2FFFB

Open form of a class a transpeptidase domain
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
453
structure length
453
Chain Sequence
DYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSRRAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords penicillin-binding protein 1B
publication title Structural analysis of an "open" form of PBP1B from Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Membrane protein, transferase
total genus 147
structure length 453
sequence length 453
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2fffB01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2fffB03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2fffB02
4FH4A 5EVIB 2XD1A 2EX9A 4LV3A 3VP2A 3W8KA 3ZDJA 4D2OA 1CI8A 4BQMA 4GNUA 1MWSA 2P9VA 2UWXA 3GRJA 4DDSA 4BJPA 3SS4A 1TDGA 1N4OA 3ZHHA 4EQIA 3ZG9B 4WEJA 2HP6A 5E2FA 3ZFZA 4WZ5C 1E25A 1K56A 4ID4A 1H8ZA 2XH9A 2ZMAA 3FZCA 2Y2KA 5CTMA 1PI5A 5GHZA 1MWRA 3UN7A 5HAPA 3PBRA 1I5QA 3VFFA 1ZG4A 4HEFA 3N7WA 3IT9A 1NYYA 2JBFA 5EOOA 5FA7A 2H0YA 3UY6A 1BZAA 1EWZA 2QPNA 2V2FF 4C75A 4GDBA 1XA7A 3IWOA 1GA0A 4PM8A 1ES4A 1ES2A 5JYOA 4M3KA 4Q8IA 1G68A 2WGWB 2CC1A 4QHCA 2RL3A 3W4PA 2OLVA 1DY6A 3G35A 1LI0A 1LL5A 3WS2A 4C3QA 2ZQDA 4JXSA 1JTGA 5D3OA 3OCNA 5BOHA 1LI9A 1BLPA 1AXBA 2EX2A 3IQAA 5FDHA 2C5WB 5M19A 4E3IA 1J9MA 3N6IA 3W4OA 4PM7A 3IWIA 3A3FA 1FCMA 3ZVTA 2WKIA 5FQ9A 4DE0A 1GHPA 4DDYA 3VOZA 4JLFA 3O88A 3AGDA 4DF6A 1KGGA 1BUEA 4MLLA 4WZ5A 4B88A 4OP8A 1ZG6A 5FSRA 2WUQA 4N92A 5J8XA 3Q1FA 3WRTA 4C6YA 2Y4AA 3C7VA 4P85A 4EUZA 2EFXA 4OVDA 2WK0A 4JF6A 3VMAA 3I7JA 4PM6A 2R9XA 4ZJ3A 3HLWA 1L0FA 4JKTA 4OPQA 2XFTA 4KQQA 5CTNA 4YINA 3O87A 4OH0A 3HVFA 4OQGA 1XKZA 3GVBA 4KZ8A 4Y0UA 4YFMA 1OMEA 3UPPA 3C5AA 1FCOA 1MWUA 4KZBA 4FH2A 3OPLA 4QJGA 4MEZA 5DVAA 3BRMA 3PBOA 4Y0TA 4LCMA 3DW0A 4UAAA 1ERQA 1NJ4A 4NETA 4OQ0A 2X02A 2QZ6A 3QNBA 3RXWA 1LL9A 2ZC5B 5CGXA 3Q7ZA 1IELA 1NZUA 4KZAA 5G18A 4Z9QA 4OLDA 5A91A 3QHYA 1HTZA 5DF9A 1IYQA 3OCLA 3G34A 1K57A 2ZD8A 3PBTA 5EVLA 3BFCA 5U47A 5FATA 3UPNA 1HVBA 1YQSA 2ZQ9A 3HUNA 4UHUA 4DKIA 2Y2GA 4EWFA 5EE8A 2R9WA 1WYCA 3GV9A 1PZPA 4PM5A 4HBTA 3N8LA 4BENA 1PZOA 3PAGA 5FQJA 5EECA 1KDWA 3S4XA 2P9VB 3M2JA 1NZOA 3A3IA 2HP9A 2X71A 2XFSA 2H5SA 2DCFA 3BECA 4WELA 5FI7A 3SH7A 5GLAA 5CXWA 3M2KA 4E3NA 5AQAA 5TGFA 5E2HA 3MFDA 3NDEA 5E43A 3ITBA 2Y2LA 3IHBA 1GA9A 3V50A 4R4RA 2PU4A 5CERA 2XDMA 1ESUA 1VM1A 4R23A 3MKFA 3UPOA 1IYSA 3HLGA 2ZM2A 3GR2A 1IKGA 1JTDA 3MZFA 3NY4A 2Y2PA 4R1GA 3ZG5A 1MKIA 5AQ9A 5AQ7A 4GB7A 3HBRA 3IXHA 5GLCA 4OQIA 5HARA 1K6SA 3VP0A 3P09A 1PW1A 1XGJA 2B5RA 1YT4A 3A3EA 3UNWA 4OQHA 5HAQA 1SDNA 3MKEA 3BLMA 2EX8A 3RXXA 4KZ9A 1L0DA 1W7FA 3V5MA 1XP4A 2WAEA 4A5RA 3BYDA 3A3DA 3HLCA 5TFQA 5GL9A 3Q81A 4GN2A 1E3UA 3WS0A 4WM9A 3VFHA 1YLTA 1PWCA 4IEDA 5FI2A 3AGEA 5FQKA 2XD5A 4DE3A 1I2WA 4QY6A 2IWBA 1SDEA 4LCLA 4O7DA 3LO7A 4KG5A 1FSYA 3G32A 3VSKA 3E2KA 4OONA 3FYZA 3OPPA 3CJMA 3DTMA 3BFGA 3WS1A 2WGIA 4E6XA 3G31A 3BFDA 4LV1A 3Q82A 5EVID 4OP5A 4U0XA 1FQGA 3HUOA 3V39A 3TOIA 4EBNA 5F1FA 2C6WB 3Q7VA 3FKWA 1O07A 4ZDXA 3SH8A 3PBSA 3HLBA 5F83A 3S1YA 3ZCZA 3ZG0A 4CPKA 4IBRA 1ONGA 3WWXA 3LCEA 2J9OA 4UA6A 4WMCD 4RYEA 1PWDA 1E4DA 3IH9A 4OOYA 5F1GA 4N1XA 3MXRA 4OPRA 2JCHA 1CI9A 3N4IA 2XEPA 1PYYA 3DWZA 3SH9A 3WS5A 3N8RA 2E8IA 4BL2A 2EFUA 4RX3A 3ZVWA 4JXWA 1NRFA 1TVFA 1N9BA 1PI4A 1YMXA 4P0MA 2FFYA 5EUAA 3C4OA 3UDIA 1KDSA 3UE0A 4EBLA 4ZTKA 1LLBA 1BSGA 3ZNYA 3JYIA 3VSLA 4ZAMA 1KVLA 4E3LA 2HDUA 3IF6C 4XUXA 3UDFA 1RGYA 1PWGA 4HESA 4QY5A 1DJCA 5DTSA 3C4PA 3LY4A 4OLGA 1XXMA 4GOGA 1K4FA 2Y2NA 4XXRA 4X68A 3MZDA 1XA1A 2Y2MA 2ZC7A 3Q07A 1Y54A 1MPLA 1YLZA 4PMAA 3UE3A 2HP5A 4DXBA 4KQOA 1BLHA 1ES3A 3CMZA 4BLMA 2RCXA 1JVJA 3FV7A 2IWDA 2ZQAA 1ES5A 4PM9A 4JBFA 1IKIA 4X53A 2WAFA 1XGIA 2WGVA 2XR0A 3P98A 4U3TA 3TSGA 5CGWA 4MBHA 3IXBA 4FD8A 1H8YA 3NCKA 5FAOA 1QMEA 4X69A 3V3RA 2ZC4B 2P74A 3BLSA 5GHXA 1JWPA 3DWKA 3ISGA 4JPMA 4IVIA 4KG2A 5E2EA 2VGKA 4MNRA 2WADA 5DF7A 2I72A 4EV4A 2ZC6B 3NI9A 3NIAA 2FFFB 4KQRA 3B3XA 5E2GA 4E3MA 1IYPA 5HL1A 2H0TA 1L0EA 3AGFA 1PIOA 1YM1A 3HUMA 4OKPA 1ALQA 4LV2A 1JWZA 3EQVA 3IF6A 5EOEA 2Y2IA 3BFFA 1RCJA 4BD1A 4FCFA 1C3BA 2Z2LB 3OPHA 5KZHA 5FQIA 4JXGA 5M18A 3TG9A 2Y59A 1YLYA 4KZ5A 1SCWA 3ZGAB 1W8QA 2XGNA 3QNCA 3FWLA 1HD8A 4E3KA 1YLJA 3IXDA 3PAEA 4KG6A 4OOLA 4EBPA 1KE0A 3HREA 3GSGA 4K0WA 4E3JA 4P87A 5FQQA 3Q7VB 2Y55A 1CK3A 1U60A 2BLSA 4R0QA 2A3UA 2ZM0A 1YLWA 1Q2QA 5KSHA 4S2LA 4WBGA 1YMSA 3V3SA 1K56D 1K4EA 5FAPA 5HFOA 4DE1A 1PW8A 2Y91A 3LY3A 5EVIC 2WZXA 2HDSA 4FSFA 1ESIA 2G2WA 2PU2A 5CHMA 1MY8A 4IVKA 4S2JA 3EQUA 1W5DA 4N9LA 5FASA 4KZ3A 4R4SA 3HL9A 5KMWA 2WKEA 5CEBA 1K38A 2ZLYA 5KSCA 1RGZA 1BLSA 4RA7A 3IWQA 4NK3A 3HLEA 2BG1A 2XF3A 4X56A 5GHYA 4ZJ1A 4R3JA 2EXAA 3C7UA 1O7EA 3PBNA 3OC2A 5IHVA 3G4PA 3ZG7B 4B4ZA 1ZC2A 4KZ7A 2WZZA 4GDNA 2WKHA 3SS5A 5JYPA 3S22A 4GD6A 1BT5A 1FR1A 2Q9MA 4KZ6A 5TR7A 2G2UA 3VP3A 2H10A 1L0GA 2HDQA 3IHAA 1FR6A 4N1HA 3LEZA 3IF5A 1ZKJA 3GTCA 3UE1A 4Y7PA 3SOIA 4WZ4A 1VQQA 5CHUA 4F94A 4DXCA 4P6BA 5FAQA 4S2MA 5EVIA 1W8YA 3VOYA 3BFEA 4N9KA 4JXVA 5EPHA 5DTTA 3A3JA 1G6AA 2DRWA 2JE5A 2ZQ8A 3D4FA 5DF8A 3VP1A 2V1ZA 1GCEA 1WE4A 1S6RA 2ZQCA 5HAIA 2J7VA 3PTEA 3ZG8B 3CG5A 3UDXA 4GKUA 4K91A 1QMFA 4PPRA 2XLNA 3NBLA 4S2NC 4Y0OA 4MBFA 4QD4A 4WMCA 1K54C 1K57C 4QB8A 3BEBA 4WYYA 4UA7A 5CGSA 3UO9A 4E3OA 2V20A 4JF5A 1EROA 4IBXA 5FI6A 1IEMA 1YLPA 2ZC3B 1SHVA 4KENB 1TDLA 4RX2A 2Q9NA 4H8RA 4UA9A 4JF4A 3MBZA 1Q2PA 1K55C 2OLUA 5F82A 1FOFA 4DE2A 1MBLA 2Z2MB 5HW3A 1KVMA 3VP4A 5GLBA 3OZHA 2WGWA 3CZDA 3IF6B 2IWCA 4OPZA 3GMWA 2Y2QA 1XPBA 3ZNTA 4BD0A 3WS4A 4R3BA 3NDGA 4CJNA 4B4XA 3OPRA 1GHIA 1LHYA 1I2SA 1W79A 2ZM8A 5CECA 1XX2A 4S2KA 1K6RA 4MBKA 5GLDA 2JC7A 3MXSA 3IXGA 3M6BA 1TEMA 4GZBA 4X55A 1KE4A 1CEGA 1M6KA 5I94A 2QMIA 4ZJ2A 3WRZA 4QU3A 2OV5A 3G30A 1ONHA 3PBQA 2DNSA 2J9PA 2ZQ7A 4OOMA 3M6HA 3ITAA 4DRTA 5A92A 1M40A 2XQZA 3E2LA 1IYOA 1H5XA 1Z6FA 4LV0A 4S2NA 5M1AA 1ERMA 1KE3A 1K54A 4X6TA 1L2SA 1DJAA 1NYMA 1KGEA 2OSUA 4L0LA 3W4QA 4LENA 3RJUA 2EX6A 3NC8A 5CEDA 2Y2HA 1BULA 1MWTA 3HLDA 5CRFA 5A90A 3GQZA 2Y2OA 4OPYA 1K55A 1MXOA 3G2YA 1KGFA 4WEKA 2HPBA 1BTLA 3HLFA 4K0XA 2A49A 5A93A 4S2PA 4ZBEA 4RVAA 2Y2JA 3SS3A 1DJBA 1GHMA 4BL3A 5CHJA 4E6WA 2X01A 1NY0A 2WYXA 1S0WA 5AQBA 4KZ4A 2ZJ9A 1JWVA 4S2OA 4GD8A 4XUZA 2J8YA 1SKFA 5FQMA 1EI5A 4U0TA 3O86A 1K25A 1FCNA 3MZEA 1BLCA 3N8SA 1HZOA 4HBUA 1E3UD 2VGJA 3O3VA 1FSWA 1NXYA 5DTKA 2XK1A 3FKVA 3BM6A 3G2ZA 1CEFA 1WYBA 2GDNA 2HDRA 2PBYA 3IH8A 4S2IA 5HX9A 1RP5A 5L2FA 2EXBA
chains in the Genus database with same CATH superfamily
5EVIB 3EGDC 3MF0A 5DNMC 3ZDJA 2KX6A 3GECA 3KSIA 1YU3A 4Z2MG 2UWXA 2P9VA 3GRJA 3CAXA 1TDGA 2E8JA 3ZHHA 1P3IB 4WEJA 5E2FA 4G91C 3P7NA 1H8ZA 3FZCA 5C5KA 1PI5A 3VFFA 3NQUB 4IBFA 2NQBA 2H0YA 4LRXC 3AYWD 4ZBJC 5B24C 1YU0A 1XA7A 1S4SA 2Z6CA 1G68A 2RL3A 3H7WB 2OLVA 3G35A 3AZNB 4JXSA 4HJ6A 5D3OA 3RELC 2YFVB 5BOHA 1LI9A 5CPJD 3IQAA 5B31B 2LB5A 2C5WB 5KIZA 4UEYA 1S66L 3W4OA 1P3LD 5C3IC 5DNMA 4DE0A 3KYEA 3VOZA 4JLFA 4Z5TD 1AOIA 3KSFA 3UE6A 1KGGA 4Y5FA 4B88A 3F1OA 2WUQA 3WTPC 2I9VA 2EFXA 3W97C 4PM6A 5LBRA 2Q0OA 3QP6A 4OPQA 2XFTA 4P6ZS 5CTNA 4X23D 1P3AC 3O87A 1M1AB 1VHMA 1KX4B 5B0ZC 2QJ5A 3PBOA 4Y0TA 5AVCD 3F6TA 3KWQA 3RELA 3MQLA 1PDCA 5B32G 4OQ0A 3LZ1C 4EERA 3AV1C 3O62C 4JJND 1IELA 3AZEB 1KX5C 4TX8A 1P3BD 1T18A 3X1VB 1W1YA 2PHYA 5DF9A 4PKYA 3PBTA 1B6WA 1YU1A 3BFCA 5B1LC 2ZQ9A 3HUNA 3L29A 2Y2GA 5EE8A 5AVBD 1PZPA 1N1JB 1X0OA 3WTPA 1PZOA 3PAGA 5EECA 3AZMC 3RFBA 4CQHA 2IO5C 3GDIA 4X1LA 1P3PC 4WELA 3W97A 5FI7A 3SH7A 5GLAA 4AFIA 4KUOA 4WN5A 5AQAA 3JVVA 1P3AA 3MGPC 3ITBA 2ZMFA 1YAXA 1P3KD 1P3FB 5AY8C 2CV5B 1HTAA 4OJOA 3MGSD 3TU4D 3MZFA 3ZG5A 1MKIA 5AQ9A 4CLCA 3AV1A 3O62A 4JGPA 5HARA 1K6SA 5HWTA 3AZKA 1GOIA 3UNWA 3IX4A 1V9ZA 3RXXA 3BLMA 3G6OA 4KZ9A 5B1LA 5B40C 4UUZA 5AV9D 3A3DA 4NE6A 5GL9A 3Q81A 1F66D 1E3UA 3AZMA 4HMDA 4WM9A 3REHB 3LR3A 4L9FA 1YLTA 1P3PA 1EW0A 4DE3A 3NOUC 3WKJA 4O7DA 1FSYA 4XZQB 5GSUD 1P3IC 3G32A 3MGPA 3E2KA 1FIKA 3FYZA 3CJMA 5AY8A 3DTMA 3G31A 4EQ1A 2ZL1B 3KYZA 4B9OA 4U0XA 4NKPA 2ZM5A 4ZDXA 2O9AA 3PBSA 2PYPA 3C1BD 3MGRA 3AZNC 4Q0HA 4ARZB 3IH9A 5B40A 3H9WA 1F98A 5FEGA 1BH9A 2JCHA 2VV6A 3N4IA 4EEPA 5B31C 2VJWA 4YOFA 3N8RA 2W3HA 3REKB 2UV0E 3ZVWA 2H28A 3W96D 3UB5P 2FFYA 5FDSA 1P3IA 3C4OA 3UDIA 3UE0A 4WL9A 3ULFA 1XJ4A 3LICA 1LLBA 5E5AD 3AZGB 1ID3B 3HJIA 2P08A 3MVDD 5J4EA 4HESA 4GHIB 5DTSA 5CPKB 3KXBB 1XXMA 1K4FA 1M1AC 4XXRA 4X68A 1KX4C 3MZDA 2ZC7A 3TJZC 1MPLA 1YLZA 3UE3A 4ESPA 3MNNC 4MB5A 3CMZA 4BLMA 4X53A 1MZUA 2WAFA 4HOIA 3L28A 3P98A 5TJJA 2OWHA 5B31A 5JA4A 1Y4OA 1H8YA 5AV8B 3AZEC 3NCKA 5FAOA 1QMEA 4F3LA 1T19A 4X69A 3X1VC 4H9RB 3V3RA 1DP8A 1LSWA 1W63M 4BBVA 2AROB 1DRMA 4NZ4A 1KU5A 2K31A 2WADA 5DF7A 3W99B 2I72A 3NIAA 2FFFB 5E2GA 4E3MA 3B0BA 4DQYB 1YM1A 1PZRA 5EOEA 4EESA 2F8ND 1OTAA 4ETXA 4XUJA 4KHAB 1A0KA 3OPHA 5FQIA 4JXGA 4ZUXD 1YLYA 1ZHHB 4KZ5A 1M1AA 4G3KA 1SCWA 1P3FC 2XGNA 3QNCA 4JGRA 1KX4A 2CV5C 1U35B 2ZY4A 3PAEA 3LFVA 4OOLA 5GXQC 3MNNA 3GSGA 5TBMA 5FQQA 4NE3A 4IBDA 2BLSA 2ZM0A 2PT7A 1CK7A 1Q2QA 1JNUA 4S2LA 2RTSA 4DE1A 3AZEA 1PW8A 3X1VA 2HDSA 3X1SB 1ESIA 3UTBB 1P3GB 1W5DA 4LPZA 4N9LA 3WA9A 5AVFA 2NQBD 2WKEA 4BWIA 5CEBA 3B6GA 1OPXA 3IWQA 1V9YA 1N1JA 2PDRA 3REHC 5GHYA 4J8XB 4ZJ1A 1J7MA 2EXAA 4CLCE 4DRAA 1HQ3D 2V0UA 1ZLAB 3PBNA 1UWNX 3G4PA 3ZG7B 4KZ7A 4D60A 2WZZA 2XSSA 4GDNA 2CV5A 2Q9MA 5DNMD 5GXQA 1TS8A 4NEED 1J3WA 2O9CA 2HDQA 5B2IB 4J8VD 5B0YB 1AOID 2L1MA 1EAKA 3LEZA 3IF5A 3GTCA 3UE1A 3AV2B 1OT6A 2GX5A 3EOIA 3VOLA 1WA9A 5FUGB 5DTTA 3A3JA 1GCEA 3UT9B 1S6RA 3PTEA 4K91A 2M7VA 3S7OA 4GJ4A 1F5MA 3BJNA 1UR8A 3A0RA 3REKC 1KX3A 1K54C 1K57C 4WUJA 3UO9A 4E3OA 1T1AA 3X1TB 4BBTA 5HWWA 4KENB 3KWQD 4RX2A 4UA9A 2W3EA 5F82A 1FOFA 1VEUB 2HZ5A 1KVMA 3C38A 3OZHA 2JKGA 3B0CT 2WGWA 3L26A 3AZIB 4Y13A 3AZGC 1ID3C 3WAAB 2M1CA 4H9PB 4BD0A 4YS3B 4CJNA 4B4XA 5CPKC 2ZM8A 1K6RA 2QHKA 3CHWP 2F8NG 1S1YA 3IXGA 3M6BA 1TEMA 2WKRA 4ARZA 3W97D 1CEGA 1M6KA 5I94A 2QMIA 3WRZA 3G30A 1ONHA 4OOMA 1M40A 3E2LA 2D01A 1H5XA 5B1MC 4LV0A 5AV8C 3REKA 2YFWB 3WD4A 1W1VA 1K54A 2VA0A 3P01A 1L2SA 1DJAA 1NYMA 1P3MD 3W4QA 1M18B 2AROC 1G5UA 4CSRB 5AV6C 4CLCD 3W99C 5BNVB 3O62D 3W98B 3AZGA 4MDZA 5A93A 3AZKD 1ID3A 4O8GA 5KDMA 1DJBA 4GHIA 3QP8A 1S0WA 5B1LD 5CPKA 2GZAA 4WU9B 2ZJ9A 4S2OA 4GD8A 2J8YA 3TE8A 1ULYA 3MZEA 1U35C 1E3UD 2VGJA 3K3CA 3AZMD 1NXYA 1CEFA 5HX9A 3WKJD 1F2KA 4YWZA 5B1MA 5AV8A 4HMEA 3W8KA 4D2OA 4H9RA 5AY8D 1CI8A 4BQMA 3LIDA 4GNUA 3X1SC 2WKPA 4HP9A 2PYOB 2AROA 1P3GC 1N4OA 4EQIA 5F68A 4Z2LA 3BWLA 5AV6A 2XH9A 5DNNB 3A0SA 3AZFB 2V1AA 3W99A 4HEFA 4K08A 3MGRD 5EOOA 4J8XC 3UY6A 3C1CC 3H0RC 3REIA 3CUEC 3QP1A 4GDBA 1ZLAC 3R45A 5B40D 1ES2A 4PM8A 1TZYC 1E15A 4Q8IA 1OTBA 2VEAA 4QHCA 1S67L 4DJ2A 1U35A 3WS2A 2ZQDA 1Y28A 1ACFA 2W3GA 5CPIB 5B2IC 1BLPA 5EVEA 5B0YC 3ZYTA 2RVQD 1AXBA 5FDHA 1P3ID 3LUQA 4E3IA 1J9MA 5IS1A 4E45A 3NECA 3AV2C 1FCMA 4EW7A 4DDYA 3E4OA 4YM6B 3UT9C 1ZG6A 2YKHA 1UR9A 2J3TC 3D72A 4N92A 3T50A 4C6YA 4DRBA 1Z09A 3C7VA 4EUZA 2WK0A 3B0CW 3LJAD 4J8XA 4JKTA 3C1CA 3X1TC 4Y0UA 3CUEA 1OMEA 1ZLAA 3UPPA 3C5AA 1FCOA 1MWUA 4FH2A 1TZYA 4H6JA 4QJGA 3REJB 3F1NB 5DVAA 4LCMA 4GLQA 1NJ4A 3WAAC 4I5SA 4NETA 1VB6A 4KUDD 5B2IA 2X02A 4EU0A 4YS3C 1LL9A 1E6ZA 4E04A 2ZOIA 4KZAA 5G18A 3VE3A 3AV2A 3MGQB 1P34B 1HTZA 2JHEA 1XJ2A 5EVLA 5FUGA 3UPNA 4EWFA 3UT9A 1WYCA 3GV9A 4XUJD 2VZWA 4NXEA 1KDWA 2P7JA 3A3IA 3LGOA 4R8PA 2HP9A 2XFSA 3BECA 3X1TA 5TGFA 3MNND 1M18C 3NDEA 4NXBA 5E43A 3V50A 3S7PA 4IBBA 1VEUA 4XT2A 1ESUA 3HLGA 3W98C 3KX0X 3AZED 3HJKA 3VH5W 3GR2A 1JTDA 3VV4A 4EETB 3WAAA 4ETZA 4H9PA 2JKTI 3T12B 5AQ7A 4GB7A 3WA9D 4OQIA 4WU9C 4PHTA 3B6GD 4EUVA 4NG2A 1P3OB 1TS6A 1GSWA 4ZRRA 3AFAA 3A3EA 2PD7A 4KGCD 5F6AA 1XJ3A 2HIOD 2EX8A 2JKRM 1JFIB 1W7FA 4M6BA 2WAEA 4A5RA 1HLUP 1YPRA 2XRNA 4I39A 2BTFP 1TF1A 2D49A 1QO6A 4IEDA 2YFWA 3AGEA 2CV5D 2XD5A 3C30A 1F9IA 1N9LA 2V8FA 4Q0IA 1S32B 5GXQD 1M18A 2PYOC 5HZHA 3LIFA 1T1BA 1P9RA 2OWJA 4OONA 1CQAA 5DNNC 3HSHA 3AZFC 1ED7A 3AN2A 1OTEA 2WGIA 2XA7M 3W98A 4LV1A 2NZDB 4Z2HA 1FQGA 3UTAA 3HUOA 5F1FA 5AV5B 4R3AA 3Q7VA 3FKWA 3B6FC 3SH8A 4WU8B 4WU9A 2JKFA 1UGUA 5F83A 4CPKA 3S7NA 3U2AA 1KX3D 1PWDA 4B93A 4OOYA 5B33B 4N1XA 3LI9A 3CI6A 4I3JA 4OPRA 1CI9A 1B67A 4IUKA 2ACGA 2XEPA 3DWZA 3EG5B 4FOFA 4BL2A 3T1SA 4JXWA 5L09A 1NRFA 4YM6C 1N9BA 1YMXA 5G4YA 2PYOA 1KDSA 5HD5A 5B24A 4H9SC 3AZFA 1BSGA 3E98A 3VSLA 2HDUA 1EQZB 4LD9B 3IF6C 2B95A 4RQ9A 1PWGA 4WNNB 3C4PA 3LY4A 3B6FA 4GOGA 4L9EA 2Y2MA 1Y54A 4PMAA 1O6IA 3REKD 4DXBA 3KO6A 1ES3A 1JVJA 4U3TA 1MC0A 1MKMA 5CGWA 4MBHA 3IP4C 3IXBA 4FD8A 3IBRA 3KYQA 4H9OA 1BYWA 5GT3B 3T1XA 4HJ4A 3MGQC 3BLSA 1P34C 3AZGD 4YM6A 1JWPA 3DWKA 1ID3D 4JPMA 5E2EA 5MC7A 3LELB 5L07A 4EV4A 4H9SA 4QLCB 5CPKD 4KQRA 1H8PA 5B0ZA 1ALQA 4LV2A 3EQVA 3IF6A 4HIAA 2Y2IA 3BFFA 3IS2B 2DQNC 4FCFA 1C3BA 5KZHA 5M18A 3K2NA 3LZ1A 1OTIA 2EWWA 4WLAA 5K5BA 1KX5A 2W8SA 3F1NA 3KS8A 1FILA 4E3KA 3B0DB 5B1MD 1YLJA 2M7UA 1KE0A 3HREA 4E3JA 4X1MA 2Y55A 1CK3A 4IBGA 2BYMB 1YU4A 2ZY3A 4WBGA 1YMSA 5AV6D 5HFOA 2Y91A 2W1TA 5EVIC 1P3OC 3AYWB 4FSFA 3MGQA 2PU2A 1P34A 1MY8A 4IVKA 3MQQA 4S2JA 4IJGA 4G92B 4BBUA 5KSCA 3REID 1BLSA 4RA7A 1OTDA 3FKEA 5CPJB 4HP4A 2BG1A 4X56A 3A1IA 1S32C 1O7EA 2NUTC 3OC2A 4B4ZA 2WKHA 3SS5A 3UB9A 3S22A 2PR6A 1FR1A 1TAFB 5TR7A 3VP3A 2NZDC 2H10A 4LFUA 3IHAA 1FR6A 1E8BA 5CP6B 4NZ1A 5AV5C 3VH5A 1ZTUA 2V1BA 4WU8C 4CAYB 5EVIA 4X23B 1P3OA 5HDDA 3FC7A 5L8MA 4N9KA 2DRWA 4JGQA 5B33C 1WWSA 4LRYC 3EPKA 1JFIA 2J7VA 5DFYA 3C1CD 3NHQA 4DN0A 3UDXA 5AVCB 4GKUA 3FPWA 4MCWA 4KUKA 1H0GA 1GSXA 1GXDA 1F1EA 1TZYD 5HSQA 4WMCA 3FG8A 3R7WB 4UA7A 3VE4A 4JJNB 1EROA 4IBXA 2ZOHA 2ZC3B 3NQUA 4IJEA 1SKOB 4JF4A 3MBZA 1Q2PA 3T4OA 5B2ID 2OLUA 4H9QB 2Z2MB 3VP4A 4GHAA 3L7HA 3H7WA 3AV2D 1D7EA 3GMWA 3WD0A 1EQZC 4LD9C 3MS6A 4FTXA 3AZNA 4R3BA 3NDGA 5AV5A 3AZJD 2YFVA 5F99B 1I2SA 3A6NB 3UT9D 4WU8A 1XX2A 5B2JD 2QKPA 4MBKA 2J3TD 5GLDA 1S1ZA 1P3KB 4R8PD 4GZBA 4X55A 3W2ZA 1L6JA 4IBIA 1KS0A 4ZJ2A 5B33A 2OV5A 4HGAB 3PBQA 2J9PA 3MGSB 5JRGB 2VK3A 1IYOA 2PRFA 5GT3C 1KGEA 4Y3IA 5CEDA 1MWTA 1BULA 5CRFA 5A90A 3WAAD 1T3UA 5BT1C 1MXOA 4Z66B 3LELC 4QLCC 4K0XA 2VV8A 5AV9B 1E6PA 2A2LA 2BASA 2IA2A 1EQZA 1W2EA 3AFAD 4LD9A 1LSXA 3SS3A 4E6WA 5CHJA 2X01A 3B47A 3JPUA 4KZ4A 4GH9A 3WTPE 3RH8B 4XUZA 2LY8A 1EI5A 4UA6A 1K25A 1FCNA 5GSUB 4Q0JA 5DTKA 3BM6A 1WYBA 4R6LA 3B42A 1RP5A 5L2FA 1M18D 2EX9A 3VP2A 3AN2D 3AYWC 2F2AC 5EM0A 1MWSA 3W98D 3SS4A 2HP6A 2GNXA 4WZ5C 1E25A 1K56A 3UTAD 4ID4A 2XROA 4G92C 4XZQC 2RIQA 3LELA 5CTMA 3SW1A 4QLCA 5GHZA 4WU9D 1P3FA 1I5QA 1ZG4A 5CPJC 4NXGA 3ZQ5A 2JBFA 5FA7A 3F1PB 2QPNA 2V2FF 1N9NA 1GA0A 5JYOA 4NXFA 2CC1A 3T4JA 3W96B 3W4PA 1BFMA 1DY6A 1LI0A 1LL5A 3MQ0A 3OLOA 1OGBA 1JTGA 3OCNA 2O0YA 2V5OA 5E5AB 4M4XA 5CP6C 1H3QA 1VETB 5M19A 5BS7C 4OJLA 3N6IA 5B24D 3MVDB 1YSQA 3A3FA 4X23C 2WKIA 5FQ9A 3EPLA 3AYWA 3REHA 4WZ5A 4OP8A 3RELD 4XZQA 4KQDA 5AVCC 5J8XA 3B6FD 3Q1FA 3BY8A 1K0KA 3WRTA 4P85A 4OVDA 4JF6A 2R9XA 1L0FA 4GS9B 4JJNC 1YKDA 4UQIM 3H82B 2ZL1A 4KQQA 4OH0A 3HVFA 4YFMA 4KZ8A 4R38A 2HUEB 4GW9A 3DTKA 3KXBC 3OPLA 4MEZA 3BRMA 4DMZA 2YKFA 4UAAA 1TAFA 3DTIA 3WTPD 4J8UB 4J8WB 1W63Q 3QNBA 3RXWA 4YM6D 5CP6A 3EWKA 5F99C 3Q7ZA 3CITA 3A6NC 5BS7A 1P3AD 4OLDA 2ZY2A 5A91A 3QHYA 1IYQA 3OCLA 4Z1WA 3G34A 1P3KC 1K57A 5B0ZD 5U47A 5FATA 1HVBA 4UPKA 5GT0B 4UHUA 3UMDA 1H0IA 4HGAC 4JGOA 2R9WA 3MGSC 5JRGC 4PM5A 3LZ1D 3N8LA 4BENA 3S4XA 2P9VB 3AV1D 3M2JA 1KX5D 4E44A 3R7WA 3MJQA 3M2KA 4JJNA 1XFNA 4WV4B 2W0NA 2PU4A 4Z66C 4H9QA 2K2NA 1VM1A 3KXBA 4R23A 3MKFA 3UPOA 3P5JB 2ZM2A 2NQBB 3VH5T 5AV9C 1IKGA 3NY4A 2Y2PA 4R1GA 1NLZA 1P3PD 2JKRI 3HBRA 5F99A 2VX8A 5GLCA 4G3WA 4NYUA 3A6NA 3MGPD 1HQ3B 2B5RA 1YT4A 5GSUC 1PRQA 1P3KA 5HAQA 1M19B 1L0DA 3BW6A 3LR4A 1XP4A 3UTBC 2WKQA 5TFQA 5HD3A 3LZ0B 3TW8A 4GN2A 3MGSA 5JRGA 3PR6A 3WS0A 4Z2GA 4J8VB 2IOUA 1PWCA 5FQKA 1AOIB 1I2WA 5BNXB 4QY6A 1SDEA 3A1KA 3VSKA 2R78A 4KHAA 4Z66A 4O01A 1Z2CB 3WS1A 4E6XA 2HJEA 5EVID 4IBEA 4QWOA 5HDCA 3V39A 2OOLA 2C6WB 2JN7A 2O99A 3S1YA 3ZCZA 4GHLA 3ZG0A 4IBRA 5BO0B 3W96C 3KWQB 1OJGA 1ONGA 4PKYG 4DJ3A 1YSPA 4RYEA 4WMCD 3LR0A 3X1SA 3CPTB 5E5AC 3MXRA 3UTBA 1P3GA 2JSSA 3FDDA 1LT0A 2E8IA 3MVDC 3CLOA 2XA7S 2EFUA 4QPRA 3T4LA 4Z2KA 1TVFA 3NOTC 3LIEA 5EUAA 3VH6W 3AZND 1CF0A 4MMNA 5AV5D 2PYRA 3ZNYA 4WF0A 3MMHA 4WU8D 5B31D 1KVLA 2KDKA 4E3LA 3AZIC 4QY5A 3T4KA 3F1PA 3X1UB 1XJ6A 1DJCA 3T1QB 2B02A 5HL6A 2HUEC 5B0YA 5B33D 2Y2NA 1P3MB 3C8CA 1XA1A 3Q07A 5IU1A 2HP5A 2KLIA 4J8UC 1BLHA 4J8WC 4CLCB 3FV7A 2IWDA 2VQRA 1ES5A 3T4SA 5E5AA 1IKIA 4OJ6A 1XGIA 2WGVA 2XR0A 3TSGA 3AZKB 3AZHB 4HJ3A 3MVDA 2P74A 1M1AD 2ZBBA 1KX4D 2EWVA 3ISGA 4Z2MH 1EQZD 4LD9D 5GT0C 4HH2A 2VGKA 2IO5B 2W27A 2ZC6B 1YU2A 1IYPA 2H0TA 4GCZA 1L0EA 3C2WA 3AGFA 3WKJB 3AZIA 3IBJA 3X1VD 2L0WA 3H82A 2Z2LB 1D06A 2FZ0A 4YS3A 2Y59A 4QNLA 1W8QA 2OAP1 3TRCA 5EV0A 3A0VA 3BQAA 5IT5A 1HD8A 3IXDA 4KG6A 3D9YA 4EBPA 4K0WA 4J8UA 1E88A 4J8WA 1P9WA 3EGXC 4P87A 2A3UA 4WZSB 2BYKB 3MGRB 1K56D 1K4EA 5BT1D 5FAPA 5CX7A 4O0PA 1HQ3C 3LELD 4QLCD 4LGWA 1P3FD 5FASA 4KZ3A 4R4SA 2Y79A 1M19C 5GT0A 1K38A 3WD1A 3LZ0C 4CSRA 1GSVA 4J8VC 2XF3A 5BNVA 5HDSA 1AOIC 1W1TA 4EXOA 1BT5A 4KZ6A 3S7QA 2G2UA 2VGLM 1L0GA 3REHD 5CPIC 4N1HA 1ZKJA 2O9BA 4Y7PA 3LJAB 5B31G 1VQQA 4XZQD 4S2MA 1HQ3A 1W8YA 3KWQC 4IBCA 5EPHA 1G6AA 2JE5A 2ZQ8A 3D4FA 2L5AA 3VP1A 1M19A 2V1ZA 5F5YA 1WE4A 3ZG8B 5JA4B 5HAIA 4F3LB 3LZ0A 4EEUA 1QMFA 3EPJA 3MSHA 4PPRA 1ODVA 3NBLA 4HHDA 4S2NC 5DNNA 4KUDB 4MBFA 4QD4A 5DKKA 4J8VA 1KOUA 4QB8A 3BEBA 4WYYA 5CGSA 2V20A 5BNXA 5FI6A 1IEMA 1YLPA 1TDLA 2Q9NA 4IBJA 4H8RA 5DKLA 4DE2A 3SZTA 2FJ7B 5CP6D 1MBLA 3MQOA 1TS7A 4G3VA 3REJC 2Y2QA 3KFUG 4XUJB 3ZNTA 4Z2IA 5B32B 3WD2A 2PD8A 3X1UC 5CPIA 1GHIA 1LHYA 3QP5A 5CECA 1P3MC 3MNNB 5BO0A 5TBMB 1NLYA 3QP4A 1STZA 3MXSA 3E0YA 5DJUA 4X25A 4CLCC 4QU3A 1CJFA 1TD5A 3CPTA 3M6HA 3AZKC 4DRTA 5M1AA 5HPIA 4S2NA 3AZHC 3MXQA 1AIWA 1ERMA 5AVEA 1KE3A 3KXBD 3AZLB 4X6TA 3WA9B 4L0LA 3KUYB 3EEAA 4LG2A 3B6GB 3GQZA 2Y2OA 3L2AA 4OPYA 4KGCB 1BTLA 5F99D 3HLFA 2HIOB 3VH6A 3A6ND 4NZ5A 3REJA 3DTEA 3WKJC 4ZBEA 5AV8D 3KSGA 4OUIA 1GHMA 4BL3A 2DF4C 3X1UA 2ZMVA 5F69A 1JWVA 2AROD 1P3MA 1SKFA 2F8NK 5FQMA 3V5MA 5JRGD 3N3FA 5GXQB 3O3VA 1FSWA 3W99D 2XK1A 4S2IA 2HGVA 2EXBA 3M7PA 4FH4A 2XD1A 3MGRC 4LV3A 3AZHA 4Z66D 2JKTM 2B18A 2ZY5A 4DDSA 3QP2A 4BJPA 4NZ3A 1U35D 3ZG9B 3ZFZA 2J8PA 3OOVA 1P3LB 2ZMAA 3KSYA 2Y2KA 1BH8B 3E4QA 1KX3B 1LL8A 1MWRA 3UN7A 5HAPA 3PBRA 4Z5TB 3N7WA 1YUEA 3IT9A 2RVQC 1NYYA 4Y17A 1IOUA 2J80A 1BZAA 1EWZA 4C75A 3X1SD 3IWOA 1ES4A 4M3KA 3RTYA 2WGWB 3UTBD 1P3GD 4C3QA 3L9KA 3K3DA 4P6ZM 4HQAA 5EM1A 2EX2A 4J8XD 1TS0A 2BYKA 3LJAC 1ZLAD 4PM7A 3IWIA 2V0WA 3ZVTA 1GHPA 3O88A 3AGDA 4DF6A 4AWLB 4IBKA 1BUEA 4MLLA 2J3WA 1P3BB 1S32A 1D1JA 5FSRA 3U4LP 3LEQA 3IX8A 5B0YD 2Y4AA 4KUDC 1P97A 4I3AA 1E6RA 1LSVA 1UWPX 3VMAA 3I7JA 4ZJ3A 3HLWA 5AVBB 2NZDA 4YINA 3UB8A 4OQGA 1XKZA 4H9NB 1IFQA 3GVBA 4I38A 3EEHA 4KZBA 2FJ7C 3NULA 5AJGA 3DAVA 3DW0A 5KDMB 4EO5B 4OJPA 1ERQA 2CWEA 4XUJC 2QZ6A 5B32C 2ZC5B 5CGXA 1NZUA 3X1TD 3TU4B 3LJAA 3MFXA 4Z9QA 3NQJB 3KS4A 2ZD8A 2D02A 2PR5A 4FUWA 3AZID 1YQSA 4UQIS 4DKIA 5B1MB 1PNEA 5FEFA 4NY2A 4HBTA 4YS3D 5FQJA 3V9RB 2QYBA 4KUDA 1NZOA 2FH5A 3AZLC 3EPHA 2H5SA 2DCFA 2LB9A 2X71A 3WA9C 3NJAA 2QWSA 3KSHA 5CXWA 3NOPC 5AV6B 4E3NA 3KUYC 1F66B 5E2HA 3MFDA 4J8UD 3B6GC 4J8WD 2Y2LA 3IHBA 1GA9A 4MB3A 3L25A 4R4RA 5CERA 2FJ7A 2XDMA 4WNNA 4KGCC 1IYSA 2HIOC 4WJ3C 4HMCA 3BY9A 3REIB 3B0DC 3T1RA 2GJ3A 3R45B 2G5IC 1NWZA 5B32A 2NUPC 2EA9A 3IXHA 3E4PA 5GT0D 3VP0A 3P09A 1PW1A 1XGJA 2A24B 4OQHA 1DP9A 5GT3A 2INWA 1SDNA 3MKEA 3BYDA 4HNBA 2V9AA 3HLCA 3C1BB 4II7A 3LR5A 3VFHA 5FI2A 3AZLA 2IWBA 2W3FA 4LCLA 3KUYA 3LO7A 4KG5A 3IS2A 1P3LC 4YNRA 2QJ7A 4KGCA 3OPPA 2HV1A 1KX3C 3BFGA 3BQ8A 4LLOB 2HIOA 4Z5TC 3C1CB 3BFDA 3Q82A 3L27A 4OP5A 2K7SA 3TOIA 4EBNA 1TZYB 4H6JB 3T4TA 1M19D 1O07A 1P0ZA 2BYMA 3HLBA 4NE5A 2PYOD 3LZ0D 2W1RA 3WWXA 5DNND 2J9OA 2P04A 3LCEA 3AZFD 1E4DA 1Q9CA 2F8NH 5F1GA 3T4QA 2PAVP 2HF6A 1PYYA 3SH9A 3ICYA 3WS5A 1OJ5A 4NFTA 4RX3A 3AZJB 2VLGA 1G28A 2AVXA 5CPJA 1PI4A 1L3LA 4P0MA 5B2JB 4AWLC 3VH6T 3DBAA 4BMWA 4EBLA 1P3BC 1XFQA 1P3LA 5CPID 4ZTKA 5HWVA 1BH8A 4R8PB 1H3OB 5A8BA 3JYIA 4OJ5A 4Z5TA 4ZAMA 3H0LC 4XUXA 3UDFA 2OAQ1 1RGYA 5AVBC 4XT2B 4OLGA 3UB6A 4CAYA 4EO5C 2F8NB 3R4KA 4X23A 1GPFA 4KQOA 4ZUXB 5G49B 2RCXA 4PM9A 2ZQAA 4JBFA 1OT9A 3AFAB 3TU4C 5L10A 5AVCA 2Z6DA 2ZC4B 5CHLB 2VKSA 5GHXA 3REJD 4Z2JA 1P3BA 4IVIA 4KG2A 4MNRA 3X1UD 1SKOA 3NI9A 5HL1A 3D3OA 2FN2A 3B3XA 4MN5A 5EFWA 1PIOA 5DFXA 3HUMA 4OKPA 1JWZA 2V8CA 2G5HC 4BD1A 1RCJA 5AVBA 3MGQD 1F66C 1P34D 3AL0C 4H9NA 3AN2B 3HCYA 3TG9A 4HI4A 3B33A 1T1CA 3ZGAB 1R4VA 2PBDP 3FWLA 1NRJA 3AZHD 3UTAB 4PAUA 3REIC 3Q7VB 4MB4A 1U60A 4R0QA 5DJTA 1YLWA 5KSHA 1PFLA 3PHYA 3V3SA 3LYXA 3TU4A 3CWFA 5DNMB 3LY3A 3NQJA 4R70A 2WZXA 2G2WA 5CHMA 3IX3A 4HH3A 3EQUA 5J7EA 4G91B 3HL9A 5KMWA 3F1OB 2MJ6A 2ZLYA 1WWIA 1RGZA 3C1BC 4NK3A 3V9RA 3HLEA 1H0MA 5AV9A 4R3JA 3C7UA 1P3OD 5BPVA 4ZBJB 5B24B 1F66A 5IHVA 4LRZE 3WD3A 1ZC2A 5JYPA 4GD6A 3RELB 5J3WA 5GSUA 4Y2FA 1AWIA 3B6FB 5G4ZA 1S4RA 4WZ4A 3SOIA 5CHUA 1S32D 4F94A 4DXCA 5C3IB 4P6BA 5FAQA 3VOYA 3BFEA 5I5LA 4IJFA 1DP6A 2A24A 4JXVA 1CXWA 2VV7A 5DF8A 1N9OA 2ZQCA 4ME4A 3CG5A 2NZDD 3HONA 4H9OB 3WTPB 3C1BA 2XLNA 4Y0OA 3W97B 3AZJC 3UMEA 2VGLS 4JF5A 3LIBA 3OBFA 1P3AB 1SHVA 5B2JC 4HY8A 1K55C 2Y8HA 3WX7A 5HW3A 3LI8A 5B0ZB 5GLBA 4IHQA 4R8PC 1G6OA 3CZDA 3IF6B 2IWCA 4MN7A 4OPZA 3W96A 2CMNA 3FPVA 5HPFA 1XPBA 3WS4A 3LZ1B 3JVUA 2L4RA 3AV1B 3O62B 3OPRA 4Y15A 1W79A 1KX5B 4S2KA 2KOIA 2G7UA 1VETA 3MR0A 3V67A 2JC7A 2HJ9C 5B1LB 1KE4A 4I3IA 4ZUXC 4UUZB 2DNSA 2ZQ7A 3PYPA 3ITAA 2W1TB 5A92A 2XQZA 3AZMB 1Z6FA 3AFAC 1E6NA 4L9GA 3H0MC 2FJ7D 1P3PB 3AZJA 2OSUA 3O5YA 4LENA 3RJUA 2EX6A 3NC8A 2Y2HA 3MGPB 1H8MA 3HLDA 5B2JA 4GS9A 1K55A 4MN6A 5B32D 4NYYA 3G2YA 1KGFA 2DMWA 5AY8B 2HPBA 4WEKA 2A49A 3LIAA 1H3OA 4S2PA 4RVAA 2NQBC 2Y2JA 1SZVA 1A7WA 5GT3D 5FL3A 4IUHA 1NY0A 2WYXA 5AQBA 3AN2C 1OGGA 4U0TA 3O86A 1BLCA 3N8SA 1HZOA 4HBUA 3UTAC 2F8NA 3FKVA 3G2ZA 3AZLD 5B40B 2GDNA 4ZUXA 1W1PA 2HDRA 5G49A 2PBYA 3IH8A 1BH9B 3PXPA 2W3DA 3KUYD 3UB7A
chains in the Genus database with same CATH topology
5EVIB 5DNMC 3ZDJA 1YU3A 4Z2MG 2UWXA 2P9VA 3GRJA 1TDGA 3ZHHA 1P3IB 4WEJA 5E2FA 4G91C 1H8ZA 3FZCA 1PI5A 3VFFA 3NQUB 4IBFA 2NQBA 2H0YA 3AYWD 4ZBJC 5B24C 1YU0A 1XA7A 1G68A 2RL3A 2OLVA 3G35A 3AZNB 4JXSA 5D3OA 3RELC 2YFVB 5BOHA 1LI9A 5CPJD 3IQAA 5B31B 2C5WB 3W4OA 1P3LD 5C3IC 5DNMA 4DE0A 3VOZA 4JLFA 4Z5TD 1AOIA 1KGGA 4B88A 2WUQA 3WTPC 2EFXA 3W97C 4PM6A 4OPQA 2XFTA 5CTNA 4X23D 1P3AC 3O87A 1M1AB 1KX4B 5B0ZC 3PBOA 4Y0TA 5AVCD 3F6TA 3KWQA 3RELA 5B32G 4OQ0A 3LZ1C 3AV1C 3O62C 4JJND 1IELA 3AZEB 1KX5C 1P3BD 3X1VB 5DF9A 3PBTA 1B6WA 1YU1A 3BFCA 5B1LC 2ZQ9A 3HUNA 3L29A 2Y2GA 5EE8A 5AVBD 1PZPA 1N1JB 3WTPA 1PZOA 3PAGA 5EECA 3AZMC 2IO5C 1P3PC 4WELA 3W97A 5FI7A 3SH7A 5GLAA 5AQAA 1P3AA 3MGPC 3ITBA 1P3KD 1P3FB 5AY8C 2CV5B 1HTAA 4OJOA 3MGSD 3TU4D 3MZFA 3ZG5A 1MKIA 5AQ9A 3AV1A 3O62A 5HARA 1K6SA 3AZKA 3UNWA 3RXXA 3BLMA 4KZ9A 5B1LA 5B40C 4UUZA 5AV9D 3A3DA 4NE6A 5GL9A 3Q81A 1F66D 1E3UA 3AZMA 4WM9A 3REHB 1YLTA 1P3PA 4DE3A 3WKJA 4O7DA 1FSYA 4XZQB 5GSUD 1P3IC 3G32A 3MGPA 3E2KA 3FYZA 3CJMA 5AY8A 3DTMA 3G31A 4U0XA 2ZM5A 4ZDXA 3PBSA 3C1BD 3MGRA 3AZNC 3IH9A 5B40A 1BH9A 2JCHA 3N4IA 5B31C 3N8RA 3REKB 3ZVWA 3W96D 2FFYA 1P3IA 3C4OA 3UDIA 3UE0A 1LLBA 5E5AD 3AZGB 1ID3B 3MVDD 4HESA 5DTSA 5CPKB 3KXBB 1XXMA 1K4FA 1M1AC 4XXRA 4X68A 1KX4C 3MZDA 2ZC7A 1MPLA 1YLZA 3UE3A 3MNNC 3CMZA 4BLMA 4X53A 2WAFA 3L28A 3P98A 5B31A 5JA4A 1H8YA 5AV8B 3AZEC 3NCKA 5FAOA 1QMEA 4X69A 3X1VC 4H9RB 3V3RA 2AROB 4NZ4A 1KU5A 2WADA 5DF7A 3W99B 2I72A 3NIAA 2FFFB 5E2GA 4E3MA 3B0BA 4DQYB 1YM1A 1PZRA 5EOEA 2F8ND 4XUJA 4KHAB 3OPHA 5FQIA 4JXGA 4ZUXD 1YLYA 4KZ5A 1M1AA 1SCWA 1P3FC 2XGNA 3QNCA 1KX4A 2CV5C 1U35B 2ZY4A 3PAEA 4OOLA 5GXQC 3MNNA 3GSGA 5FQQA 4NE3A 4IBDA 2BLSA 2ZM0A 1Q2QA 4S2LA 4DE1A 3AZEA 1PW8A 3X1VA 2HDSA 3X1SB 1ESIA 3UTBB 1P3GB 1W5DA 4N9LA 3WA9A 2NQBD 2WKEA 5CEBA 3B6GA 3IWQA 1N1JA 3REHC 5GHYA 4J8XB 4ZJ1A 2EXAA 4DRAA 1HQ3D 1ZLAB 3PBNA 3G4PA 3ZG7B 4KZ7A 2WZZA 4GDNA 2CV5A 2Q9MA 5DNMD 5GXQA 2HDQA 5B2IB 4J8VD 5B0YB 1AOID 3LEZA 3IF5A 3GTCA 3UE1A 3AV2B 5FUGB 5DTTA 3A3JA 1GCEA 3UT9B 1S6RA 3PTEA 4K91A 3REKC 1KX3A 1K54C 1K57C 3UO9A 4E3OA 3X1TB 4KENB 3KWQD 4RX2A 4UA9A 5F82A 1FOFA 1KVMA 3OZHA 3B0CT 2WGWA 3L26A 3AZIB 3AZGC 1ID3C 3WAAB 4H9PB 4BD0A 4YS3B 4CJNA 4B4XA 5CPKC 2ZM8A 1K6RA 2F8NG 3IXGA 3M6BA 1TEMA 3W97D 1CEGA 1M6KA 5I94A 2QMIA 3WRZA 3G30A 1ONHA 4OOMA 1M40A 3E2LA 1H5XA 4LV0A 5B1MC 5AV8C 3REKA 2YFWB 1K54A 1L2SA 1DJAA 1NYMA 1P3MD 3W4QA 1M18B 2AROC 4CSRB 5AV6C 3W99C 5BNVB 3O62D 3W98B 3AZGA 5A93A 3AZKD 1ID3A 5KDMA 1DJBA 1S0WA 5B1LD 5CPKA 4WU9B 2ZJ9A 4S2OA 4GD8A 2J8YA 1ULYA 3MZEA 1U35C 1E3UD 2VGJA 3AZMD 1NXYA 1CEFA 5HX9A 3WKJD 5B1MA 5AV8A 3W8KA 4D2OA 4H9RA 5AY8D 1CI8A 4BQMA 4GNUA 3X1SC 2PYOB 2AROA 1P3GC 1N4OA 4EQIA 5AV6A 2XH9A 5DNNB 3AZFB 3W99A 4HEFA 3MGRD 5EOOA 4J8XC 3UY6A 3C1CC 3H0RC 3REIA 4GDBA 1ZLAC 3R45A 5B40D 1ES2A 4PM8A 1TZYC 4Q8IA 4QHCA 1U35A 3WS2A 2ZQDA 5CPIB 5B2IC 1BLPA 5B0YC 2RVQD 1AXBA 5FDHA 1P3ID 4E3IA 1J9MA 4E45A 3AV2C 1FCMA 4DDYA 4YM6B 3UT9C 1ZG6A 4N92A 4C6YA 4DRBA 3C7VA 4EUZA 2WK0A 3B0CW 3LJAD 4J8XA 4JKTA 3C1CA 3X1TC 4Y0UA 1OMEA 1ZLAA 3UPPA 3C5AA 1FCOA 1MWUA 4FH2A 1TZYA 4QJGA 3REJB 5DVAA 4LCMA 1NJ4A 3WAAC 4NETA 4KUDD 5B2IA 2X02A 4YS3C 1LL9A 4KZAA 5G18A 3AV2A 3MGQB 1P34B 1HTZA 5EVLA 5FUGA 3UPNA 4EWFA 3UT9A 1WYCA 3GV9A 4XUJD 1KDWA 3A3IA 4R8PA 2HP9A 2XFSA 3BECA 3X1TA 5TGFA 3MNND 1M18C 3NDEA 5E43A 3V50A 4IBBA 1ESUA 3HLGA 3W98C 3AZED 3VH5W 3GR2A 1JTDA 3WAAA 4H9PA 5AQ7A 4GB7A 3WA9D 4OQIA 4WU9C 3B6GD 1P3OB 3AFAA 3A3EA 4KGCD 2HIOD 2EX8A 1JFIB 1W7FA 4M6BA 2WAEA 4A5RA 4IEDA 2YFWA 3AGEA 2CV5D 2XD5A 1S32B 5GXQD 1M18A 2PYOC 4OONA 5DNNC 3HSHA 3AZFC 3AN2A 2WGIA 3W98A 4LV1A 2NZDB 1FQGA 3UTAA 3HUOA 5F1FA 5AV5B 3Q7VA 3FKWA 3B6FC 3SH8A 4WU8B 4WU9A 5F83A 4CPKA 1KX3D 1PWDA 4OOYA 5B33B 4N1XA 4OPRA 1CI9A 1B67A 2XEPA 3DWZA 3EG5B 4BL2A 4JXWA 1NRFA 4YM6C 1N9BA 1YMXA 2PYOA 1KDSA 5B24A 4H9SC 3AZFA 1BSGA 3VSLA 2HDUA 1EQZB 4LD9B 3IF6C 1PWGA 4WNNB 3C4PA 3LY4A 3B6FA 4GOGA 2Y2MA 1Y54A 4PMAA 3REKD 4DXBA 1ES3A 1JVJA 4U3TA 5CGWA 4MBHA 3IP4C 3IXBA 4FD8A 4H9OA 5GT3B 3MGQC 3BLSA 1P34C 3AZGD 4YM6A 1JWPA 3DWKA 1ID3D 4JPMA 5E2EA 3LELB 4EV4A 4H9SA 4QLCB 5CPKD 4KQRA 5B0ZA 1ALQA 4LV2A 3EQVA 3IF6A 2Y2IA 3BFFA 2DQNC 4FCFA 1C3BA 5KZHA 5M18A 3LZ1A 1KX5A 2W8SA 3KS8A 4E3KA 3B0DB 5B1MD 1YLJA 1KE0A 3HREA 4E3JA 2Y55A 1CK3A 4IBGA 2BYMB 1YU4A 2ZY3A 4WBGA 1YMSA 5AV6D 5HFOA 2Y91A 5EVIC 1P3OC 3AYWB 4FSFA 3MGQA 2PU2A 1P34A 1MY8A 4IVKA 4S2JA 4G92B 5KSCA 3REID 1BLSA 4RA7A 3FKEA 5CPJB 2BG1A 4X56A 3A1IA 1S32C 1O7EA 3OC2A 4B4ZA 2WKHA 3SS5A 3S22A 1FR1A 1TAFB 5TR7A 3VP3A 2NZDC 2H10A 3IHAA 1FR6A 5CP6B 4NZ1A 5AV5C 3VH5A 4WU8C 4CAYB 5EVIA 4X23B 1P3OA 4N9KA 2DRWA 5B33C 1WWSA 3EPKA 1JFIA 2J7VA 3C1CD 3UDXA 5AVCB 4GKUA 1F1EA 1TZYD 4WMCA 4UA7A 4JJNB 1EROA 4IBXA 2ZC3B 3NQUA 4IJEA 4JF4A 3MBZA 1Q2PA 5B2ID 2OLUA 4H9QB 2Z2MB 3VP4A 4GHAA 3AV2D 3GMWA 1EQZC 4LD9C 3AZNA 4R3BA 3NDGA 5AV5A 3AZJD 2YFVA 5F99B 1I2SA 3A6NB 3UT9D 4WU8A 1XX2A 5B2JD 4MBKA 5GLDA 1P3KB 4R8PD 4GZBA 4X55A 4IBIA 4ZJ2A 5B33A 2OV5A 4HGAB 3PBQA 2J9PA 3MGSB 5JRGB 1IYOA 5GT3C 1KGEA 5CEDA 1BULA 1MWTA 5CRFA 5A90A 3WAAD 1T3UA 5BT1C 1MXOA 4Z66B 3LELC 4QLCC 4K0XA 5AV9B 1EQZA 1W2EA 3AFAD 4LD9A 3SS3A 4E6WA 5CHJA 2X01A 4KZ4A 4GH9A 3WTPE 4XUZA 2LY8A 1EI5A 4UA6A 1K25A 1FCNA 5GSUB 5DTKA 3BM6A 1WYBA 1RP5A 5L2FA 1M18D 2EX9A 3VP2A 3AN2D 3AYWC 2F2AC 1MWSA 3W98D 3SS4A 2HP6A 4WZ5C 1E25A 1K56A 3UTAD 4ID4A 4G92C 4XZQC 2RIQA 3LELA 5CTMA 4QLCA 5GHZA 4WU9D 1P3FA 1I5QA 1ZG4A 5CPJC 2JBFA 5FA7A 2QPNA 2V2FF 1GA0A 5JYOA 2CC1A 3W96B 3W4PA 1BFMA 1DY6A 1LI0A 1LL5A 1JTGA 3OCNA 5E5AB 5CP6C 5M19A 5BS7C 4OJLA 3N6IA 5B24D 3MVDB 3A3FA 4X23C 2WKIA 5FQ9A 3EPLA 3AYWA 3REHA 4WZ5A 4OP8A 3RELD 4XZQA 5AVCC 5J8XA 3B6FD 3Q1FA 3WRTA 4P85A 4OVDA 4JF6A 2R9XA 1L0FA 4JJNC 4KQQA 4OH0A 3HVFA 4YFMA 4KZ8A 2HUEB 3KXBC 3OPLA 4MEZA 3BRMA 4UAAA 1TAFA 3WTPD 4J8UB 4J8WB 3QNBA 3RXWA 4YM6D 5CP6A 5F99C 3Q7ZA 3A6NC 5BS7A 1P3AD 4OLDA 2ZY2A 5A91A 3QHYA 1IYQA 3OCLA 3G34A 1P3KC 1K57A 5B0ZD 5U47A 5FATA 1HVBA 4UPKA 5GT0B 4UHUA 4HGAC 2R9WA 3MGSC 5JRGC 4PM5A 3LZ1D 3N8LA 4BENA 3S4XA 2P9VB 3AV1D 3M2JA 1KX5D 4E44A 3M2KA 4JJNA 4WV4B 2PU4A 4Z66C 4H9QA 1VM1A 3KXBA 4R23A 3MKFA 3UPOA 3P5JB 2ZM2A 2NQBB 3VH5T 5AV9C 1IKGA 3NY4A 2Y2PA 4R1GA 1P3PD 3HBRA 5F99A 5GLCA 4NYUA 3A6NA 3MGPD 1HQ3B 2B5RA 1YT4A 5GSUC 1P3KA 5HAQA 1M19B 1L0DA 1XP4A 3UTBC 5TFQA 3LZ0B 4GN2A 3MGSA 5JRGA 3WS0A 4J8VB 2IOUA 1PWCA 5FQKA 1AOIB 1I2WA 5BNXB 4QY6A 1SDEA 3A1KA 3VSKA 4KHAA 4Z66A 1Z2CB 3WS1A 4E6XA 5EVID 4IBEA 3V39A 2C6WB 3S1YA 3ZCZA 4GHLA 3ZG0A 4IBRA 5BO0B 3W96C 3KWQB 1ONGA 4WMCD 4RYEA 3X1SA 5E5AC 3MXRA 3UTBA 1P3GA 2JSSA 3FDDA 2E8IA 3MVDC 2EFUA 1TVFA 5EUAA 3VH6W 3AZND 5AV5D 3ZNYA 4WU8D 5B31D 1KVLA 4E3LA 3AZIC 4QY5A 3X1UB 1DJCA 2HUEC 5B0YA 5B33D 2Y2NA 1P3MB 1XA1A 3Q07A 2HP5A 4J8UC 1BLHA 4J8WC 3FV7A 2IWDA 2VQRA 1ES5A 5E5AA 1IKIA 4OJ6A 1XGIA 2WGVA 2XR0A 3TSGA 3AZKB 3AZHB 3MVDA 2P74A 1M1AD 1KX4D 3ISGA 4Z2MH 1EQZD 4LD9D 5GT0C 2VGKA 2IO5B 2ZC6B 1YU2A 1IYPA 2H0TA 1L0EA 3AGFA 3WKJB 3AZIA 3X1VD 2Z2LB 2Y59A 4YS3A 4QNLA 1W8QA 1HD8A 3IXDA 4KG6A 4EBPA 4K0WA 4J8UA 4J8WA 4P87A 2A3UA 4WZSB 2BYKB 3MGRB 1K56D 1K4EA 5BT1D 5FAPA 1HQ3C 3LELD 4QLCD 1P3FD 5FASA 4KZ3A 4R4SA 1M19C 5GT0A 1K38A 3LZ0C 4CSRA 4J8VC 2XF3A 5BNVA 1AOIC 1BT5A 4KZ6A 2G2UA 1L0GA 3REHD 5CPIC 4N1HA 1ZKJA 4Y7PA 3LJAB 5B31G 1VQQA 4XZQD 4S2MA 1HQ3A 1W8YA 3KWQC 4IBCA 5EPHA 1G6AA 2JE5A 2ZQ8A 3D4FA 2L5AA 3VP1A 1M19A 2V1ZA 1WE4A 3ZG8B 5JA4B 5HAIA 3LZ0A 1QMFA 3EPJA 4PPRA 3NBLA 4S2NC 5DNNA 4KUDB 4MBFA 4QD4A 4J8VA 4QB8A 3BEBA 4WYYA 5CGSA 2V20A 5BNXA 5FI6A 1IEMA 1YLPA 1TDLA 2Q9NA 4IBJA 4H8RA 4DE2A 2FJ7B 5CP6D 1MBLA 3REJC 2Y2QA 3KFUG 4XUJB 3ZNTA 5B32B 3X1UC 5CPIA 1GHIA 1LHYA 5CECA 1P3MC 3MNNB 5BO0A 3MXSA 4QU3A 3M6HA 3AZKC 4DRTA 5M1AA 4S2NA 3AZHC 1ERMA 1KE3A 3KXBD 3AZLB 4X6TA 3WA9B 4L0LA 3KUYB 4LG2A 3B6GB 3GQZA 2Y2OA 3L2AA 4OPYA 4KGCB 1BTLA 5F99D 3HLFA 2HIOB 3VH6A 3A6ND 4NZ5A 3REJA 4ZBEA 3WKJC 5AV8D 4OUIA 1GHMA 4BL3A 2DF4C 3X1UA 1JWVA 2AROD 1P3MA 1SKFA 2F8NK 5FQMA 3V5MA 5JRGD 3N3FA 5GXQB 3O3VA 1FSWA 3W99D 2XK1A 4S2IA 2EXBA 4FH4A 2XD1A 3MGRC 4LV3A 3AZHA 4Z66D 2ZY5A 4DDSA 4BJPA 4NZ3A 1U35D 3ZG9B 3ZFZA 2J8PA 1P3LB 2ZMAA 3KSYA 2Y2KA 1BH8B 1KX3B 1MWRA 3UN7A 5HAPA 3PBRA 4Z5TB 3N7WA 1YUEA 3IT9A 2RVQC 1NYYA 1BZAA 1EWZA 4C75A 3X1SD 3IWOA 1ES4A 4M3KA 2WGWB 3UTBD 1P3GD 4C3QA 2EX2A 4J8XD 2BYKA 3LJAC 1ZLAD 4PM7A 3IWIA 3ZVTA 1GHPA 3O88A 3AGDA 4DF6A 4AWLB 4IBKA 1BUEA 4MLLA 1P3BB 1S32A 5FSRA 5B0YD 2Y4AA 4KUDC 3VMAA 3I7JA 4ZJ3A 3HLWA 5AVBB 2NZDA 4YINA 4OQGA 1XKZA 4H9NB 3GVBA 4KZBA 2FJ7C 3DW0A 5KDMB 4EO5B 4OJPA 1ERQA 2CWEA 4XUJC 2QZ6A 5B32C 2ZC5B 5CGXA 1NZUA 3X1TD 3TU4B 3LJAA 4Z9QA 3NQJB 3KS4A 2ZD8A 3AZID 1YQSA 4DKIA 5B1MB 4NY2A 4HBTA 4YS3D 5FQJA 3V9RB 4KUDA 1NZOA 3AZLC 3EPHA 2H5SA 2DCFA 2X71A 3WA9C 5CXWA 5AV6B 4E3NA 3KUYC 1F66B 5E2HA 3MFDA 4J8UD 3B6GC 4J8WD 2Y2LA 3IHBA 1GA9A 3L25A 4R4RA 5CERA 2FJ7A 2XDMA 4WNNA 4KGCC 1IYSA 2HIOC 4WJ3C 3REIB 3B0DC 3R45B 2G5IC 5B32A 3IXHA 5GT0D 3VP0A 3P09A 1PW1A 1XGJA 4OQHA 5GT3A 1SDNA 3MKEA 3BYDA 3HLCA 3C1BB 3VFHA 5FI2A 3AZLA 2IWBA 4LCLA 3KUYA 3LO7A 4KG5A 1P3LC 4KGCA 3OPPA 1KX3C 3BFGA 2HIOA 4Z5TC 3C1CB 3BFDA 3Q82A 3L27A 4OP5A 3TOIA 4EBNA 1TZYB 1M19D 1O07A 2BYMA 3HLBA 4NE5A 2PYOD 3LZ0D 3WWXA 5DNND 2J9OA 3LCEA 3AZFD 1E4DA 1Q9CA 2F8NH 5F1GA 1PYYA 3SH9A 3WS5A 4NFTA 4RX3A 3AZJB 5CPJA 1PI4A 4P0MA 5B2JB 4AWLC 3VH6T 4EBLA 1P3BC 1P3LA 5CPID 4ZTKA 1BH8A 4R8PB 1H3OB 3JYIA 4OJ5A 4Z5TA 4ZAMA 3H0LC 4XUXA 3UDFA 1RGYA 5AVBC 4OLGA 4CAYA 4EO5C 2F8NB 4X23A 4KQOA 4ZUXB 5G49B 2RCXA 4PM9A 2ZQAA 4JBFA 3AFAB 3TU4C 5AVCA 2ZC4B 5CHLB 5GHXA 3REJD 1P3BA 4IVIA 4KG2A 4MNRA 3X1UD 3NI9A 5HL1A 3B3XA 1PIOA 3HUMA 4OKPA 1JWZA 2G5HC 4BD1A 1RCJA 5AVBA 3MGQD 1F66C 1P34D 3AL0C 4H9NA 3AN2B 3TG9A 3ZGAB 1R4VA 3FWLA 3AZHD 3UTAB 3REIC 3Q7VB 1U60A 4R0QA 1YLWA 5KSHA 3V3SA 3TU4A 5DNMB 3LY3A 3NQJA 2WZXA 2G2WA 5CHMA 3EQUA 4G91B 3HL9A 5KMWA 2ZLYA 1WWIA 1RGZA 3C1BC 4NK3A 3V9RA 3HLEA 5AV9A 4R3JA 3C7UA 1P3OD 5BPVA 4ZBJB 5B24B 1F66A 5IHVA 1ZC2A 5JYPA 4GD6A 3RELB 5GSUA 3B6FB 3SOIA 4WZ4A 5CHUA 1S32D 4F94A 4DXCA 5C3IB 4P6BA 5FAQA 3VOYA 3BFEA 4IJFA 4JXVA 5DF8A 2ZQCA 3CG5A 2NZDD 3HONA 4H9OB 3WTPB 3C1BA 2XLNA 4Y0OA 3W97B 3AZJC 4JF5A 1P3AB 1SHVA 5B2JC 1K55C 3WX7A 5HW3A 5B0ZB 5GLBA 4R8PC 3CZDA 3IF6B 2IWCA 4OPZA 3W96A 1XPBA 3WS4A 3LZ1B 3AV1B 3O62B 3OPRA 1W79A 1KX5B 4S2KA 2JC7A 5B1LB 1KE4A 4ZUXC 4UUZB 2DNSA 2ZQ7A 3ITAA 5A92A 2XQZA 3AZMB 1Z6FA 3AFAC 3H0MC 2FJ7D 1P3PB 3AZJA 2OSUA 4LENA 3RJUA 2EX6A 3NC8A 3HLDA 2Y2HA 3MGPB 5B2JA 1K55A 5B32D 4NYYA 3G2YA 1KGFA 4WEKA 5AY8B 2HPBA 2A49A 1H3OA 4S2PA 4RVAA 2NQBC 2Y2JA 1A7WA 5GT3D 1NY0A 2WYXA 5AQBA 3AN2C 4U0TA 3O86A 1BLCA 3N8SA 1HZOA 4HBUA 3UTAC 2F8NA 3FKVA 3G2ZA 3AZLD 5B40B 2GDNA 4ZUXA 2HDRA 2PBYA 5G49A 3IH8A 1BH9B 3KUYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FH4 A;  5EVI B;  2XD1 A;  2EX9 A;  4LV3 A;  3VP2 A;  3W8K A;  3ZDJ A;  4D2O A;  1CI8 A;  4BQM A;  4GNU A;  1MWS A;  2P9V A;  2UWX A;  3GRJ A;  4DDS A;  4BJP A;  3SS4 A;  1TDG A;  1N4O A;  3ZHH A;  4EQI A;  3ZG9 B;  4WEJ A;  2HP6 A;  5E2F A;  3ZFZ A;  4WZ5 C;  1E25 A;  1K56 A;  4ID4 A;  1H8Z A;  2XH9 A;  2ZMA A;  3FZC A;  2Y2K A;  5CTM A;  1PI5 A;  5GHZ A;  1MWR A;  3UN7 A;  5HAP A;  3PBR A;  1I5Q A;  3VFF A;  1ZG4 A;  4HEF A;  3N7W A;  3IT9 A;  1NYY A;  2JBF A;  5EOO A;  5FA7 A;  2H0Y A;  3UY6 A;  1BZA A;  1EWZ A;  2QPN A;  2V2F F;  4C75 A;  4GDB A;  1XA7 A;  3IWO A;  1GA0 A;  4PM8 A;  1ES4 A;  1ES2 A;  5JYO A;  4M3K A;  4Q8I A;  1G68 A;  2WGW B;  2CC1 A;  4QHC A;  2RL3 A;  3W4P A;  2OLV A;  1DY6 A;  3G35 A;  1LI0 A;  1LL5 A;  3WS2 A;  4C3Q A;  2ZQD A;  4JXS A;  1JTG A;  5D3O A;  3OCN A;  5BOH A;  1LI9 A;  1BLP A;  1AXB A;  2EX2 A;  3IQA A;  5FDH A;  2C5W B;  5M19 A;  4E3I A;  1J9M A;  3N6I A;  3W4O A;  4PM7 A;  3IWI A;  3A3F A;  1FCM A;  3ZVT A;  2WKI A;  5FQ9 A;  4DE0 A;  1GHP A;  4DDY A;  3VOZ A;  4JLF A;  3O88 A;  3AGD A;  4DF6 A;  1KGG A;  1BUE A;  4MLL A;  4WZ5 A;  4B88 A;  4OP8 A;  1ZG6 A;  5FSR A;  2WUQ A;  4N92 A;  5J8X A;  3Q1F A;  3WRT A;  4C6Y A;  2Y4A A;  3C7V A;  4P85 A;  4EUZ A;  2EFX A;  4OVD A;  2WK0 A;  4JF6 A;  3VMA A;  3I7J A;  4PM6 A;  2R9X A;  4ZJ3 A;  3HLW A;  1L0F A;  4JKT A;  4OPQ A;  2XFT A;  4KQQ A;  5CTN A;  4YIN A;  3O87 A;  4OH0 A;  3HVF A;  4OQG A;  1XKZ A;  3GVB A;  4KZ8 A;  4Y0U A;  4YFM A;  1OME A;  3UPP A;  3C5A A;  1FCO A;  1MWU A;  4KZB A;  4FH2 A;  3OPL A;  4QJG A;  4MEZ A;  5DVA A;  3BRM A;  3PBO A;  4Y0T A;  4LCM A;  3DW0 A;  4UAA A;  1ERQ A;  1NJ4 A;  4NET A;  4OQ0 A;  2X02 A;  2QZ6 A;  3QNB A;  3RXW A;  1LL9 A;  2ZC5 B;  5CGX A;  3Q7Z A;  1IEL A;  1NZU A;  4KZA A;  5G18 A;  4Z9Q A;  4OLD A;  5A91 A;  3QHY A;  1HTZ A;  5DF9 A;  1IYQ A;  3OCL A;  3G34 A;  1K57 A;  2ZD8 A;  3PBT A;  5EVL A;  3BFC A;  5U47 A;  5FAT A;  3UPN A;  1HVB A;  1YQS A;  2ZQ9 A;  3HUN A;  4UHU A;  4DKI A;  2Y2G A;  4EWF A;  5EE8 A;  2R9W A;  1WYC A;  3GV9 A;  1PZP A;  4PM5 A;  4HBT A;  3N8L A;  4BEN A;  1PZO A;  3PAG A;  5FQJ A;  5EEC A;  1KDW A;  3S4X A;  2P9V B;  3M2J A;  1NZO A;  3A3I A;  2HP9 A;  2X71 A;  2XFS A;  2H5S A;  2DCF A;  3BEC A;  4WEL A;  5FI7 A;  3SH7 A;  5GLA A;  5CXW A;  3M2K A;  4E3N A;  5AQA A;  5TGF A;  5E2H A;  3MFD A;  3NDE A;  5E43 A;  3ITB A;  2Y2L A;  3IHB A;  1GA9 A;  3V50 A;  4R4R A;  2PU4 A;  5CER A;  2XDM A;  1ESU A;  1VM1 A;  4R23 A;  3MKF A;  3UPO A;  1IYS A;  3HLG A;  2ZM2 A;  3GR2 A;  1IKG A;  1JTD A;  3MZF A;  3NY4 A;  2Y2P A;  4R1G A;  3ZG5 A;  1MKI A;  5AQ9 A;  5AQ7 A;  4GB7 A;  3HBR A;  3IXH A;  5GLC A;  4OQI A;  5HAR A;  1K6S A;  3VP0 A;  3P09 A;  1PW1 A;  1XGJ A;  2B5R A;  1YT4 A;  3A3E A;  3UNW A;  4OQH A;  5HAQ A;  1SDN A;  3MKE A;  3BLM A;  2EX8 A;  3RXX A;  4KZ9 A;  1L0D A;  1W7F A;  3V5M A;  1XP4 A;  2WAE A;  4A5R A;  3BYD A;  3A3D A;  3HLC A;  5TFQ A;  5GL9 A;  3Q81 A;  4GN2 A;  1E3U A;  3WS0 A;  4WM9 A;  3VFH A;  1YLT A;  1PWC A;  4IED A;  5FI2 A;  3AGE A;  5FQK A;  2XD5 A;  4DE3 A;  1I2W A;  4QY6 A;  2IWB A;  1SDE A;  4LCL A;  4O7D A;  3LO7 A;  4KG5 A;  1FSY A;  3G32 A;  3VSK A;  3E2K A;  4OON A;  3FYZ A;  3OPP A;  3CJM A;  3DTM A;  3BFG A;  3WS1 A;  2WGI A;  4E6X A;  3G31 A;  3BFD A;  4LV1 A;  3Q82 A;  5EVI D;  4OP5 A;  4U0X A;  1FQG A;  3HUO A;  3V39 A;  3TOI A;  4EBN A;  5F1F A;  2C6W B;  3Q7V A;  3FKW A;  1O07 A;  4ZDX A;  3SH8 A;  3PBS A;  3HLB A;  5F83 A;  3S1Y A;  3ZCZ A;  3ZG0 A;  4CPK A;  4IBR A;  1ONG A;  3WWX A;  3LCE A;  2J9O A;  4UA6 A;  4WMC D;  4RYE A;  1PWD A;  1E4D A;  3IH9 A;  4OOY A;  5F1G A;  4N1X A;  3MXR A;  4OPR A;  2JCH A;  1CI9 A;  3N4I A;  2XEP A;  1PYY A;  3DWZ A;  3SH9 A;  3WS5 A;  3N8R A;  2E8I A;  4BL2 A;  2EFU A;  4RX3 A;  3ZVW A;  4JXW A;  1NRF A;  1TVF A;  1N9B A;  1PI4 A;  1YMX A;  4P0M A;  2FFY A;  5EUA A;  3C4O A;  3UDI A;  1KDS A;  3UE0 A;  4EBL A;  4ZTK A;  1LLB A;  1BSG A;  3ZNY A;  3JYI A;  3VSL A;  4ZAM A;  1KVL A;  4E3L A;  2HDU A;  3IF6 C;  4XUX A;  3UDF A;  1RGY A;  1PWG A;  4HES A;  4QY5 A;  1DJC A;  5DTS A;  3C4P A;  3LY4 A;  4OLG A;  1XXM A;  4GOG A;  1K4F A;  2Y2N A;  4XXR A;  4X68 A;  3MZD A;  1XA1 A;  2Y2M A;  2ZC7 A;  3Q07 A;  1Y54 A;  1MPL A;  1YLZ A;  4PMA A;  3UE3 A;  2HP5 A;  4DXB A;  4KQO A;  1BLH A;  1ES3 A;  3CMZ A;  4BLM A;  2RCX A;  1JVJ A;  3FV7 A;  2IWD A;  2ZQA A;  1ES5 A;  4PM9 A;  4JBF A;  1IKI A;  4X53 A;  2WAF A;  1XGI A;  2WGV A;  2XR0 A;  3P98 A;  4U3T A;  3TSG A;  5CGW A;  4MBH A;  3IXB A;  4FD8 A;  1H8Y A;  3NCK A;  5FAO A;  1QME A;  4X69 A;  3V3R A;  2ZC4 B;  2P74 A;  3BLS A;  5GHX A;  1JWP A;  3DWK A;  3ISG A;  4JPM A;  4IVI A;  4KG2 A;  5E2E A;  2VGK A;  4MNR A;  2WAD A;  5DF7 A;  2I72 A;  4EV4 A;  2ZC6 B;  3NI9 A;  3NIA A;  2FFF B;  4KQR A;  3B3X A;  5E2G A;  4E3M A;  1IYP A;  5HL1 A;  2H0T A;  1L0E A;  3AGF A;  1PIO A;  1YM1 A;  3HUM A;  4OKP A;  1ALQ A;  4LV2 A;  1JWZ A;  3EQV A;  3IF6 A;  5EOE A;  2Y2I A;  3BFF A;  1RCJ A;  4BD1 A;  4FCF A;  1C3B A;  2Z2L B;  3OPH A;  5KZH A;  5FQI A;  4JXG A;  5M18 A;  3TG9 A;  2Y59 A;  1YLY A;  4KZ5 A;  1SCW A;  3ZGA B;  1W8Q A;  2XGN A;  3QNC A;  3FWL A;  1HD8 A;  4E3K A;  1YLJ A;  3IXD A;  3PAE A;  4KG6 A;  4OOL A;  4EBP A;  1KE0 A;  3HRE A;  3GSG A;  4K0W A;  4E3J A;  4P87 A;  5FQQ A;  3Q7V B;  2Y55 A;  1CK3 A;  1U60 A;  2BLS A;  4R0Q A;  2A3U A;  2ZM0 A;  1YLW A;  1Q2Q A;  5KSH A;  4S2L A;  4WBG A;  1YMS A;  3V3S A;  1K56 D;  1K4E A;  5FAP A;  5HFO A;  4DE1 A;  1PW8 A;  2Y91 A;  3LY3 A;  5EVI C;  2WZX A;  2HDS A;  4FSF A;  1ESI A;  2G2W A;  2PU2 A;  5CHM A;  1MY8 A;  4IVK A;  4S2J A;  3EQU A;  1W5D A;  4N9L A;  5FAS A;  4KZ3 A;  4R4S A;  3HL9 A;  5KMW A;  2WKE A;  5CEB A;  1K38 A;  2ZLY A;  5KSC A;  1RGZ A;  1BLS A;  4RA7 A;  3IWQ A;  4NK3 A;  3HLE A;  2BG1 A;  2XF3 A;  4X56 A;  5GHY A;  4ZJ1 A;  4R3J A;  2EXA A;  3C7U A;  1O7E A;  3PBN A;  3OC2 A;  5IHV A;  3G4P A;  3ZG7 B;  4B4Z A;  1ZC2 A;  4KZ7 A;  2WZZ A;  4GDN A;  2WKH A;  3SS5 A;  5JYP A;  3S22 A;  4GD6 A;  1BT5 A;  1FR1 A;  2Q9M A;  4KZ6 A;  5TR7 A;  2G2U A;  3VP3 A;  2H10 A;  1L0G A;  2HDQ A;  3IHA A;  1FR6 A;  4N1H A;  3LEZ A;  3IF5 A;  1ZKJ A;  3GTC A;  3UE1 A;  4Y7P A;  3SOI A;  4WZ4 A;  1VQQ A;  5CHU A;  4F94 A;  4DXC A;  4P6B A;  5FAQ A;  4S2M A;  5EVI A;  1W8Y A;  3VOY A;  3BFE A;  4N9K A;  4JXV A;  5EPH A;  5DTT A;  3A3J A;  1G6A A;  2DRW A;  2JE5 A;  2ZQ8 A;  3D4F A;  5DF8 A;  3VP1 A;  2V1Z A;  1GCE A;  1WE4 A;  1S6R A;  2ZQC A;  5HAI A;  2J7V A;  3PTE A;  3ZG8 B;  3CG5 A;  3UDX A;  4GKU A;  4K91 A;  1QMF A;  4PPR A;  2XLN A;  3NBL A;  4S2N C;  4Y0O A;  4MBF A;  4QD4 A;  4WMC A;  1K54 C;  1K57 C;  4QB8 A;  3BEB A;  4WYY A;  4UA7 A;  5CGS A;  3UO9 A;  4E3O A;  2V20 A;  4JF5 A;  1ERO A;  4IBX A;  5FI6 A;  1IEM A;  1YLP A;  2ZC3 B;  1SHV A;  4KEN B;  1TDL A;  4RX2 A;  2Q9N A;  4H8R A;  4UA9 A;  4JF4 A;  3MBZ A;  1Q2P A;  1K55 C;  2OLU A;  5F82 A;  1FOF A;  4DE2 A;  1MBL A;  2Z2M B;  5HW3 A;  1KVM A;  3VP4 A;  5GLB A;  3OZH A;  2WGW A;  3CZD A;  3IF6 B;  2IWC A;  4OPZ A;  3GMW A;  2Y2Q A;  1XPB A;  3ZNT A;  4BD0 A;  3WS4 A;  4R3B A;  3NDG A;  4CJN A;  4B4X A;  3OPR A;  1GHI A;  1LHY A;  1I2S A;  1W79 A;  2ZM8 A;  5CEC A;  1XX2 A;  4S2K A;  1K6R A;  4MBK A;  5GLD A;  2JC7 A;  3MXS A;  3IXG A;  3M6B A;  1TEM A;  4GZB A;  4X55 A;  1KE4 A;  1CEG A;  1M6K A;  5I94 A;  2QMI A;  4ZJ2 A;  3WRZ A;  4QU3 A;  2OV5 A;  3G30 A;  1ONH A;  3PBQ A;  2DNS A;  2J9P A;  2ZQ7 A;  4OOM A;  3M6H A;  3ITA A;  4DRT A;  5A92 A;  1M40 A;  2XQZ A;  3E2L A;  1IYO A;  1H5X A;  1Z6F A;  4LV0 A;  4S2N A;  5M1A A;  1ERM A;  1KE3 A;  1K54 A;  4X6T A;  1L2S A;  1DJA A;  1NYM A;  1KGE A;  2OSU A;  4L0L A;  3W4Q A;  4LEN A;  3RJU A;  2EX6 A;  3NC8 A;  5CED A;  2Y2H A;  1BUL A;  1MWT A;  3HLD A;  5CRF A;  5A90 A;  3GQZ A;  2Y2O A;  4OPY A;  1K55 A;  1MXO A;  3G2Y A;  1KGF A;  4WEK A;  2HPB A;  1BTL A;  3HLF A;  4K0X A;  2A49 A;  5A93 A;  4S2P A;  4ZBE A;  4RVA A;  2Y2J A;  3SS3 A;  1DJB A;  1GHM A;  4BL3 A;  5CHJ A;  4E6W A;  2X01 A;  1NY0 A;  2WYX A;  1S0W A;  5AQB A;  4KZ4 A;  2ZJ9 A;  1JWV A;  4S2O A;  4GD8 A;  4XUZ A;  2J8Y A;  1SKF A;  5FQM A;  1EI5 A;  4U0T A;  3O86 A;  1K25 A;  1FCN A;  3MZE A;  1BLC A;  3N8S A;  1HZO A;  4HBU A;  1E3U D;  2VGJ A;  3O3V A;  1FSW A;  1NXY A;  5DTK A;  2XK1 A;  3FKV A;  3BM6 A;  3G2Z A;  1CEF A;  1WYB A;  2GDN A;  2HDR A;  2PBY A;  3IH8 A;  4S2I A;  5HX9 A;  1RP5 A;  5L2F A;  2EXB A; 
#chains in the Genus database with same CATH topology
 5EVI B;  3EGD C;  3MF0 A;  5DNM C;  3ZDJ A;  2KX6 A;  3GEC A;  3KSI A;  1YU3 A;  4Z2M G;  2UWX A;  2P9V A;  3GRJ A;  3CAX A;  1TDG A;  2E8J A;  3ZHH A;  1P3I B;  4WEJ A;  5E2F A;  4G91 C;  3P7N A;  1H8Z A;  3FZC A;  5C5K A;  1PI5 A;  3VFF A;  3NQU B;  4IBF A;  2NQB A;  2H0Y A;  4LRX C;  3AYW D;  4ZBJ C;  5B24 C;  1YU0 A;  1XA7 A;  1S4S A;  2Z6C A;  1G68 A;  2RL3 A;  3H7W B;  2OLV A;  3G35 A;  3AZN B;  4JXS A;  4HJ6 A;  5D3O A;  3REL C;  2YFV B;  5BOH A;  1LI9 A;  5CPJ D;  3IQA A;  5B31 B;  2LB5 A;  2C5W B;  5KIZ A;  4UEY A;  1S66 L;  3W4O A;  1P3L D;  5C3I C;  5DNM A;  4DE0 A;  3KYE A;  3VOZ A;  4JLF A;  4Z5T D;  1AOI A;  3KSF A;  3UE6 A;  1KGG A;  4Y5F A;  4B88 A;  3F1O A;  2WUQ A;  3WTP C;  2I9V A;  2EFX A;  3W97 C;  4PM6 A;  5LBR A;  2Q0O A;  3QP6 A;  4OPQ A;  2XFT A;  4P6Z S;  5CTN A;  4X23 D;  1P3A C;  3O87 A;  1M1A B;  1VHM A;  1KX4 B;  5B0Z C;  2QJ5 A;  3PBO A;  4Y0T A;  5AVC D;  3F6T A;  3KWQ A;  3REL A;  3MQL A;  1PDC A;  5B32 G;  4OQ0 A;  3LZ1 C;  4EER A;  3AV1 C;  3O62 C;  4JJN D;  1IEL A;  3AZE B;  1KX5 C;  4TX8 A;  1P3B D;  1T18 A;  3X1V B;  1W1Y A;  2PHY A;  5DF9 A;  4PKY A;  3PBT A;  1B6W A;  1YU1 A;  3BFC A;  5B1L C;  2ZQ9 A;  3HUN A;  3L29 A;  2Y2G A;  5EE8 A;  5AVB D;  1PZP A;  1N1J B;  1X0O A;  3WTP A;  1PZO A;  3PAG A;  5EEC A;  3AZM C;  3RFB A;  4CQH A;  2IO5 C;  3GDI A;  4X1L A;  1P3P C;  4WEL A;  3W97 A;  5FI7 A;  3SH7 A;  5GLA A;  4AFI A;  4KUO A;  4WN5 A;  5AQA A;  3JVV A;  1P3A A;  3MGP C;  3ITB A;  2ZMF A;  1YAX A;  1P3K D;  1P3F B;  5AY8 C;  2CV5 B;  1HTA A;  4OJO A;  3MGS D;  3TU4 D;  3MZF A;  3ZG5 A;  1MKI A;  5AQ9 A;  4CLC A;  3AV1 A;  3O62 A;  4JGP A;  5HAR A;  1K6S A;  5HWT A;  3AZK A;  1GOI A;  3UNW A;  3IX4 A;  1V9Z A;  3RXX A;  3BLM A;  3G6O A;  4KZ9 A;  5B1L A;  5B40 C;  4UUZ A;  5AV9 D;  3A3D A;  4NE6 A;  5GL9 A;  3Q81 A;  1F66 D;  1E3U A;  3AZM A;  4HMD A;  4WM9 A;  3REH B;  3LR3 A;  4L9F A;  1YLT A;  1P3P A;  1EW0 A;  4DE3 A;  3NOU C;  3WKJ A;  4O7D A;  1FSY A;  4XZQ B;  5GSU D;  1P3I C;  3G32 A;  3MGP A;  3E2K A;  1FIK A;  3FYZ A;  3CJM A;  5AY8 A;  3DTM A;  3G31 A;  4EQ1 A;  2ZL1 B;  3KYZ A;  4B9O A;  4U0X A;  4NKP A;  2ZM5 A;  4ZDX A;  2O9A A;  3PBS A;  2PYP A;  3C1B D;  3MGR A;  3AZN C;  4Q0H A;  4ARZ B;  3IH9 A;  5B40 A;  3H9W A;  1F98 A;  5FEG A;  1BH9 A;  2JCH A;  2VV6 A;  3N4I A;  4EEP A;  5B31 C;  2VJW A;  4YOF A;  3N8R A;  2W3H A;  3REK B;  2UV0 E;  3ZVW A;  2H28 A;  3W96 D;  3UB5 P;  2FFY A;  5FDS A;  1P3I A;  3C4O A;  3UDI A;  3UE0 A;  4WL9 A;  3ULF A;  1XJ4 A;  3LIC A;  1LLB A;  5E5A D;  3AZG B;  1ID3 B;  3HJI A;  2P08 A;  3MVD D;  5J4E A;  4HES A;  4GHI B;  5DTS A;  5CPK B;  3KXB B;  1XXM A;  1K4F A;  1M1A C;  4XXR A;  4X68 A;  1KX4 C;  3MZD A;  2ZC7 A;  3TJZ C;  1MPL A;  1YLZ A;  3UE3 A;  4ESP A;  3MNN C;  4MB5 A;  3CMZ A;  4BLM A;  4X53 A;  1MZU A;  2WAF A;  4HOI A;  3L28 A;  3P98 A;  5TJJ A;  2OWH A;  5B31 A;  5JA4 A;  1Y4O A;  1H8Y A;  5AV8 B;  3AZE C;  3NCK A;  5FAO A;  1QME A;  4F3L A;  1T19 A;  4X69 A;  3X1V C;  4H9R B;  3V3R A;  1DP8 A;  1LSW A;  1W63 M;  4BBV A;  2ARO B;  1DRM A;  4NZ4 A;  1KU5 A;  2K31 A;  2WAD A;  5DF7 A;  3W99 B;  2I72 A;  3NIA A;  2FFF B;  5E2G A;  4E3M A;  3B0B A;  4DQY B;  1YM1 A;  1PZR A;  5EOE A;  4EES A;  2F8N D;  1OTA A;  4ETX A;  4XUJ A;  4KHA B;  1A0K A;  3OPH A;  5FQI A;  4JXG A;  4ZUX D;  1YLY A;  1ZHH B;  4KZ5 A;  1M1A A;  4G3K A;  1SCW A;  1P3F C;  2XGN A;  3QNC A;  4JGR A;  1KX4 A;  2CV5 C;  1U35 B;  2ZY4 A;  3PAE A;  3LFV A;  4OOL A;  5GXQ C;  3MNN A;  3GSG A;  5TBM A;  5FQQ A;  4NE3 A;  4IBD A;  2BLS A;  2ZM0 A;  2PT7 A;  1CK7 A;  1Q2Q A;  1JNU A;  4S2L A;  2RTS A;  4DE1 A;  3AZE A;  1PW8 A;  3X1V A;  2HDS A;  3X1S B;  1ESI A;  3UTB B;  1P3G B;  1W5D A;  4LPZ A;  4N9L A;  3WA9 A;  5AVF A;  2NQB D;  2WKE A;  4BWI A;  5CEB A;  3B6G A;  1OPX A;  3IWQ A;  1V9Y A;  1N1J A;  2PDR A;  3REH C;  5GHY A;  4J8X B;  4ZJ1 A;  1J7M A;  2EXA A;  4CLC E;  4DRA A;  1HQ3 D;  2V0U A;  1ZLA B;  3PBN A;  1UWN X;  3G4P A;  3ZG7 B;  4KZ7 A;  4D60 A;  2WZZ A;  2XSS A;  4GDN A;  2CV5 A;  2Q9M A;  5DNM D;  5GXQ A;  1TS8 A;  4NEE D;  1J3W A;  2O9C A;  2HDQ A;  5B2I B;  4J8V D;  5B0Y B;  1AOI D;  2L1M A;  1EAK A;  3LEZ A;  3IF5 A;  3GTC A;  3UE1 A;  3AV2 B;  1OT6 A;  2GX5 A;  3EOI A;  3VOL A;  1WA9 A;  5FUG B;  5DTT A;  3A3J A;  1GCE A;  3UT9 B;  1S6R A;  3PTE A;  4K91 A;  2M7V A;  3S7O A;  4GJ4 A;  1F5M A;  3BJN A;  1UR8 A;  3A0R A;  3REK C;  1KX3 A;  1K54 C;  1K57 C;  4WUJ A;  3UO9 A;  4E3O A;  1T1A A;  3X1T B;  4BBT A;  5HWW A;  4KEN B;  3KWQ D;  4RX2 A;  4UA9 A;  2W3E A;  5F82 A;  1FOF A;  1VEU B;  2HZ5 A;  1KVM A;  3C38 A;  3OZH A;  2JKG A;  3B0C T;  2WGW A;  3L26 A;  3AZI B;  4Y13 A;  3AZG C;  1ID3 C;  3WAA B;  2M1C A;  4H9P B;  4BD0 A;  4YS3 B;  4CJN A;  4B4X A;  5CPK C;  2ZM8 A;  1K6R A;  2QHK A;  3CHW P;  2F8N G;  1S1Y A;  3IXG A;  3M6B A;  1TEM A;  2WKR A;  4ARZ A;  3W97 D;  1CEG A;  1M6K A;  5I94 A;  2QMI A;  3WRZ A;  3G30 A;  1ONH A;  4OOM A;  1M40 A;  3E2L A;  2D01 A;  1H5X A;  5B1M C;  4LV0 A;  5AV8 C;  3REK A;  2YFW B;  3WD4 A;  1W1V A;  1K54 A;  2VA0 A;  3P01 A;  1L2S A;  1DJA A;  1NYM A;  1P3M D;  3W4Q A;  1M18 B;  2ARO C;  1G5U A;  4CSR B;  5AV6 C;  4CLC D;  3W99 C;  5BNV B;  3O62 D;  3W98 B;  3AZG A;  4MDZ A;  5A93 A;  3AZK D;  1ID3 A;  4O8G A;  5KDM A;  1DJB A;  4GHI A;  3QP8 A;  1S0W A;  5B1L D;  5CPK A;  2GZA A;  4WU9 B;  2ZJ9 A;  4S2O A;  4GD8 A;  2J8Y A;  3TE8 A;  1ULY A;  3MZE A;  1U35 C;  1E3U D;  2VGJ A;  3K3C A;  3AZM D;  1NXY A;  1CEF A;  5HX9 A;  3WKJ D;  1F2K A;  4YWZ A;  5B1M A;  5AV8 A;  4HME A;  3W8K A;  4D2O A;  4H9R A;  5AY8 D;  1CI8 A;  4BQM A;  3LID A;  4GNU A;  3X1S C;  2WKP A;  4HP9 A;  2PYO B;  2ARO A;  1P3G C;  1N4O A;  4EQI A;  5F68 A;  4Z2L A;  3BWL A;  5AV6 A;  2XH9 A;  5DNN B;  3A0S A;  3AZF B;  2V1A A;  3W99 A;  4HEF A;  4K08 A;  3MGR D;  5EOO A;  4J8X C;  3UY6 A;  3C1C C;  3H0R C;  3REI A;  3CUE C;  3QP1 A;  4GDB A;  1ZLA C;  3R45 A;  5B40 D;  1ES2 A;  4PM8 A;  1TZY C;  1E15 A;  4Q8I A;  1OTB A;  2VEA A;  4QHC A;  1S67 L;  4DJ2 A;  1U35 A;  3WS2 A;  2ZQD A;  1Y28 A;  1ACF A;  2W3G A;  5CPI B;  5B2I C;  1BLP A;  5EVE A;  5B0Y C;  3ZYT A;  2RVQ D;  1AXB A;  5FDH A;  1P3I D;  3LUQ A;  4E3I A;  1J9M A;  5IS1 A;  4E45 A;  3NEC A;  3AV2 C;  1FCM A;  4EW7 A;  4DDY A;  3E4O A;  4YM6 B;  3UT9 C;  1ZG6 A;  2YKH A;  1UR9 A;  2J3T C;  3D72 A;  4N92 A;  3T50 A;  4C6Y A;  4DRB A;  1Z09 A;  3C7V A;  4EUZ A;  2WK0 A;  3B0C W;  3LJA D;  4J8X A;  4JKT A;  3C1C A;  3X1T C;  4Y0U A;  3CUE A;  1OME A;  1ZLA A;  3UPP A;  3C5A A;  1FCO A;  1MWU A;  4FH2 A;  1TZY A;  4H6J A;  4QJG A;  3REJ B;  3F1N B;  5DVA A;  4LCM A;  4GLQ A;  1NJ4 A;  3WAA C;  4I5S A;  4NET A;  1VB6 A;  4KUD D;  5B2I A;  2X02 A;  4EU0 A;  4YS3 C;  1LL9 A;  1E6Z A;  4E04 A;  2ZOI A;  4KZA A;  5G18 A;  3VE3 A;  3AV2 A;  3MGQ B;  1P34 B;  1HTZ A;  2JHE A;  1XJ2 A;  5EVL A;  5FUG A;  3UPN A;  4EWF A;  3UT9 A;  1WYC A;  3GV9 A;  4XUJ D;  2VZW A;  4NXE A;  1KDW A;  2P7J A;  3A3I A;  3LGO A;  4R8P A;  2HP9 A;  2XFS A;  3BEC A;  3X1T A;  5TGF A;  3MNN D;  1M18 C;  3NDE A;  4NXB A;  5E43 A;  3V50 A;  3S7P A;  4IBB A;  1VEU A;  4XT2 A;  1ESU A;  3HLG A;  3W98 C;  3KX0 X;  3AZE D;  3HJK A;  3VH5 W;  3GR2 A;  1JTD A;  3VV4 A;  4EET B;  3WAA A;  4ETZ A;  4H9P A;  2JKT I;  3T12 B;  5AQ7 A;  4GB7 A;  3WA9 D;  4OQI A;  4WU9 C;  4PHT A;  3B6G D;  4EUV A;  4NG2 A;  1P3O B;  1TS6 A;  1GSW A;  4ZRR A;  3AFA A;  3A3E A;  2PD7 A;  4KGC D;  5F6A A;  1XJ3 A;  2HIO D;  2EX8 A;  2JKR M;  1JFI B;  1W7F A;  4M6B A;  2WAE A;  4A5R A;  1HLU P;  1YPR A;  2XRN A;  4I39 A;  2BTF P;  1TF1 A;  2D49 A;  1QO6 A;  4IED A;  2YFW A;  3AGE A;  2CV5 D;  2XD5 A;  3C30 A;  1F9I A;  1N9L A;  2V8F A;  4Q0I A;  1S32 B;  5GXQ D;  1M18 A;  2PYO C;  5HZH A;  3LIF A;  1T1B A;  1P9R A;  2OWJ A;  4OON A;  1CQA A;  5DNN C;  3HSH A;  3AZF C;  1ED7 A;  3AN2 A;  1OTE A;  2WGI A;  2XA7 M;  3W98 A;  4LV1 A;  2NZD B;  4Z2H A;  1FQG A;  3UTA A;  3HUO A;  5F1F A;  5AV5 B;  4R3A A;  3Q7V A;  3FKW A;  3B6F C;  3SH8 A;  4WU8 B;  4WU9 A;  2JKF A;  1UGU A;  5F83 A;  4CPK A;  3S7N A;  3U2A A;  1KX3 D;  1PWD A;  4B93 A;  4OOY A;  5B33 B;  4N1X A;  3LI9 A;  3CI6 A;  4I3J A;  4OPR A;  1CI9 A;  1B67 A;  4IUK A;  2ACG A;  2XEP A;  3DWZ A;  3EG5 B;  4FOF A;  4BL2 A;  3T1S A;  4JXW A;  5L09 A;  1NRF A;  4YM6 C;  1N9B A;  1YMX A;  5G4Y A;  2PYO A;  1KDS A;  5HD5 A;  5B24 A;  4H9S C;  3AZF A;  1BSG A;  3E98 A;  3VSL A;  2HDU A;  1EQZ B;  4LD9 B;  3IF6 C;  2B95 A;  4RQ9 A;  1PWG A;  4WNN B;  3C4P A;  3LY4 A;  3B6F A;  4GOG A;  4L9E A;  2Y2M A;  1Y54 A;  4PMA A;  1O6I A;  3REK D;  4DXB A;  3KO6 A;  1ES3 A;  1JVJ A;  4U3T A;  1MC0 A;  1MKM A;  5CGW A;  4MBH A;  3IP4 C;  3IXB A;  4FD8 A;  3IBR A;  3KYQ A;  4H9O A;  1BYW A;  5GT3 B;  3T1X A;  4HJ4 A;  3MGQ C;  3BLS A;  1P34 C;  3AZG D;  4YM6 A;  1JWP A;  3DWK A;  1ID3 D;  4JPM A;  5E2E A;  5MC7 A;  3LEL B;  5L07 A;  4EV4 A;  4H9S A;  4QLC B;  5CPK D;  4KQR A;  1H8P A;  5B0Z A;  1ALQ A;  4LV2 A;  3EQV A;  3IF6 A;  4HIA A;  2Y2I A;  3BFF A;  3IS2 B;  2DQN C;  4FCF A;  1C3B A;  5KZH A;  5M18 A;  3K2N A;  3LZ1 A;  1OTI A;  2EWW A;  4WLA A;  5K5B A;  1KX5 A;  2W8S A;  3F1N A;  3KS8 A;  1FIL A;  4E3K A;  3B0D B;  5B1M D;  1YLJ A;  2M7U A;  1KE0 A;  3HRE A;  4E3J A;  4X1M A;  2Y55 A;  1CK3 A;  4IBG A;  2BYM B;  1YU4 A;  2ZY3 A;  4WBG A;  1YMS A;  5AV6 D;  5HFO A;  2Y91 A;  2W1T A;  5EVI C;  1P3O C;  3AYW B;  4FSF A;  3MGQ A;  2PU2 A;  1P34 A;  1MY8 A;  4IVK A;  3MQQ A;  4S2J A;  4IJG A;  4G92 B;  4BBU A;  5KSC A;  3REI D;  1BLS A;  4RA7 A;  1OTD A;  3FKE A;  5CPJ B;  4HP4 A;  2BG1 A;  4X56 A;  3A1I A;  1S32 C;  1O7E A;  2NUT C;  3OC2 A;  4B4Z A;  2WKH A;  3SS5 A;  3UB9 A;  3S22 A;  2PR6 A;  1FR1 A;  1TAF B;  5TR7 A;  3VP3 A;  2NZD C;  2H10 A;  4LFU A;  3IHA A;  1FR6 A;  1E8B A;  5CP6 B;  4NZ1 A;  5AV5 C;  3VH5 A;  1ZTU A;  2V1B A;  4WU8 C;  4CAY B;  5EVI A;  4X23 B;  1P3O A;  5HDD A;  3FC7 A;  5L8M A;  4N9K A;  2DRW A;  4JGQ A;  5B33 C;  1WWS A;  4LRY C;  3EPK A;  1JFI A;  2J7V A;  5DFY A;  3C1C D;  3NHQ A;  4DN0 A;  3UDX A;  5AVC B;  4GKU A;  3FPW A;  4MCW A;  4KUK A;  1H0G A;  1GSX A;  1GXD A;  1F1E A;  1TZY D;  5HSQ A;  4WMC A;  3FG8 A;  3R7W B;  4UA7 A;  3VE4 A;  4JJN B;  1ERO A;  4IBX A;  2ZOH A;  2ZC3 B;  3NQU A;  4IJE A;  1SKO B;  4JF4 A;  3MBZ A;  1Q2P A;  3T4O A;  5B2I D;  2OLU A;  4H9Q B;  2Z2M B;  3VP4 A;  4GHA A;  3L7H A;  3H7W A;  3AV2 D;  1D7E A;  3GMW A;  3WD0 A;  1EQZ C;  4LD9 C;  3MS6 A;  4FTX A;  3AZN A;  4R3B A;  3NDG A;  5AV5 A;  3AZJ D;  2YFV A;  5F99 B;  1I2S A;  3A6N B;  3UT9 D;  4WU8 A;  1XX2 A;  5B2J D;  2QKP A;  4MBK A;  2J3T D;  5GLD A;  1S1Z A;  1P3K B;  4R8P D;  4GZB A;  4X55 A;  3W2Z A;  1L6J A;  4IBI A;  1KS0 A;  4ZJ2 A;  5B33 A;  2OV5 A;  4HGA B;  3PBQ A;  2J9P A;  3MGS B;  5JRG B;  2VK3 A;  1IYO A;  2PRF A;  5GT3 C;  1KGE A;  4Y3I A;  5CED A;  1MWT A;  1BUL A;  5CRF A;  5A90 A;  3WAA D;  1T3U A;  5BT1 C;  1MXO A;  4Z66 B;  3LEL C;  4QLC C;  4K0X A;  2VV8 A;  5AV9 B;  1E6P A;  2A2L A;  2BAS A;  2IA2 A;  1EQZ A;  1W2E A;  3AFA D;  4LD9 A;  1LSX A;  3SS3 A;  4E6W A;  5CHJ A;  2X01 A;  3B47 A;  3JPU A;  4KZ4 A;  4GH9 A;  3WTP E;  3RH8 B;  4XUZ A;  2LY8 A;  1EI5 A;  4UA6 A;  1K25 A;  1FCN A;  5GSU B;  4Q0J A;  5DTK A;  3BM6 A;  1WYB A;  4R6L A;  3B42 A;  1RP5 A;  5L2F A;  1M18 D;  2EX9 A;  3VP2 A;  3AN2 D;  3AYW C;  2F2A C;  5EM0 A;  1MWS A;  3W98 D;  3SS4 A;  2HP6 A;  2GNX A;  4WZ5 C;  1E25 A;  1K56 A;  3UTA D;  4ID4 A;  2XRO A;  4G92 C;  4XZQ C;  2RIQ A;  3LEL A;  5CTM A;  3SW1 A;  4QLC A;  5GHZ A;  4WU9 D;  1P3F A;  1I5Q A;  1ZG4 A;  5CPJ C;  4NXG A;  3ZQ5 A;  2JBF A;  5FA7 A;  3F1P B;  2QPN A;  2V2F F;  1N9N A;  1GA0 A;  5JYO A;  4NXF A;  2CC1 A;  3T4J A;  3W96 B;  3W4P A;  1BFM A;  1DY6 A;  1LI0 A;  1LL5 A;  3MQ0 A;  3OLO A;  1OGB A;  1JTG A;  3OCN A;  2O0Y A;  2V5O A;  5E5A B;  4M4X A;  5CP6 C;  1H3Q A;  1VET B;  5M19 A;  5BS7 C;  4OJL A;  3N6I A;  5B24 D;  3MVD B;  1YSQ A;  3A3F A;  4X23 C;  2WKI A;  5FQ9 A;  3EPL A;  3AYW A;  3REH A;  4WZ5 A;  4OP8 A;  3REL D;  4XZQ A;  4KQD A;  5AVC C;  5J8X A;  3B6F D;  3Q1F A;  3BY8 A;  1K0K A;  3WRT A;  4P85 A;  4OVD A;  4JF6 A;  2R9X A;  1L0F A;  4GS9 B;  4JJN C;  1YKD A;  4UQI M;  3H82 B;  2ZL1 A;  4KQQ A;  4OH0 A;  3HVF A;  4YFM A;  4KZ8 A;  4R38 A;  2HUE B;  4GW9 A;  3DTK A;  3KXB C;  3OPL A;  4MEZ A;  3BRM A;  4DMZ A;  2YKF A;  4UAA A;  1TAF A;  3DTI A;  3WTP D;  4J8U B;  4J8W B;  1W63 Q;  3QNB A;  3RXW A;  4YM6 D;  5CP6 A;  3EWK A;  5F99 C;  3Q7Z A;  3CIT A;  3A6N C;  5BS7 A;  1P3A D;  4OLD A;  2ZY2 A;  5A91 A;  3QHY A;  1IYQ A;  3OCL A;  4Z1W A;  3G34 A;  1P3K C;  1K57 A;  5B0Z D;  5U47 A;  5FAT A;  1HVB A;  4UPK A;  5GT0 B;  4UHU A;  3UMD A;  1H0I A;  4HGA C;  4JGO A;  2R9W A;  3MGS C;  5JRG C;  4PM5 A;  3LZ1 D;  3N8L A;  4BEN A;  3S4X A;  2P9V B;  3AV1 D;  3M2J A;  1KX5 D;  4E44 A;  3R7W A;  3MJQ A;  3M2K A;  4JJN A;  1XFN A;  4WV4 B;  2W0N A;  2PU4 A;  4Z66 C;  4H9Q A;  2K2N A;  1VM1 A;  3KXB A;  4R23 A;  3MKF A;  3UPO A;  3P5J B;  2ZM2 A;  2NQB B;  3VH5 T;  5AV9 C;  1IKG A;  3NY4 A;  2Y2P A;  4R1G A;  1NLZ A;  1P3P D;  2JKR I;  3HBR A;  5F99 A;  2VX8 A;  5GLC A;  4G3W A;  4NYU A;  3A6N A;  3MGP D;  1HQ3 B;  2B5R A;  1YT4 A;  5GSU C;  1PRQ A;  1P3K A;  5HAQ A;  1M19 B;  1L0D A;  3BW6 A;  3LR4 A;  1XP4 A;  3UTB C;  2WKQ A;  5TFQ A;  5HD3 A;  3LZ0 B;  3TW8 A;  4GN2 A;  3MGS A;  5JRG A;  3PR6 A;  3WS0 A;  4Z2G A;  4J8V B;  2IOU A;  1PWC A;  5FQK A;  1AOI B;  1I2W A;  5BNX B;  4QY6 A;  1SDE A;  3A1K A;  3VSK A;  2R78 A;  4KHA A;  4Z66 A;  4O01 A;  1Z2C B;  3WS1 A;  4E6X A;  2HJE A;  5EVI D;  4IBE A;  4QWO A;  5HDC A;  3V39 A;  2OOL A;  2C6W B;  2JN7 A;  2O99 A;  3S1Y A;  3ZCZ A;  4GHL A;  3ZG0 A;  4IBR A;  5BO0 B;  3W96 C;  3KWQ B;  1OJG A;  1ONG A;  4PKY G;  4DJ3 A;  1YSP A;  4RYE A;  4WMC D;  3LR0 A;  3X1S A;  3CPT B;  5E5A C;  3MXR A;  3UTB A;  1P3G A;  2JSS A;  3FDD A;  1LT0 A;  2E8I A;  3MVD C;  3CLO A;  2XA7 S;  2EFU A;  4QPR A;  3T4L A;  4Z2K A;  1TVF A;  3NOT C;  3LIE A;  5EUA A;  3VH6 W;  3AZN D;  1CF0 A;  4MMN A;  5AV5 D;  2PYR A;  3ZNY A;  4WF0 A;  3MMH A;  4WU8 D;  5B31 D;  1KVL A;  2KDK A;  4E3L A;  3AZI C;  4QY5 A;  3T4K A;  3F1P A;  3X1U B;  1XJ6 A;  1DJC A;  3T1Q B;  2B02 A;  5HL6 A;  2HUE C;  5B0Y A;  5B33 D;  2Y2N A;  1P3M B;  3C8C A;  1XA1 A;  3Q07 A;  5IU1 A;  2HP5 A;  2KLI A;  4J8U C;  1BLH A;  4J8W C;  4CLC B;  3FV7 A;  2IWD A;  2VQR A;  1ES5 A;  3T4S A;  5E5A A;  1IKI A;  4OJ6 A;  1XGI A;  2WGV A;  2XR0 A;  3TSG A;  3AZK B;  3AZH B;  4HJ3 A;  3MVD A;  2P74 A;  1M1A D;  2ZBB A;  1KX4 D;  2EWV A;  3ISG A;  4Z2M H;  1EQZ D;  4LD9 D;  5GT0 C;  4HH2 A;  2VGK A;  2IO5 B;  2W27 A;  2ZC6 B;  1YU2 A;  1IYP A;  2H0T A;  4GCZ A;  1L0E A;  3C2W A;  3AGF A;  3WKJ B;  3AZI A;  3IBJ A;  3X1V D;  2L0W A;  3H82 A;  2Z2L B;  1D06 A;  2FZ0 A;  4YS3 A;  2Y59 A;  4QNL A;  1W8Q A;  2OAP 1;  3TRC A;  5EV0 A;  3A0V A;  3BQA A;  5IT5 A;  1HD8 A;  3IXD A;  4KG6 A;  3D9Y A;  4EBP A;  4K0W A;  4J8U A;  1E88 A;  4J8W A;  1P9W A;  3EGX C;  4P87 A;  2A3U A;  4WZS B;  2BYK B;  3MGR B;  1K56 D;  1K4E A;  5BT1 D;  5FAP A;  5CX7 A;  4O0P A;  1HQ3 C;  3LEL D;  4QLC D;  4LGW A;  1P3F D;  5FAS A;  4KZ3 A;  4R4S A;  2Y79 A;  1M19 C;  5GT0 A;  1K38 A;  3WD1 A;  3LZ0 C;  4CSR A;  1GSV A;  4J8V C;  2XF3 A;  5BNV A;  5HDS A;  1AOI C;  1W1T A;  4EXO A;  1BT5 A;  4KZ6 A;  3S7Q A;  2G2U A;  2VGL M;  1L0G A;  3REH D;  5CPI C;  4N1H A;  1ZKJ A;  2O9B A;  4Y7P A;  3LJA B;  5B31 G;  1VQQ A;  4XZQ D;  4S2M A;  1HQ3 A;  1W8Y A;  3KWQ C;  4IBC A;  5EPH A;  1G6A A;  2JE5 A;  2ZQ8 A;  3D4F A;  2L5A A;  3VP1 A;  1M19 A;  2V1Z A;  5F5Y A;  1WE4 A;  3ZG8 B;  5JA4 B;  5HAI A;  4F3L B;  3LZ0 A;  4EEU A;  1QMF A;  3EPJ A;  3MSH A;  4PPR A;  1ODV A;  3NBL A;  4HHD A;  4S2N C;  5DNN A;  4KUD B;  4MBF A;  4QD4 A;  5DKK A;  4J8V A;  1KOU A;  4QB8 A;  3BEB A;  4WYY A;  5CGS A;  2V20 A;  5BNX A;  5FI6 A;  1IEM A;  1YLP A;  1TDL A;  2Q9N A;  4IBJ A;  4H8R A;  5DKL A;  4DE2 A;  3SZT A;  2FJ7 B;  5CP6 D;  1MBL A;  3MQO A;  1TS7 A;  4G3V A;  3REJ C;  2Y2Q A;  3KFU G;  4XUJ B;  3ZNT A;  4Z2I A;  5B32 B;  3WD2 A;  2PD8 A;  3X1U C;  5CPI A;  1GHI A;  1LHY A;  3QP5 A;  5CEC A;  1P3M C;  3MNN B;  5BO0 A;  5TBM B;  1NLY A;  3QP4 A;  1STZ A;  3MXS A;  3E0Y A;  5DJU A;  4X25 A;  4CLC C;  4QU3 A;  1CJF A;  1TD5 A;  3CPT A;  3M6H A;  3AZK C;  4DRT A;  5M1A A;  5HPI A;  4S2N A;  3AZH C;  3MXQ A;  1AIW A;  1ERM A;  5AVE A;  1KE3 A;  3KXB D;  3AZL B;  4X6T A;  3WA9 B;  4L0L A;  3KUY B;  3EEA A;  4LG2 A;  3B6G B;  3GQZ A;  2Y2O A;  3L2A A;  4OPY A;  4KGC B;  1BTL A;  5F99 D;  3HLF A;  2HIO B;  3VH6 A;  3A6N D;  4NZ5 A;  3REJ A;  3DTE A;  3WKJ C;  4ZBE A;  5AV8 D;  3KSG A;  4OUI A;  1GHM A;  4BL3 A;  2DF4 C;  3X1U A;  2ZMV A;  5F69 A;  1JWV A;  2ARO D;  1P3M A;  1SKF A;  2F8N K;  5FQM A;  3V5M A;  5JRG D;  3N3F A;  5GXQ B;  3O3V A;  1FSW A;  3W99 D;  2XK1 A;  4S2I A;  2HGV A;  2EXB A;  3M7P A;  4FH4 A;  2XD1 A;  3MGR C;  4LV3 A;  3AZH A;  4Z66 D;  2JKT M;  2B18 A;  2ZY5 A;  4DDS A;  3QP2 A;  4BJP A;  4NZ3 A;  1U35 D;  3ZG9 B;  3ZFZ A;  2J8P A;  3OOV A;  1P3L B;  2ZMA A;  3KSY A;  2Y2K A;  1BH8 B;  3E4Q A;  1KX3 B;  1LL8 A;  1MWR A;  3UN7 A;  5HAP A;  3PBR A;  4Z5T B;  3N7W A;  1YUE A;  3IT9 A;  2RVQ C;  1NYY A;  4Y17 A;  1IOU A;  2J80 A;  1BZA A;  1EWZ A;  4C75 A;  3X1S D;  3IWO A;  1ES4 A;  4M3K A;  3RTY A;  2WGW B;  3UTB D;  1P3G D;  4C3Q A;  3L9K A;  3K3D A;  4P6Z M;  4HQA A;  5EM1 A;  2EX2 A;  4J8X D;  1TS0 A;  2BYK A;  3LJA C;  1ZLA D;  4PM7 A;  3IWI A;  2V0W A;  3ZVT A;  1GHP A;  3O88 A;  3AGD A;  4DF6 A;  4AWL B;  4IBK A;  1BUE A;  4MLL A;  2J3W A;  1P3B B;  1S32 A;  1D1J A;  5FSR A;  3U4L P;  3LEQ A;  3IX8 A;  5B0Y D;  2Y4A A;  4KUD C;  1P97 A;  4I3A A;  1E6R A;  1LSV A;  1UWP X;  3VMA A;  3I7J A;  4ZJ3 A;  3HLW A;  5AVB B;  2NZD A;  4YIN A;  3UB8 A;  4OQG A;  1XKZ A;  4H9N B;  1IFQ A;  3GVB A;  4I38 A;  3EEH A;  4KZB A;  2FJ7 C;  3NUL A;  5AJG A;  3DAV A;  3DW0 A;  5KDM B;  4EO5 B;  4OJP A;  1ERQ A;  2CWE A;  4XUJ C;  2QZ6 A;  5B32 C;  2ZC5 B;  5CGX A;  1NZU A;  3X1T D;  3TU4 B;  3LJA A;  3MFX A;  4Z9Q A;  3NQJ B;  3KS4 A;  2ZD8 A;  2D02 A;  2PR5 A;  4FUW A;  3AZI D;  1YQS A;  4UQI S;  4DKI A;  5B1M B;  1PNE A;  5FEF A;  4NY2 A;  4HBT A;  4YS3 D;  5FQJ A;  3V9R B;  2QYB A;  4KUD A;  1NZO A;  2FH5 A;  3AZL C;  3EPH A;  2H5S A;  2DCF A;  2LB9 A;  2X71 A;  3WA9 C;  3NJA A;  2QWS A;  3KSH A;  5CXW A;  3NOP C;  5AV6 B;  4E3N A;  3KUY C;  1F66 B;  5E2H A;  3MFD A;  4J8U D;  3B6G C;  4J8W D;  2Y2L A;  3IHB A;  1GA9 A;  4MB3 A;  3L25 A;  4R4R A;  5CER A;  2FJ7 A;  2XDM A;  4WNN A;  4KGC C;  1IYS A;  2HIO C;  4WJ3 C;  4HMC A;  3BY9 A;  3REI B;  3B0D C;  3T1R A;  2GJ3 A;  3R45 B;  2G5I C;  1NWZ A;  5B32 A;  2NUP C;  2EA9 A;  3IXH A;  3E4P A;  5GT0 D;  3VP0 A;  3P09 A;  1PW1 A;  1XGJ A;  2A24 B;  4OQH A;  1DP9 A;  5GT3 A;  2INW A;  1SDN A;  3MKE A;  3BYD A;  4HNB A;  2V9A A;  3HLC A;  3C1B B;  4II7 A;  3LR5 A;  3VFH A;  5FI2 A;  3AZL A;  2IWB A;  2W3F A;  4LCL A;  3KUY A;  3LO7 A;  4KG5 A;  3IS2 A;  1P3L C;  4YNR A;  2QJ7 A;  4KGC A;  3OPP A;  2HV1 A;  1KX3 C;  3BFG A;  3BQ8 A;  4LLO B;  2HIO A;  4Z5T C;  3C1C B;  3BFD A;  3Q82 A;  3L27 A;  4OP5 A;  2K7S A;  3TOI A;  4EBN A;  1TZY B;  4H6J B;  3T4T A;  1M19 D;  1O07 A;  1P0Z A;  2BYM A;  3HLB A;  4NE5 A;  2PYO D;  3LZ0 D;  2W1R A;  3WWX A;  5DNN D;  2J9O A;  2P04 A;  3LCE A;  3AZF D;  1E4D A;  1Q9C A;  2F8N H;  5F1G A;  3T4Q A;  2PAV P;  2HF6 A;  1PYY A;  3SH9 A;  3ICY A;  3WS5 A;  1OJ5 A;  4NFT A;  4RX3 A;  3AZJ B;  2VLG A;  1G28 A;  2AVX A;  5CPJ A;  1PI4 A;  1L3L A;  4P0M A;  5B2J B;  4AWL C;  3VH6 T;  3DBA A;  4BMW A;  4EBL A;  1P3B C;  1XFQ A;  1P3L A;  5CPI D;  4ZTK A;  5HWV A;  1BH8 A;  4R8P B;  1H3O B;  5A8B A;  3JYI A;  4OJ5 A;  4Z5T A;  4ZAM A;  3H0L C;  4XUX A;  3UDF A;  2OAQ 1;  1RGY A;  5AVB C;  4XT2 B;  4OLG A;  3UB6 A;  4CAY A;  4EO5 C;  2F8N B;  3R4K A;  4X23 A;  1GPF A;  4KQO A;  4ZUX B;  5G49 B;  2RCX A;  4PM9 A;  2ZQA A;  4JBF A;  1OT9 A;  3AFA B;  3TU4 C;  5L10 A;  5AVC A;  2Z6D A;  2ZC4 B;  5CHL B;  2VKS A;  5GHX A;  3REJ D;  4Z2J A;  1P3B A;  4IVI A;  4KG2 A;  4MNR A;  3X1U D;  1SKO A;  3NI9 A;  5HL1 A;  3D3O A;  2FN2 A;  3B3X A;  4MN5 A;  5EFW A;  1PIO A;  5DFX A;  3HUM A;  4OKP A;  1JWZ A;  2V8C A;  2G5H C;  4BD1 A;  1RCJ A;  5AVB A;  3MGQ D;  1F66 C;  1P34 D;  3AL0 C;  4H9N A;  3AN2 B;  3HCY A;  3TG9 A;  4HI4 A;  3B33 A;  1T1C A;  3ZGA B;  1R4V A;  2PBD P;  3FWL A;  1NRJ A;  3AZH D;  3UTA B;  4PAU A;  3REI C;  3Q7V B;  4MB4 A;  1U60 A;  4R0Q A;  5DJT A;  1YLW A;  5KSH A;  1PFL A;  3PHY A;  3V3S A;  3LYX A;  3TU4 A;  3CWF A;  5DNM B;  3LY3 A;  3NQJ A;  4R70 A;  2WZX A;  2G2W A;  5CHM A;  3IX3 A;  4HH3 A;  3EQU A;  5J7E A;  4G91 B;  3HL9 A;  5KMW A;  3F1O B;  2MJ6 A;  2ZLY A;  1WWI A;  1RGZ A;  3C1B C;  4NK3 A;  3V9R A;  3HLE A;  1H0M A;  5AV9 A;  4R3J A;  3C7U A;  1P3O D;  5BPV A;  4ZBJ B;  5B24 B;  1F66 A;  5IHV A;  4LRZ E;  3WD3 A;  1ZC2 A;  5JYP A;  4GD6 A;  3REL B;  5J3W A;  5GSU A;  4Y2F A;  1AWI A;  3B6F B;  5G4Z A;  1S4R A;  4WZ4 A;  3SOI A;  5CHU A;  1S32 D;  4F94 A;  4DXC A;  5C3I B;  4P6B A;  5FAQ A;  3VOY A;  3BFE A;  5I5L A;  4IJF A;  1DP6 A;  2A24 A;  4JXV A;  1CXW A;  2VV7 A;  5DF8 A;  1N9O A;  2ZQC A;  4ME4 A;  3CG5 A;  2NZD D;  3HON A;  4H9O B;  3WTP B;  3C1B A;  2XLN A;  4Y0O A;  3W97 B;  3AZJ C;  3UME A;  2VGL S;  4JF5 A;  3LIB A;  3OBF A;  1P3A B;  1SHV A;  5B2J C;  4HY8 A;  1K55 C;  2Y8H A;  3WX7 A;  5HW3 A;  3LI8 A;  5B0Z B;  5GLB A;  4IHQ A;  4R8P C;  1G6O A;  3CZD A;  3IF6 B;  2IWC A;  4MN7 A;  4OPZ A;  3W96 A;  2CMN A;  3FPV A;  5HPF A;  1XPB A;  3WS4 A;  3LZ1 B;  3JVU A;  2L4R A;  3AV1 B;  3O62 B;  3OPR A;  4Y15 A;  1W79 A;  1KX5 B;  4S2K A;  2KOI A;  2G7U A;  1VET A;  3MR0 A;  3V67 A;  2JC7 A;  2HJ9 C;  5B1L B;  1KE4 A;  4I3I A;  4ZUX C;  4UUZ B;  2DNS A;  2ZQ7 A;  3PYP A;  3ITA A;  2W1T B;  5A92 A;  2XQZ A;  3AZM B;  1Z6F A;  3AFA C;  1E6N A;  4L9G A;  3H0M C;  2FJ7 D;  1P3P B;  3AZJ A;  2OSU A;  3O5Y A;  4LEN A;  3RJU A;  2EX6 A;  3NC8 A;  2Y2H A;  3MGP B;  1H8M A;  3HLD A;  5B2J A;  4GS9 A;  1K55 A;  4MN6 A;  5B32 D;  4NYY A;  3G2Y A;  1KGF A;  2DMW A;  5AY8 B;  2HPB A;  4WEK A;  2A49 A;  3LIA A;  1H3O A;  4S2P A;  4RVA A;  2NQB C;  2Y2J A;  1SZV A;  1A7W A;  5GT3 D;  5FL3 A;  4IUH A;  1NY0 A;  2WYX A;  5AQB A;  3AN2 C;  1OGG A;  4U0T A;  3O86 A;  1BLC A;  3N8S A;  1HZO A;  4HBU A;  3UTA C;  2F8N A;  3FKV A;  3G2Z A;  3AZL D;  5B40 B;  2GDN A;  4ZUX A;  1W1P A;  2HDR A;  5G49 A;  2PBY A;  3IH8 A;  1BH9 B;  3PXP A;  2W3D A;  3KUY D;  3UB7 A; 
#chains in the Genus database with same CATH homology
 5EVI B;  5DNM C;  3ZDJ A;  1YU3 A;  4Z2M G;  2UWX A;  2P9V A;  3GRJ A;  1TDG A;  3ZHH A;  1P3I B;  4WEJ A;  5E2F A;  4G91 C;  1H8Z A;  3FZC A;  1PI5 A;  3VFF A;  3NQU B;  4IBF A;  2NQB A;  2H0Y A;  3AYW D;  4ZBJ C;  5B24 C;  1YU0 A;  1XA7 A;  1G68 A;  2RL3 A;  2OLV A;  3G35 A;  3AZN B;  4JXS A;  5D3O A;  3REL C;  2YFV B;  5BOH A;  1LI9 A;  5CPJ D;  3IQA A;  5B31 B;  2C5W B;  3W4O A;  1P3L D;  5C3I C;  5DNM A;  4DE0 A;  3VOZ A;  4JLF A;  4Z5T D;  1AOI A;  1KGG A;  4B88 A;  2WUQ A;  3WTP C;  2EFX A;  3W97 C;  4PM6 A;  4OPQ A;  2XFT A;  5CTN A;  4X23 D;  1P3A C;  3O87 A;  1M1A B;  1KX4 B;  5B0Z C;  3PBO A;  4Y0T A;  5AVC D;  3F6T A;  3KWQ A;  3REL A;  5B32 G;  4OQ0 A;  3LZ1 C;  3AV1 C;  3O62 C;  4JJN D;  1IEL A;  3AZE B;  1KX5 C;  1P3B D;  3X1V B;  5DF9 A;  3PBT A;  1B6W A;  1YU1 A;  3BFC A;  5B1L C;  2ZQ9 A;  3HUN A;  3L29 A;  2Y2G A;  5EE8 A;  5AVB D;  1PZP A;  1N1J B;  3WTP A;  1PZO A;  3PAG A;  5EEC A;  3AZM C;  2IO5 C;  1P3P C;  4WEL A;  3W97 A;  5FI7 A;  3SH7 A;  5GLA A;  5AQA A;  1P3A A;  3MGP C;  3ITB A;  1P3K D;  1P3F B;  5AY8 C;  2CV5 B;  1HTA A;  4OJO A;  3MGS D;  3TU4 D;  3MZF A;  3ZG5 A;  1MKI A;  5AQ9 A;  3AV1 A;  3O62 A;  5HAR A;  1K6S A;  3AZK A;  3UNW A;  3RXX A;  3BLM A;  4KZ9 A;  5B1L A;  5B40 C;  4UUZ A;  5AV9 D;  3A3D A;  4NE6 A;  5GL9 A;  3Q81 A;  1F66 D;  1E3U A;  3AZM A;  4WM9 A;  3REH B;  1YLT A;  1P3P A;  4DE3 A;  3WKJ A;  4O7D A;  1FSY A;  4XZQ B;  5GSU D;  1P3I C;  3G32 A;  3MGP A;  3E2K A;  3FYZ A;  3CJM A;  5AY8 A;  3DTM A;  3G31 A;  4U0X A;  2ZM5 A;  4ZDX A;  3PBS A;  3C1B D;  3MGR A;  3AZN C;  3IH9 A;  5B40 A;  1BH9 A;  2JCH A;  3N4I A;  5B31 C;  3N8R A;  3REK B;  3ZVW A;  3W96 D;  2FFY A;  1P3I A;  3C4O A;  3UDI A;  3UE0 A;  1LLB A;  5E5A D;  3AZG B;  1ID3 B;  3MVD D;  4HES A;  5DTS A;  5CPK B;  3KXB B;  1XXM A;  1K4F A;  1M1A C;  4XXR A;  4X68 A;  1KX4 C;  3MZD A;  2ZC7 A;  1MPL A;  1YLZ A;  3UE3 A;  3MNN C;  3CMZ A;  4BLM A;  4X53 A;  2WAF A;  3L28 A;  3P98 A;  5B31 A;  5JA4 A;  1H8Y A;  5AV8 B;  3AZE C;  3NCK A;  5FAO A;  1QME A;  4X69 A;  3X1V C;  4H9R B;  3V3R A;  2ARO B;  4NZ4 A;  1KU5 A;  2WAD A;  5DF7 A;  3W99 B;  2I72 A;  3NIA A;  2FFF B;  5E2G A;  4E3M A;  3B0B A;  4DQY B;  1YM1 A;  1PZR A;  5EOE A;  2F8N D;  4XUJ A;  4KHA B;  3OPH A;  5FQI A;  4JXG A;  4ZUX D;  1YLY A;  4KZ5 A;  1M1A A;  1SCW A;  1P3F C;  2XGN A;  3QNC A;  1KX4 A;  2CV5 C;  1U35 B;  2ZY4 A;  3PAE A;  4OOL A;  5GXQ C;  3MNN A;  3GSG A;  5FQQ A;  4NE3 A;  4IBD A;  2BLS A;  2ZM0 A;  1Q2Q A;  4S2L A;  4DE1 A;  3AZE A;  1PW8 A;  3X1V A;  2HDS A;  3X1S B;  1ESI A;  3UTB B;  1P3G B;  1W5D A;  4N9L A;  3WA9 A;  2NQB D;  2WKE A;  5CEB A;  3B6G A;  3IWQ A;  1N1J A;  3REH C;  5GHY A;  4J8X B;  4ZJ1 A;  2EXA A;  4DRA A;  1HQ3 D;  1ZLA B;  3PBN A;  3G4P A;  3ZG7 B;  4KZ7 A;  2WZZ A;  4GDN A;  2CV5 A;  2Q9M A;  5DNM D;  5GXQ A;  2HDQ A;  5B2I B;  4J8V D;  5B0Y B;  1AOI D;  3LEZ A;  3IF5 A;  3GTC A;  3UE1 A;  3AV2 B;  5FUG B;  5DTT A;  3A3J A;  1GCE A;  3UT9 B;  1S6R A;  3PTE A;  4K91 A;  3REK C;  1KX3 A;  1K54 C;  1K57 C;  3UO9 A;  4E3O A;  3X1T B;  4KEN B;  3KWQ D;  4RX2 A;  4UA9 A;  5F82 A;  1FOF A;  1KVM A;  3OZH A;  3B0C T;  2WGW A;  3L26 A;  3AZI B;  3AZG C;  1ID3 C;  3WAA B;  4H9P B;  4BD0 A;  4YS3 B;  4CJN A;  4B4X A;  5CPK C;  2ZM8 A;  1K6R A;  2F8N G;  3IXG A;  3M6B A;  1TEM A;  3W97 D;  1CEG A;  1M6K A;  5I94 A;  2QMI A;  3WRZ A;  3G30 A;  1ONH A;  4OOM A;  1M40 A;  3E2L A;  1H5X A;  4LV0 A;  5B1M C;  5AV8 C;  3REK A;  2YFW B;  1K54 A;  1L2S A;  1DJA A;  1NYM A;  1P3M D;  3W4Q A;  1M18 B;  2ARO C;  4CSR B;  5AV6 C;  3W99 C;  5BNV B;  3O62 D;  3W98 B;  3AZG A;  5A93 A;  3AZK D;  1ID3 A;  5KDM A;  1DJB A;  1S0W A;  5B1L D;  5CPK A;  4WU9 B;  2ZJ9 A;  4S2O A;  4GD8 A;  2J8Y A;  1ULY A;  3MZE A;  1U35 C;  1E3U D;  2VGJ A;  3AZM D;  1NXY A;  1CEF A;  5HX9 A;  3WKJ D;  5B1M A;  5AV8 A;  3W8K A;  4D2O A;  4H9R A;  5AY8 D;  1CI8 A;  4BQM A;  4GNU A;  3X1S C;  2PYO B;  2ARO A;  1P3G C;  1N4O A;  4EQI A;  5AV6 A;  2XH9 A;  5DNN B;  3AZF B;  3W99 A;  4HEF A;  3MGR D;  5EOO A;  4J8X C;  3UY6 A;  3C1C C;  3H0R C;  3REI A;  4GDB A;  1ZLA C;  3R45 A;  5B40 D;  1ES2 A;  4PM8 A;  1TZY C;  4Q8I A;  4QHC A;  1U35 A;  3WS2 A;  2ZQD A;  5CPI B;  5B2I C;  1BLP A;  5B0Y C;  2RVQ D;  1AXB A;  5FDH A;  1P3I D;  4E3I A;  1J9M A;  4E45 A;  3AV2 C;  1FCM A;  4DDY A;  4YM6 B;  3UT9 C;  1ZG6 A;  4N92 A;  4C6Y A;  4DRB A;  3C7V A;  4EUZ A;  2WK0 A;  3B0C W;  3LJA D;  4J8X A;  4JKT A;  3C1C A;  3X1T C;  4Y0U A;  1OME A;  1ZLA A;  3UPP A;  3C5A A;  1FCO A;  1MWU A;  4FH2 A;  1TZY A;  4QJG A;  3REJ B;  5DVA A;  4LCM A;  1NJ4 A;  3WAA C;  4NET A;  4KUD D;  5B2I A;  2X02 A;  4YS3 C;  1LL9 A;  4KZA A;  5G18 A;  3AV2 A;  3MGQ B;  1P34 B;  1HTZ A;  5EVL A;  5FUG A;  3UPN A;  4EWF A;  3UT9 A;  1WYC A;  3GV9 A;  4XUJ D;  1KDW A;  3A3I A;  4R8P A;  2HP9 A;  2XFS A;  3BEC A;  3X1T A;  5TGF A;  3MNN D;  1M18 C;  3NDE A;  5E43 A;  3V50 A;  4IBB A;  1ESU A;  3HLG A;  3W98 C;  3AZE D;  3VH5 W;  3GR2 A;  1JTD A;  3WAA A;  4H9P A;  5AQ7 A;  4GB7 A;  3WA9 D;  4OQI A;  4WU9 C;  3B6G D;  1P3O B;  3AFA A;  3A3E A;  4KGC D;  2HIO D;  2EX8 A;  1JFI B;  1W7F A;  4M6B A;  2WAE A;  4A5R A;  4IED A;  2YFW A;  3AGE A;  2CV5 D;  2XD5 A;  1S32 B;  5GXQ D;  1M18 A;  2PYO C;  4OON A;  5DNN C;  3HSH A;  3AZF C;  3AN2 A;  2WGI A;  3W98 A;  4LV1 A;  2NZD B;  1FQG A;  3UTA A;  3HUO A;  5F1F A;  5AV5 B;  3Q7V A;  3FKW A;  3B6F C;  3SH8 A;  4WU8 B;  4WU9 A;  5F83 A;  4CPK A;  1KX3 D;  1PWD A;  4OOY A;  5B33 B;  4N1X A;  4OPR A;  1CI9 A;  1B67 A;  2XEP A;  3DWZ A;  3EG5 B;  4BL2 A;  4JXW A;  1NRF A;  4YM6 C;  1N9B A;  1YMX A;  2PYO A;  1KDS A;  5B24 A;  4H9S C;  3AZF A;  1BSG A;  3VSL A;  2HDU A;  1EQZ B;  4LD9 B;  3IF6 C;  1PWG A;  4WNN B;  3C4P A;  3LY4 A;  3B6F A;  4GOG A;  2Y2M A;  1Y54 A;  4PMA A;  3REK D;  4DXB A;  1ES3 A;  1JVJ A;  4U3T A;  5CGW A;  4MBH A;  3IP4 C;  3IXB A;  4FD8 A;  4H9O A;  5GT3 B;  3MGQ C;  3BLS A;  1P34 C;  3AZG D;  4YM6 A;  1JWP A;  3DWK A;  1ID3 D;  4JPM A;  5E2E A;  3LEL B;  4EV4 A;  4H9S A;  4QLC B;  5CPK D;  4KQR A;  5B0Z A;  1ALQ A;  4LV2 A;  3EQV A;  3IF6 A;  2Y2I A;  3BFF A;  2DQN C;  4FCF A;  1C3B A;  5KZH A;  5M18 A;  3LZ1 A;  1KX5 A;  2W8S A;  3KS8 A;  4E3K A;  3B0D B;  5B1M D;  1YLJ A;  1KE0 A;  3HRE A;  4E3J A;  2Y55 A;  1CK3 A;  4IBG A;  2BYM B;  1YU4 A;  2ZY3 A;  4WBG A;  1YMS A;  5AV6 D;  5HFO A;  2Y91 A;  5EVI C;  1P3O C;  3AYW B;  4FSF A;  3MGQ A;  2PU2 A;  1P34 A;  1MY8 A;  4IVK A;  4S2J A;  4G92 B;  5KSC A;  3REI D;  1BLS A;  4RA7 A;  3FKE A;  5CPJ B;  2BG1 A;  4X56 A;  3A1I A;  1S32 C;  1O7E A;  3OC2 A;  4B4Z A;  2WKH A;  3SS5 A;  3S22 A;  1FR1 A;  1TAF B;  5TR7 A;  3VP3 A;  2NZD C;  2H10 A;  3IHA A;  1FR6 A;  5CP6 B;  4NZ1 A;  5AV5 C;  3VH5 A;  4WU8 C;  4CAY B;  5EVI A;  4X23 B;  1P3O A;  4N9K A;  2DRW A;  5B33 C;  1WWS A;  3EPK A;  1JFI A;  2J7V A;  3C1C D;  3UDX A;  5AVC B;  4GKU A;  1F1E A;  1TZY D;  4WMC A;  4UA7 A;  4JJN B;  1ERO A;  4IBX A;  2ZC3 B;  3NQU A;  4IJE A;  4JF4 A;  3MBZ A;  1Q2P A;  5B2I D;  2OLU A;  4H9Q B;  2Z2M B;  3VP4 A;  4GHA A;  3AV2 D;  3GMW A;  1EQZ C;  4LD9 C;  3AZN A;  4R3B A;  3NDG A;  5AV5 A;  3AZJ D;  2YFV A;  5F99 B;  1I2S A;  3A6N B;  3UT9 D;  4WU8 A;  1XX2 A;  5B2J D;  4MBK A;  5GLD A;  1P3K B;  4R8P D;  4GZB A;  4X55 A;  4IBI A;  4ZJ2 A;  5B33 A;  2OV5 A;  4HGA B;  3PBQ A;  2J9P A;  3MGS B;  5JRG B;  1IYO A;  5GT3 C;  1KGE A;  5CED A;  1BUL A;  1MWT A;  5CRF A;  5A90 A;  3WAA D;  1T3U A;  5BT1 C;  1MXO A;  4Z66 B;  3LEL C;  4QLC C;  4K0X A;  5AV9 B;  1EQZ A;  1W2E A;  3AFA D;  4LD9 A;  3SS3 A;  4E6W A;  5CHJ A;  2X01 A;  4KZ4 A;  4GH9 A;  3WTP E;  4XUZ A;  2LY8 A;  1EI5 A;  4UA6 A;  1K25 A;  1FCN A;  5GSU B;  5DTK A;  3BM6 A;  1WYB A;  1RP5 A;  5L2F A;  1M18 D;  2EX9 A;  3VP2 A;  3AN2 D;  3AYW C;  2F2A C;  1MWS A;  3W98 D;  3SS4 A;  2HP6 A;  4WZ5 C;  1E25 A;  1K56 A;  3UTA D;  4ID4 A;  4G92 C;  4XZQ C;  2RIQ A;  3LEL A;  5CTM A;  4QLC A;  5GHZ A;  4WU9 D;  1P3F A;  1I5Q A;  1ZG4 A;  5CPJ C;  2JBF A;  5FA7 A;  2QPN A;  2V2F F;  1GA0 A;  5JYO A;  2CC1 A;  3W96 B;  3W4P A;  1BFM A;  1DY6 A;  1LI0 A;  1LL5 A;  1JTG A;  3OCN A;  5E5A B;  5CP6 C;  5M19 A;  5BS7 C;  4OJL A;  3N6I A;  5B24 D;  3MVD B;  3A3F A;  4X23 C;  2WKI A;  5FQ9 A;  3EPL A;  3AYW A;  3REH A;  4WZ5 A;  4OP8 A;  3REL D;  4XZQ A;  5AVC C;  5J8X A;  3B6F D;  3Q1F A;  3WRT A;  4P85 A;  4OVD A;  4JF6 A;  2R9X A;  1L0F A;  4JJN C;  4KQQ A;  4OH0 A;  3HVF A;  4YFM A;  4KZ8 A;  2HUE B;  3KXB C;  3OPL A;  4MEZ A;  3BRM A;  4UAA A;  1TAF A;  3WTP D;  4J8U B;  4J8W B;  3QNB A;  3RXW A;  4YM6 D;  5CP6 A;  5F99 C;  3Q7Z A;  3A6N C;  5BS7 A;  1P3A D;  4OLD A;  2ZY2 A;  5A91 A;  3QHY A;  1IYQ A;  3OCL A;  3G34 A;  1P3K C;  1K57 A;  5B0Z D;  5U47 A;  5FAT A;  1HVB A;  4UPK A;  5GT0 B;  4UHU A;  4HGA C;  2R9W A;  3MGS C;  5JRG C;  4PM5 A;  3LZ1 D;  3N8L A;  4BEN A;  3S4X A;  2P9V B;  3AV1 D;  3M2J A;  1KX5 D;  4E44 A;  3M2K A;  4JJN A;  4WV4 B;  2PU4 A;  4Z66 C;  4H9Q A;  1VM1 A;  3KXB A;  4R23 A;  3MKF A;  3UPO A;  3P5J B;  2ZM2 A;  2NQB B;  3VH5 T;  5AV9 C;  1IKG A;  3NY4 A;  2Y2P A;  4R1G A;  1P3P D;  3HBR A;  5F99 A;  5GLC A;  4NYU A;  3A6N A;  3MGP D;  1HQ3 B;  2B5R A;  1YT4 A;  5GSU C;  1P3K A;  5HAQ A;  1M19 B;  1L0D A;  1XP4 A;  3UTB C;  5TFQ A;  3LZ0 B;  4GN2 A;  3MGS A;  5JRG A;  3WS0 A;  4J8V B;  2IOU A;  1PWC A;  5FQK A;  1AOI B;  1I2W A;  5BNX B;  4QY6 A;  1SDE A;  3A1K A;  3VSK A;  4KHA A;  4Z66 A;  1Z2C B;  3WS1 A;  4E6X A;  5EVI D;  4IBE A;  3V39 A;  2C6W B;  3S1Y A;  3ZCZ A;  4GHL A;  3ZG0 A;  4IBR A;  5BO0 B;  3W96 C;  3KWQ B;  1ONG A;  4WMC D;  4RYE A;  3X1S A;  5E5A C;  3MXR A;  3UTB A;  1P3G A;  2JSS A;  3FDD A;  2E8I A;  3MVD C;  2EFU A;  1TVF A;  5EUA A;  3VH6 W;  3AZN D;  5AV5 D;  3ZNY A;  4WU8 D;  5B31 D;  1KVL A;  4E3L A;  3AZI C;  4QY5 A;  3X1U B;  1DJC A;  2HUE C;  5B0Y A;  5B33 D;  2Y2N A;  1P3M B;  1XA1 A;  3Q07 A;  2HP5 A;  4J8U C;  1BLH A;  4J8W C;  3FV7 A;  2IWD A;  2VQR A;  1ES5 A;  5E5A A;  1IKI A;  4OJ6 A;  1XGI A;  2WGV A;  2XR0 A;  3TSG A;  3AZK B;  3AZH B;  3MVD A;  2P74 A;  1M1A D;  1KX4 D;  3ISG A;  4Z2M H;  1EQZ D;  4LD9 D;  5GT0 C;  2VGK A;  2IO5 B;  2ZC6 B;  1YU2 A;  1IYP A;  2H0T A;  1L0E A;  3AGF A;  3WKJ B;  3AZI A;  3X1V D;  2Z2L B;  2Y59 A;  4YS3 A;  4QNL A;  1W8Q A;  1HD8 A;  3IXD A;  4KG6 A;  4EBP A;  4K0W A;  4J8U A;  4J8W A;  4P87 A;  2A3U A;  4WZS B;  2BYK B;  3MGR B;  1K56 D;  1K4E A;  5BT1 D;  5FAP A;  1HQ3 C;  3LEL D;  4QLC D;  1P3F D;  5FAS A;  4KZ3 A;  4R4S A;  1M19 C;  5GT0 A;  1K38 A;  3LZ0 C;  4CSR A;  4J8V C;  2XF3 A;  5BNV A;  1AOI C;  1BT5 A;  4KZ6 A;  2G2U A;  1L0G A;  3REH D;  5CPI C;  4N1H A;  1ZKJ A;  4Y7P A;  3LJA B;  5B31 G;  1VQQ A;  4XZQ D;  4S2M A;  1HQ3 A;  1W8Y A;  3KWQ C;  4IBC A;  5EPH A;  1G6A A;  2JE5 A;  2ZQ8 A;  3D4F A;  2L5A A;  3VP1 A;  1M19 A;  2V1Z A;  1WE4 A;  3ZG8 B;  5JA4 B;  5HAI A;  3LZ0 A;  1QMF A;  3EPJ A;  4PPR A;  3NBL A;  4S2N C;  5DNN A;  4KUD B;  4MBF A;  4QD4 A;  4J8V A;  4QB8 A;  3BEB A;  4WYY A;  5CGS A;  2V20 A;  5BNX A;  5FI6 A;  1IEM A;  1YLP A;  1TDL A;  2Q9N A;  4IBJ A;  4H8R A;  4DE2 A;  2FJ7 B;  5CP6 D;  1MBL A;  3REJ C;  2Y2Q A;  3KFU G;  4XUJ B;  3ZNT A;  5B32 B;  3X1U C;  5CPI A;  1GHI A;  1LHY A;  5CEC A;  1P3M C;  3MNN B;  5BO0 A;  3MXS A;  4QU3 A;  3M6H A;  3AZK C;  4DRT A;  5M1A A;  4S2N A;  3AZH C;  1ERM A;  1KE3 A;  3KXB D;  3AZL B;  4X6T A;  3WA9 B;  4L0L A;  3KUY B;  4LG2 A;  3B6G B;  3GQZ A;  2Y2O A;  3L2A A;  4OPY A;  4KGC B;  1BTL A;  5F99 D;  3HLF A;  2HIO B;  3VH6 A;  3A6N D;  4NZ5 A;  3REJ A;  4ZBE A;  3WKJ C;  5AV8 D;  4OUI A;  1GHM A;  4BL3 A;  2DF4 C;  3X1U A;  1JWV A;  2ARO D;  1P3M A;  1SKF A;  2F8N K;  5FQM A;  3V5M A;  5JRG D;  3N3F A;  5GXQ B;  3O3V A;  1FSW A;  3W99 D;  2XK1 A;  4S2I A;  2EXB A;  4FH4 A;  2XD1 A;  3MGR C;  4LV3 A;  3AZH A;  4Z66 D;  2ZY5 A;  4DDS A;  4BJP A;  4NZ3 A;  1U35 D;  3ZG9 B;  3ZFZ A;  2J8P A;  1P3L B;  2ZMA A;  3KSY A;  2Y2K A;  1BH8 B;  1KX3 B;  1MWR A;  3UN7 A;  5HAP A;  3PBR A;  4Z5T B;  3N7W A;  1YUE A;  3IT9 A;  2RVQ C;  1NYY A;  1BZA A;  1EWZ A;  4C75 A;  3X1S D;  3IWO A;  1ES4 A;  4M3K A;  2WGW B;  3UTB D;  1P3G D;  4C3Q A;  2EX2 A;  4J8X D;  2BYK A;  3LJA C;  1ZLA D;  4PM7 A;  3IWI A;  3ZVT A;  1GHP A;  3O88 A;  3AGD A;  4DF6 A;  4AWL B;  4IBK A;  1BUE A;  4MLL A;  1P3B B;  1S32 A;  5FSR A;  5B0Y D;  2Y4A A;  4KUD C;  3VMA A;  3I7J A;  4ZJ3 A;  3HLW A;  5AVB B;  2NZD A;  4YIN A;  4OQG A;  1XKZ A;  4H9N B;  3GVB A;  4KZB A;  2FJ7 C;  3DW0 A;  5KDM B;  4EO5 B;  4OJP A;  1ERQ A;  2CWE A;  4XUJ C;  2QZ6 A;  5B32 C;  2ZC5 B;  5CGX A;  1NZU A;  3X1T D;  3TU4 B;  3LJA A;  4Z9Q A;  3NQJ B;  3KS4 A;  2ZD8 A;  3AZI D;  1YQS A;  4DKI A;  5B1M B;  4NY2 A;  4HBT A;  4YS3 D;  5FQJ A;  3V9R B;  4KUD A;  1NZO A;  3AZL C;  3EPH A;  2H5S A;  2DCF A;  2X71 A;  3WA9 C;  5CXW A;  5AV6 B;  4E3N A;  3KUY C;  1F66 B;  5E2H A;  3MFD A;  4J8U D;  3B6G C;  4J8W D;  2Y2L A;  3IHB A;  1GA9 A;  3L25 A;  4R4R A;  5CER A;  2FJ7 A;  2XDM A;  4WNN A;  4KGC C;  1IYS A;  2HIO C;  4WJ3 C;  3REI B;  3B0D C;  3R45 B;  2G5I C;  5B32 A;  3IXH A;  5GT0 D;  3VP0 A;  3P09 A;  1PW1 A;  1XGJ A;  4OQH A;  5GT3 A;  1SDN A;  3MKE A;  3BYD A;  3HLC A;  3C1B B;  3VFH A;  5FI2 A;  3AZL A;  2IWB A;  4LCL A;  3KUY A;  3LO7 A;  4KG5 A;  1P3L C;  4KGC A;  3OPP A;  1KX3 C;  3BFG A;  2HIO A;  4Z5T C;  3C1C B;  3BFD A;  3Q82 A;  3L27 A;  4OP5 A;  3TOI A;  4EBN A;  1TZY B;  1M19 D;  1O07 A;  2BYM A;  3HLB A;  4NE5 A;  2PYO D;  3LZ0 D;  3WWX A;  5DNN D;  2J9O A;  3LCE A;  3AZF D;  1E4D A;  1Q9C A;  2F8N H;  5F1G A;  1PYY A;  3SH9 A;  3WS5 A;  4NFT A;  4RX3 A;  3AZJ B;  5CPJ A;  1PI4 A;  4P0M A;  5B2J B;  4AWL C;  3VH6 T;  4EBL A;  1P3B C;  1P3L A;  5CPI D;  4ZTK A;  1BH8 A;  4R8P B;  1H3O B;  3JYI A;  4OJ5 A;  4Z5T A;  4ZAM A;  3H0L C;  4XUX A;  3UDF A;  1RGY A;  5AVB C;  4OLG A;  4CAY A;  4EO5 C;  2F8N B;  4X23 A;  4KQO A;  4ZUX B;  5G49 B;  2RCX A;  4PM9 A;  2ZQA A;  4JBF A;  3AFA B;  3TU4 C;  5AVC A;  2ZC4 B;  5CHL B;  5GHX A;  3REJ D;  1P3B A;  4IVI A;  4KG2 A;  4MNR A;  3X1U D;  3NI9 A;  5HL1 A;  3B3X A;  1PIO A;  3HUM A;  4OKP A;  1JWZ A;  2G5H C;  4BD1 A;  1RCJ A;  5AVB A;  3MGQ D;  1F66 C;  1P34 D;  3AL0 C;  4H9N A;  3AN2 B;  3TG9 A;  3ZGA B;  1R4V A;  3FWL A;  3AZH D;  3UTA B;  3REI C;  3Q7V B;  1U60 A;  4R0Q A;  1YLW A;  5KSH A;  3V3S A;  3TU4 A;  5DNM B;  3LY3 A;  3NQJ A;  2WZX A;  2G2W A;  5CHM A;  3EQU A;  4G91 B;  3HL9 A;  5KMW A;  2ZLY A;  1WWI A;  1RGZ A;  3C1B C;  4NK3 A;  3V9R A;  3HLE A;  5AV9 A;  4R3J A;  3C7U A;  1P3O D;  5BPV A;  4ZBJ B;  5B24 B;  1F66 A;  5IHV A;  1ZC2 A;  5JYP A;  4GD6 A;  3REL B;  5GSU A;  3B6F B;  3SOI A;  4WZ4 A;  5CHU A;  1S32 D;  4F94 A;  4DXC A;  5C3I B;  4P6B A;  5FAQ A;  3VOY A;  3BFE A;  4IJF A;  4JXV A;  5DF8 A;  2ZQC A;  3CG5 A;  2NZD D;  3HON A;  4H9O B;  3WTP B;  3C1B A;  2XLN A;  4Y0O A;  3W97 B;  3AZJ C;  4JF5 A;  1P3A B;  1SHV A;  5B2J C;  1K55 C;  3WX7 A;  5HW3 A;  5B0Z B;  5GLB A;  4R8P C;  3CZD A;  3IF6 B;  2IWC A;  4OPZ A;  3W96 A;  1XPB A;  3WS4 A;  3LZ1 B;  3AV1 B;  3O62 B;  3OPR A;  1W79 A;  1KX5 B;  4S2K A;  2JC7 A;  5B1L B;  1KE4 A;  4ZUX C;  4UUZ B;  2DNS A;  2ZQ7 A;  3ITA A;  5A92 A;  2XQZ A;  3AZM B;  1Z6F A;  3AFA C;  3H0M C;  2FJ7 D;  1P3P B;  3AZJ A;  2OSU A;  4LEN A;  3RJU A;  2EX6 A;  3NC8 A;  3HLD A;  2Y2H A;  3MGP B;  5B2J A;  1K55 A;  5B32 D;  4NYY A;  3G2Y A;  1KGF A;  4WEK A;  5AY8 B;  2HPB A;  2A49 A;  1H3O A;  4S2P A;  4RVA A;  2NQB C;  2Y2J A;  1A7W A;  5GT3 D;  1NY0 A;  2WYX A;  5AQB A;  3AN2 C;  4U0T A;  3O86 A;  1BLC A;  3N8S A;  1HZO A;  4HBU A;  3UTA C;  2F8N A;  3FKV A;  3G2Z A;  3AZL D;  5B40 B;  2GDN A;  4ZUX A;  2HDR A;  2PBY A;  5G49 A;  3IH8 A;  1BH9 B;  3KUY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...