1VFPA 4IVRA 2C1ZA 4PSDA 3GPCA 5ELLA 1DOAA 1XZIA 1M2VB 5JUWA 4GGPA 4J1SA 3AR7A 5HM6A 1NSFA 1ESDA 1O08A 4LKRA 1PS9A 2JKYA 2C5AA 3TXAA 3OX3A 4NJEA 4BP1A