2FFFB

Open form of a class a transpeptidase domain
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
453
structure length
453
Chain Sequence
DYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSRRAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of an "open" form of PBP1B from Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Membrane protein, transferase
molecule keywords penicillin-binding protein 1B
total genus 147
structure length 453
sequence length 453
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2fffB01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2fffB03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2fffB02
4YINA 3IF5A 2EX8A 1MBLA 2WGVA 4Z9QA 1XXMA 1FSWA 2ZJ9A 3Q81A 5DF9A 2ZM8A 1TDLA 4E3MA 4JF4A 3HBRA 3ZVTA 4E3IA 4JXVA 2RCXA 2IWCA 1VM1A 4E6XA 5E2GA 4Y0TA 4RX3A 3A3DA 3N7WA 2EX6A 2P9VB 4B4ZA 4DE3A 2HDRA 3C4OA 4K0XA 4WMCD 2FFYA 2HDSA 5CEDA 3DTMA 3NBLA 4OOLA 1NYMA 3LCEA 2IWBA 4DKIA 5EE8A 1DJBA 4ZJ2A 5J8XA 2HPBA 1H8YA 4H8RA 3V3RA 1K55C 3W4QA 1L0DA 3IH9A 2PU4A 1RGZA 1PI5A 2UWXA 4M3KA 1L0FA 3ZG0A 2WKIA 3NDEA 4LENA 4Q8IA 1NXYA 3UPNA 4EBNA 1W7FA 3N8RA 1GA0A 2Y2LA 1WYCA 3JYIA 4WEKA 5HFOA 4NK3A 5HAIA 1KE4A 3HLBA 5FI6A 1W8YA 2FFFB 1FR6A 2QZ6A 3AGDA 3MBZA 1E4DA 4OVDA 5A91A 2Y2HA 3VP4A 2Y2GA 2XH9A 4E3LA 3C4PA 3PBOA 4X56A 2ZMAA 3HUMA 3M2JA 5GHYA 5DVAA 3RXWA 1PW1A 2ZD8A 4KZ3A 3HREA 4S2LA 4QB8A 1KDWA 5AQBA 3VSKA 2JBFA 2VGJA 3S22A 4E3OA 3LO7A 1MPLA 4R0QA 4LCLA 3IWQA 2ZM2A 2ZC3B 5GHXA 4KZ8A 5EECA 3UPPA 4EBPA 3G30A 3HLWA 5DTTA 1XA1A 2H0YA 5I94A 5GLCA 3MZDA 4S2OA 2QPNA 2WYXA 4C3QA 4EQIA 4F94A 3WS0A 5G18A 4IVKA 1LHYA 4X53A 2OLUA 2ZLYA 1XA7A 5AQAA 1ZKJA 2HDUA 1GHPA 4MBKA 2Z2LB 1FCOA 4KZ9A 4KG2A 3C7UA 2XF3A 2WUQA 5FQKA 4KG5A 1YMXA 4KQRA 2B5RA 4UA7A 5JYPA 1YT4A 3S4XA 4UHUA 1OMEA 3VSLA 3D4FA 1CEGA 1KE0A 5EOOA 3C7VA 4R3JA 4ZJ3A 2VGKA 5FQMA 3BFGA 5TGFA 3TG9A 3IXDA 3CMZA 3W4OA 3B3XA 5FQJA 4KZBA 1CEFA 3GMWA 4BLMA 4ZBEA 2V2FF 4FH2A 1IEMA 2XQZA 1RCJA 1CI8A 4KZ7A 2EFXA 4JXSA 5EPHA 5GLDA 5HW3A 3MZFA 3Q07A 2ZQCA 2XDMA 4GD8A 1XX2A 3E2LA 3N8SA 4JXWA 4HBUA 1YLJA 1PW8A 4IVIA 5E43A 4BQMA 1ONGA 3AGEA 3O86A 3BFDA 2ZM0A 5KSCA 3WRTA 5FQ9A 5CEBA 4X69A 4P6BA 5CERA 3SH7A 3NI9A 3UY6A 4S2PA 4C75A 1WYBA 1M40A 1RP5A 4GKUA 4X6TA 5F82A 4DE0A 4PM5A 4WZ5A 3SOIA 1GHMA 1JVJA 3LEZA 2XD5A 5FQIA 1H8ZA 4BL2A 3IT9A 5CHMA 3WS1A 5IHVA 3W8KA 2WK0A 2Y4AA 1BLSA 2Y2QA 3N4IA 4UA9A 1LL5A 3UE0A 2IWDA 1GCEA 4OP5A 4KG6A 5EVIB 3BYDA 1M6KA 4LV3A 3S1YA 3WRZA 1LI9A 4S2MA 4U0XA 4XUXA 4QY6A 4GZBA 1KGFA 2A49A 4E3NA 3IHBA 1Q2PA 1IYPA 2PBYA 3FYZA 3HLEA 3Q7VA 4OPQA 4Y0OA 4ZJ1A 5EOEA 1XKZA 4R23A 3BFEA 3SS4A 5E2HA 2H0TA 3PBQA 3QNCA 4KENB 5GHZA 5M18A 2X01A 4UA6A 2ZQ9A 4IEDA 3ITAA 1MWUA 4DXCA 3MXRA 3NY4A 2BLSA 4K91A 4RX2A 3WS4A 1W79A 2DNSA 3IF6A 2BG1A 3LY3A 4WM9A 1JWVA 1PI4A 1K6RA 1Z6FA 3PBSA 5FAQA 3VFHA 1BZAA 3MFDA 1Q2QA 2V20A 5F1FA 1TVFA 2V1ZA 3UNWA 4R4SA 3O87A 4RA7A 2QMIA 4E3JA 5HL1A 1MWTA 1NZOA 2OV5A 2G2UA 1EI5A 3G4PA 4XUZA 5CRFA 3FKVA 3HL9A 3HLFA 4OP8A 2A3UA 3IF6C 3TSGA 1E25A 2DRWA 1YLPA 3A3JA 4MBHA 5FATA 3DWKA 3OZHA 5L2FA 3Q7VB 1FR1A 1L2SA 1PZPA 3BEBA 1ES5A 1HTZA 4GN2A 3ISGA 2Y55A 4KZ5A 1SDEA 2XGNA 2XD1A 1I5QA 4OOMA 4EV4A 3GR2A 4R3BA 3O88A 4WBGA 3ZDJA 3UN7A 1XPBA 2Y2KA 2WZXA 5FDHA 1YQSA 1FCNA 3G35A 3FWLA 5CECA 3BFFA 3MXSA 4LV1A 5JYOA 4XXRA 4MBFA 1FCMA 3AGFA 3OPPA 4U3TA 1TDGA 3CJMA 3OPHA 1BTLA 4JF5A 1CI9A 1NRFA 4U0TA 5E2FA 4C6YA 1BLCA 2EXBA 3OPLA 4Y7PA 1PWDA 4N92A 4WMCA 1K56D 1S6RA 1ERMA 2Y2PA 5FA7A 3G2YA 1KVLA 4OPYA 4CPKA 5KMWA 3V3SA 4S2NC 2XLNA 5EVID 2Y91A 1N4OA 4UAAA 3PBRA 3BLSA 4HBTA 1FSYA 3RJUA 4JBFA 2Y2OA 4N9KA 1O07A 3BM6A 3UDFA 4YFMA 1FQGA 4OLDA 4QD4A 1ES2A 1K55A 3P09A 1PWCA 3Q7ZA 2C6WB 4KZ6A 3TOIA 2Y2MA 1KGEA 1MY8A 3GSGA 4OKPA 5U47A 3UE1A 3SH8A 2R9XA 4FCFA 1K4FA 4S2NA 1IYQA 4S2JA 3IWOA 3DWZA 2R9WA 3EQUA 4LV0A 4OQ0A 1CK3A 3GVBA 4BL3A 5TFQA 5KSHA 3VMAA 3OCNA 1SKFA 2ZC7A 1ZG6A 3EQVA 4RYEA 1NJ4A 2J8YA 2WKEA 1FOFA 2WKHA 3VFFA 3CZDA 1RGYA 3GQZA 4WELA 4QHCA 1DJAA 1Y54A 4L0LA 4GD6A 1MKIA 2J7VA 3P98A 5AQ7A 2H5SA 1K6SA 3HLCA 3DW0A 5CGXA 1YM1A 3NCKA 1IKGA 2WZZA 3GTCA 3PAEA 4P85A 3GRJA 3PAGA 3N8LA 1ESUA 1K4EA 1K57C 4IBRA 1ONHA 4OPRA 4CJNA 3WS5A 1EWZA 4D2OA 3A3FA 1YLYA 1N9BA 2EX2A 5CHJA 1SHVA 3ZG7B 3UDXA 4X55A 3ZFZA 5HAQA 2WGWA 4KQOA 3ZVWA 2HP6A 2WAEA 3PTEA 3I7JA 4DF6A 3UPOA 1QMFA 1NZUA 3V50A 4HESA 2WGWB 1HD8A 4N1XA 3N6IA 4OONA 3IXGA 3NDGA 5E2EA 4PM7A 3Q1FA 1IYSA 1O7EA 2I72A 3C5AA 4GB7A 4WYYA 2ZQDA 5F83A 4OPZA 2Z2MB 4MNRA 2PU2A 2ZQ7A 1I2WA 2H10A 1I2SA 2RL3A 5DF8A 1KE3A 2X71A 1U60A 3IF6B 3ZNYA 5CXWA 1MWRA 2XFTA 4QJGA 2XR0A 3BFCA 4WZ5C 3SH9A 4S2KA 5FI2A 3NC8A 1JTGA 4GOGA 1ZC2A 3M6BA 2EXAA 1C3BA 4DDSA 2JC7A 1MXOA 1YMSA 4A5RA 1ES3A 5CHUA 1J9MA 1K57A 5KZHA 3QHYA 3FKWA 4LCMA 4GDBA 1SCWA 2Q9MA 4N1HA 3IQAA 5EUAA 1ALQA 2J9OA 3OCLA 1HZOA 2E8IA 4S2IA 5HAPA 3HLGA 3PBNA 2ZC4B 3SS5A 4WZ4A 4BD0A 4FD8A 3ZNTA 2JE5A 1YLWA 1AXBA 2HP5A 4R4RA 3V5MA 1NYYA 5GLAA 4ZTKA 2Y2NA 4JF6A 3VOZA 1ESIA 5A92A 4B88A 4HEFA 2EX9A 4JPMA 4NETA 4K0WA 3ZG9B 1BLPA 2WADA 1PYYA 5GLBA 2HP9A 4BD1A 1YLTA 1HVBA 3UDIA 3VOYA 5GL9A 1BT5A 1W8QA 2ZC5B 4KZ4A 4MLLA 5CGWA 1S0WA 1K54C 1BLHA 1ES4A 3A3IA 1BUEA 1VQQA 1K56A 4MEZA 3ITBA 4JKTA 3CG5A 3IH8A 4FSFA 4PM6A 4DE2A 4O7DA 4GDNA 5AQ9A 5EVIA 2ZC6B 1IELA 2OLVA 4ID4A 1JTDA 3FZCA 3HLDA 4PM9A 4OQIA 5CTNA 5CTMA 3ZG5A 2GDNA 4ZAMA 1NY0A 1LI0A 1K54A 2G2WA 4OQGA 5FI7A 3WS2A 2HDQA 3G32A 1BSGA 1JWZA 3BRMA 4IBXA 4OOYA 3E2KA 1LLBA 4FH4A 1XGJA 3WWXA 1DJCA 5A90A 1XP4A 1KVMA 1PIOA 4KZAA 3SS3A 3IWIA 4OH0A 3ZGAB 4X68A 4JLFA 4DDYA 2Y59A 3HUOA 1JWPA 4OQHA 5D3OA 1DY6A 4JXGA 4PPRA 3A3EA 3ZCZA 4DRTA 1MWSA 3IXHA 1KDSA 1K38A 4BJPA 4PM8A 4KQQA 2XK1A 5FQQA 2JCHA 3HUNA 5A93A 5DTSA 4RVAA 1K25A 5FASA 4R1GA 4E6WA 1ERQA 4PMAA 3M2KA 3VP2A 2J9PA 4EBLA 1GA9A 3G31A 5M19A 3M6HA 3BECA 3MZEA 3VP0A 2EFUA 3IHAA 4QU3A 3VP3A 2X02A 3G2ZA 2Y2IA 2P74A 3V39A 1PWGA 2XEPA 1WE4A 4B4XA 5BOHA 2XFSA 3BLMA 3OC2A 4LV2A 4ZDXA 4N9LA 4WEJA 1YLZA 1BULA 5FAOA 3W4PA 5EVIC 1E3UA 3VP1A 4OLGA 5TR7A 4E3KA 3UE3A 1QMEA 2Y2JA 1IYOA 1G68A 3FV7A 5DTKA 4DE1A 1L0GA 1SDNA 5F1GA 3NIAA 5EVLA 3QNBA 1TEMA 3G34A 3ZG8B 3MKEA 5HX9A 2DCFA 5HARA 3OPRA 4P0MA 5CGSA 3IXBA 1GHIA 1KGGA 3RXXA 1IKIA 1ZG4A 2Q9NA 2WAFA 4EWFA 3O3VA 2ZQAA 1XGIA 3HVFA 2OSUA 2P9VA 3Q82A 4BENA 3PBTA 1L0EA 4QY5A 4GNUA 1LL9A 5M1AA 4DXBA 3GV9A 3ZHHA 4EUZA 1W5DA 1E3UD 1PZOA 1EROA 2CC1A 3MKFA 4Y0UA 3UO9A 3LY4A 5FSRA 2ZQ8A 1G6AA 2WGIA 4P87A 5FAPA 2C5WB 1H5XA 5DF7A
chains in the Genus database with same CATH superfamily
1CK7A 5IT5A 3IF5A 4MMNA 4LFUA 2Z6CA 1OTBA 1OTDA 3AZKB 3EPKA 2ZM8A 1OGGA 2P7JA 4E3MA 3E4OA 1E6RA 4JXVA 5HPIA 2O9BA 1VM1A 3N3FA 5E2GA 2AROC 4UPKA 4DE3A 1PDCA 5CEDA 3NBLA 2IWBA 4I5SA 5EE8A 3AZMA 4HGAB 4ZJ2A 2HPBA 3FDDA 1K55C 4WU9C 3ZG0A 2DQNC 3QP5A 2NZDC 3LR5A 4EBNA 3AZHA 1OTEA 3N8RA 2Y2LA 1UWNX 5EVEA 4WEKA 4WN5A 2XSSA 4HOIA 5FI6A 1ZLAD 2QZ6A 1BH8A 2W3FA 5E5AC 3LIBA 3X1TD 2XH9A 4E3LA 3MS6A 4HH2A 3FG8A 1GSVA 3MQLA 5BO0A 1LL8A 1OT6A 1BH8B 1KDWA 5AVCA 3TU4C 2VGJA 3C1BC 2IO5B 3S22A 3MGQC 5K5BA 4R0QA 1CF0A 3L29A 2ZC3B 3RH8B 5FEGA 3UT9A 3GDIA 5GHXA 4KZ8A 3UPPA 5DNMB 2NQBA 3AFAB 5GT0B 1S32C 4S2OA 3RELD 5GT3C 5EM1A 5B0ZD 3X1TA 4F94A 5G18A 4IVKA 1L6JA 4X53A 1XA7A 2ZLYA 2HDUA 3W96A 4Z2KA 1W1TA 1T1AA 2Z2LB 1FCOA 4KG5A 1YMXA 5F99A 4J8VD 4KQRA 3LZ0D 5JYPA 1HQ3D 3S4XA 2PD8A 4HQAA 5FQMA 1FILA 5TGFA 4X23B 3CMZA 1P3MD 3HSHA 3LJAD 3AZGC 4IJFA 4HMDA 1P3BB 3LZ0C 4XZQC 3C30A 1CEFA 4J8WD 5B0ZA 1WWIA 2VX8A 1F5MA 1P3LB 4KZ7A 3UTBC 3MZFA 5L10A 4YM6B 4JXWA 3T1RA 1PW8A 3O86A 4NXEA 2ZM0A 1TS0A 3WRTA 1QO6A 4Z66D 4X69A 4P6BA 3X1SA 3C1BD 2ZOIA 3NI9A 3QP2A 3SH7A 1M40A 5F82A 4WZ5A 4J8VB 4NZ1A 5FQIA 5IHVA 1M19D 5DNMD 1OTAA 3A6NC 5CPIC 3S7NA 5BNVB 3RELB 3R45B 1GCEA 3BW6A 1ZLAC 3KWQA 4LV3A 5AV5B 1ODVA 3S1YA 1P34D 2VQRA 1P3GB 1P3PC 1LI9A 4U0XA 1KX4A 3LZ1A 2RIQA 1KGFA 4H9OA 3C38A 4J8UB 3FYZA 4Y0OA 1LSVA 5HWWA 3LZ0B 3AZND 3S7OA 2OOLA 5AV6B 4LD9D 3W98B 3WD1A 4F3LB 5AVBD 3BY9A 3ITAA 4CAYB 1H3OB 1W79A 4XZQA 3B0DB 2BG1A 2DNSA 4Z2MG 1P3FD 1PI4A 4E45A 5CPJD 1Z6FA 5FAQA 3VFHA 2A2LA 3AZEA 1TVFA 2A24A 2RVQD 2VGLM 3X1VC 1MWTA 1NZOA 5HPFA 3K3CA 3HL9A 1F9IA 2BYMB 2ACGA 2DRWA 2HZ5A 4XUJC 5L2FA 1FR1A 3BQAA 3AV1D 1ES5A 3NQJB 2FJ7B 2Y55A 5AY8C 1NWZA 2VJWA 1I5QA 3AZJB 3B6GD 5AV9D 1G6OA 1P0ZA 1M19B 3G35A 3FWLA 3MVDC 4WL9A 2YKFA 4XXRA 2VV7A 1AWIA 3B0DC 2HV1A 2PYPA 3CJMA 4NY2A 3OPHA 4GH9A 1NRFA 1AOIB 1BLCA 2EXBA 3MVDA 1GPFA 4LLOB 4Z66B 4OPYA 4NEED 3EOIA 3NULA 5KMWA 2XLNA 3H0RC 1GOIA 4EU0A 1P3IC 1XJ2A 1N4OA 5HD5A 1E15A 4HBTA 3RJUA 4WNNA 3L9KA 5AVBC 3REIA 1FQGA 4WLAA 3A0VA 4ETXA 4H9PB 1PWCA 3Q7ZA 3NOTC 2BYKA 1EQZD 3GSGA 5U47A 4S2NA 3AZLB 3MGQB 4KUDA 3GVBA 1TZYD 5GT0A 5J4EA 4EEUA 2XROA 2PYOB 3VMAA 1SKFA 2ZC7A 1ZG6A 3KSYA 1NJ4A 5BT1C 1D7EA 1S1YA 2WKEA 5B1LD 3CZDA 1DJAA 3P01A 1U35D 3B6FC 4QLCB 3W97D 1N9LA 3C1CC 1IKGA 5B2IA 4NKPA 4HJ3A 2OWJA 1K57C 3MMHA 4OPRA 1T1BA 1Z2CB 3WTPB 3WS5A 1EWZA 3KS4A 1VEUA 5CHJA 4X55A 4J8XA 2W8SA 3WTPA 5BS7C 3PTEA 1QMFA 3NJAA 3B0CT 3V50A 1F98A 2O99A 1PZRA 3W96D 4N1XA 3N6IA 4J8WC 4OONA 2VKSA 4PM7A 1P3OD 2I72A 1LSXA 4GB7A 2ZQDA 1HQ3A 5F83A 2Z2MB 4MNRA 2PU2A 3L25A 1KE3A 2X71A 4PAUA 5B2JB 5CPKC 5B24D 3WAAA 2DF4C 3V67A 5B33D 1JTGA 4GOGA 5B2JC 2EXAA 2JC7A 1ES3A 5DKLA 5B0ZC 5KZHA 4WU9B 3W2ZA 2Q9MA 4MCWA 1ALQA 1F66B 4GHIB 3REJB 1HZOA 3HLGA 2H28A 2JE5A 1AXBA 4JJNC 3V5MA 5IS1A 5FUGB 4ZTKA 3TU4D 2JKGA 1ESIA 3WTPC 3REHB 4HEFA 4II7A 3AN2D 5GLBA 3WA9D 3UMEA 3MGRD 4KUOA 3UDIA 4BD1A 1W8QA 4KZ4A 5JRGC 1K54C 4EERA 1BUEA 2K7SA 4MB4A 2J80A 4GJ4A 4CLCD 2IO5C 3P7NA 3IH8A 4DQYB 3KUYB 4H9SA 4HMCA 5EVIA 3TE8A 3X1SB 3FZCA 1XFQA 3HLDA 1V9ZA 4ZAMA 3CUEC 4YM6C 1NY0A 3FPVA 3WS2A 1P3PA 5FI7A 3E98A 3G32A 1BSGA 1JWZA 4CQHA 1ID3C 2CV5B 4HP9A 3WWXA 3AN2A 1XP4A 4DDYA 1PIOA 2EA9A 3ZGAB 5DJTA 4EXOA 1JWPA 4H9NB 4IBBA 4JXGA 3ZCZA 3A3EA 4HJ6A 4BWIA 1K38A 4BJPA 4PM8A 5B0YD 1F2KA 2FN2A 3D9YA 4R1GA 5BNVA 3RELA 1W1YA 4PMAA 1GA9A 4Z2HA 1G5UA 3BECA 4QU3A 3IHAA 2Y2IA 2V0WA 3REJD 1WE4A 1YU1A 1W2EA 3OC2A 5L8MA 4PKYG 4N9LA 1YLZA 3MF0A 3VP1A 3AZHC 4R6LA 5KIZA 3MGQA 4LRXC 5GXQB 1IYOA 3FV7A 1KX4C 3T1QB 4J8WA 5J3WA 3MKEA 4UQIS 5HARA 3OPRA 4QLCC 2W1RA 5CPIA 4ME4A 2YFVB 3AZFA 5FDSA 3T4QA 4EWFA 2ZQAA 1XGIA 3CITA 2R78A 3PBTA 3PYPA 1L0EA 5J7EA 1EQZC 1W5DA 4I3AA 1ID3A 3X1VB 2HIOD 4IBFA 4P87A 1JNUA 5HDDA 4D2OA 1EQZA 5IU1A 1FSWA 3Q81A 3AZHB 2Y8HA 1M19A 3QP8A 1N9NA 3DTEA 3H7WB 2JN7A 3UTAB 3MGPD 4KHAA 4XT2B 3WA9C 4RX3A 2EX6A 3CPTB 4I39A 4B4ZA 3AZIA 3MVDD 3C4OA 2ZY2A 5AV6D 3A6NB 4JJND 1P3AC 1NYMA 4DKIA 3UTBB 5J8XA 4I3IA 4ARZB 3MQ0A 1L0DA 3C2WA 3NQUA 4XUJA 3AZKD 4LRYC 2JHEA 3NDEA 4Q8IA 1W7FA 3IX4A 1WYCA 3JYIA 5AVFA 5HFOA 4X23C 1KE4A 3HLBA 4BBUA 2FFFB 1FR6A 2FJ7C 5CPKA 4GW9A 2NQBB 2Y2HA 3X1TB 4JJNA 4HJ4A 2ZMAA 4CLCE 3M2JA 5GHYA 3RXWA 2W3DA 2XA7M 1GSXA 4R38A 2ZOHA 4IBIA 4WU8D 1S66L 5B32C 3MXQA 5L09A 3WKJA 5B1LA 3UE6A 3KO6A 4LG2A 4G3VA 5HSQA 4E3OA 5AVEA 3AV1A 5B24B 4EBPA 3G30A 4LGWA 3HLWA 5DTTA 2H0YA 2EWVA 4R3AA 1A7WA 4EQIA 2J3WA 3WS0A 2OLUA 5AQAA 1M18B 1ZKJA 1GHPA 4MBKA 1ZLAA 3BQ8A 4KG2A 3C7UA 2XF3A 1T19A 2B5RA 3VSLA 4UHUA 1OMEA 3D4FA 1CEGA 3W97C 5EOOA 3B6FD 3T4SA 1T1CA 1P3AA 3CAXA 3CWFA 4IBJA 3FPWA 1TS7A 2JSSA 3T4KA 4BLMA 4ZBEA 3VH5T 4WF0A 1IEMA 4Z66C 2YKHA 2XQZA 1P3LD 3AV2D 5GLDA 5HW3A 3H82A 2PD7A 2ZQCA 3Q07A 4GD8A 2B02A 1XX2A 3E2LA 5E43A 2O9AA 5JRGA 5FQ9A 4WU9A 4S2PA 5DFXA 1HLUP 1WYBA 1RP5A 4X6TA 4DE0A 3REKB 5B32A 4GHAA 3W99A 4J8XB 5CP6D 3LEZA 2LB9A 3OLOA 3MGSB 3IT9A 4X25A 3W8KA 2WK0A 2VV6A 3N4IA 1LL5A 3BYDA 2LB5A 1M6KA 1HQ3B 4XUXA 4QY6A 2A49A 4Y5FA 3HLEA 4CLCA 2HUEC 3EGXC 3V9RB 3BFEA 4G92B 3DBAA 3PBQA 5F5YA 4X23A 5GHZA 3CLOA 3TJZC 1P3KA 4EO5B 3AV1C 2X01A 5AVCC 2BTFP 3NY4A 1UR9A 3WS4A 3LY3A 5B2IC 2V1AA 3T4OA 3PBSA 5HDSA 3MGSC 1Q2QA 5F1FA 3HCYA 4R4SA 1P3IB 5DNND 4WJ3C 1EI5A 1P3KB 3FKVA 3HLFA 3IF6C 2PR5A 3TSGA 1T18A 1H0MA 2NZDD 4Y15A 1YLPA 5FATA 3VH6A 2ZM5A 3UTAC 3DWKA 3Q7VB 1UWPX 2VA0A 3WD2A 2XGNA 2XD1A 2V8CA 4R3BA 3O88A 3ZDJA 3MGRB 3UTAD 3AYWA 1YQSA 4JGQA 2LY8A 5JYOA 4ZUXD 1AOIC 5DNNA 3AGFA 4AWLC 2AROD 3LELB 5G4YA 1TDGA 1BTLA 1CI9A 4U0TA 2JKRI 4LD9B 5B40A 5AV8A 2PYOA 2D01A 4N92A 3VH5W 2Y2PA 3LELA 1M19C 1W1PA 5DNNB 5CX7A 1Y28A 1MKMA 2EWWA 2OAP1 1M18C 5KDMB 4EW7A 4UAAA 3AZID 2JKFA 3PXPA 1STZA 1FSYA 1H3QA 4JBFA 4N9KA 5HWTA 4OLDA 3T4TA 1M18A 1K55A 3P09A 1EQZB 2C6WB 4KZ6A 3UE1A 2Y2MA 1MY8A 2WKRA 4IJGA 3KXBD 1KX3D 3AZJC 3FC7A 4J8UC 1IYQA 4S2JA 1XJ4A 1YPRA 4OQ0A 4BL3A 4ZUXA 4CAYA 3OCNA 4RYEA 3AZLA 2J8YA 1OPXA 5A8BA 3HJKA 4Z5TD 3QP6A 5L07A 1FOFA 2WKHA 4Z1WA 3WKJC 2PHYA 3GQZA 1KX5B 1Y54A 4ZBJC 4L0LA 4GD6A 1NLYA 4YM6D 3HLCA 3DW0A 1YM1A 3G6OA 1W1VA 4J8VC 3NCKA 2WZZA 1BH9B 1PFLA 3TW8A 3N8LA 5DFYA 3X1SC 1ESUA 4ZUXB 2J8PA 2F8NK 3QP1A 1KS0A 5B2JA 1VB6A 1EAKA 4NG2A 4PKYA 3RELC 4O01A 3ZG7B 3UDXA 1YSPA 3VE3A 3T50A 3NQUB 4XUJB 3ZFZA 5HAQA 3WTPE 2NZDB 5HD3A 2HP6A 2WAEA 3LIAA 2CMNA 1D1JA 1HD8A 2IA2A 4H6JA 5DNMA 3OOVA 3IXGA 3NDGA 4GLQA 1IYSA 4WYYA 1DP8A 4CSRA 5AV5C 3AZLC 2RL3A 5DF8A 1U60A 3EPJA 1MWRA 3UT9B 5DJUA 5B2JD 1AIWA 5B33C 4HIAA 5TBMA 5B24C 3C1CA 5FI2A 3NC8A 1ZC2A 4R8PD 1C3BA 4A5RA 2BASA 1TS8A 1J9MA 1K57A 4WU9D 4NXGA 3FKWA 4GDBA 4N1HA 2Z6DA 3IQAA 3K3DA 2J9OA 4IBEA 1S32A 5CP6A 2D49A 3PBNA 2ZC4B 3SS5A 4KUKA 1T3UA 1YLWA 1TAFB 3VH6W 2HP5A 5BS7A 1NYYA 4KUDC 1Y4OA 5CPJB 4B88A 3AZJA 5B32D 1KX3B 3WKJB 3IBRA 3LGOA 4MLLA 5CGWA 3K2NA 4DJ2A 4GCZA 4KGCB 3AL0C 1K56A 1P3LA 5AV6A 4R8PC 1YU4A 3CG5A 4GDNA 5EV0A 4X23D 4EEPA 4ID4A 1JTDA 3ZG5A 5CTNA 4OQIA 1M1AD 4OQGA 1KX4B 4GHLA 3AYWB 3LZ1D 4OOYA 4IBXA 1U35C 5AV5D 4MN7A 2NUTC 1DJCA 4DMZA 1KVMA 3SS3A 1NRJA 3UB8A 5B33B 4JLFA 4O0PA 5D3OA 4PPRA 1DP9A 1MWSA 1P3MA 3A1KA 3UT9D 3MNNC 1KDSA 3IBJA 5FL3A 3R4KA 4KQQA 1TZYC 4MB5A 4IUHA 1Q9CA 2I9VA 4XZQB 5C5KA 3WD4A 3KS8A 1ERQA 3C1BB 4YS3A 3VP2A 2J9PA 1M1AA 5M19A 1R4VA 3M6HA 3BY8A 2PT7A 3VP0A 2X02A 4H9OB 3G2ZA 1BYWA 5BOHA 1PNEA 3PHYA 2XFSA 4UQIM 3REID 3F1NB 4QWOA 4WEJA 5FAOA 4H9SC 5EVIC 2BYMA 4OLGA 5JRGB 3VV4A 3KSGA 3VE4A 2A24B 4CLCB 5B0YB 1ID3B 2Y2JA 2ZMFA 5DKKA 1SDNA 3GECA 3AZGA 1TEMA 5F6AA 4L9GA 3G34A 2DCFA 3DAVA 5CGSA 1GHIA 3LI9A 1KGGA 3RXXA 4MB3A 3AYWC 1CJFA 1IKIA 3LUQA 3REHA 2Q9NA 2WAFA 1KX3C 4EUZA 5TJJA 3GV9A 3IX8A 2YFWA 1KX4D 1PZOA 4NE5A 3MKFA 4KHAB 3LY4A 1G6AA 5FAPA 2VLGA 1H5XA 1M1AC 1H0GA 1P3KC 4MN5A 4YINA 2EX8A 1MBLA 2WGVA 1XXMA 3RTYA 4OJPA 4Y17A 5DF9A 2F8NH 3MQQA 4ARZA 2ZMVA 3VH6T 1N1JA 3HBRA 3ZVTA 4E3IA 4MN6A 2RCXA 3NOPC 2INWA 1P3FC 2NUPC 3AZED 2P9VB 5GT0C 4ZRRA 3MVDB 3W96B 2HDRA 2HDSA 5HWVA 1F66A 1P34B 1P3GD 1GSWA 3LCEA 4HNBA 3CPTA 4DN0A 4IBCA 4LD9C 3CI6A 5E5AA 1H8YA 4H8RA 4WNNB 3W4QA 2B18A 2PU4A 1RGZA 3D72A 4H9RB 2UWXA 1ID3D 2WKIA 1P34A 3UPNA 4G3KA 1DP6A 1W8YA 3MBZA 2O9CA 3H9WA 4WZSB 1E4DA 4OVDA 3A6ND 2M7UA 1F66D 2HIOB 3C4PA 2QKPA 3PBOA 4X56A 4ESPA 3HUMA 3AFAC 4FTXA 1N9OA 5DVAA 4KZ3A 3MGRC 3AN2C 4O8GA 5AQBA 3VSKA 3WTPD 3WA9A 4EETB 2RTSA 3F1OB 3AN2B 3IWQA 2ZM2A 3QP4A 3ICYA 4E04A 2VZWA 3LR4A 5EECA 5I94A 2ZBBA 2V8FA 3KYZA 5GLCA 3O62C 3E4PA 3MZDA 3X1UB 3UTAA 2WYXA 1LHYA 3EG5B 4NXBA 3X1SD 3C1BA 1IOUA 1LSWA 2HJEA 1B67A 4WU8A 3DTKA 4KZ9A 2O0YA 2WUQA 4NE3A 5B33A 5BO0B 5B31G 2NQBC 2GZAA 3UTBA 1YU3A 1KE0A 3F1OA 1P3MC 4ZJ3A 1ACFA 3TG9A 4BBTA 1VHMA 1HQ3C 3W4OA 1V9YA 3L28A 3KSIA 4KGCD 3W96C 4YOFA 4G92C 1GXDA 1RCJA 1CI8A 1IFQA 1S67L 1ULYA 2QJ5A 4IBGA 1YLJA 4IVIA 5HZHA 1ONGA 1S4RA 1S32B 1MZUA 3KWQB 3MGQD 4YS3B 5CEBA 3AZIC 5CERA 3UY6A 4PM5A 4GKUA 2W0NA 2F8NG 3SOIA 5CPJA 2G5IC 5BNXA 1GHMA 1JVJA 2XD5A 1H8ZA 1YU2A 3WS1A 3W97A 1F66C 1OGBA 3L7HA 5F69A 1BLSA 3UE0A 1SZVA 2IWDA 5AV8C 3X1UD 4NXFA 4OP5A 3MR0A 4CSRB 1KX5C 5G4ZA 4FUWA 4S2MA 3B47A 4GZBA 4E3NA 5CHLB 3IHBA 1Q2PA 1IYPA 3AV2A 4ZJ1A 3HONA 5EOEA 1XKZA 3CUEA 3QNCA 4KENB 3JPUA 3ZYTA 5AY8A 2J3TC 1P3GC 1P3PB 2ZQ9A 4IEDA 4BMWA 1MWUA 3CHWP 4DXCA 2BLSA 4K91A 4RX2A 3KUYA 4WM9A 4ETZA 2QYBA 2VK3A 1K6RA 3WD3A 5B1MC 4OJ6A 5DNNC 2G7UA 1BZAA 2ZL1A 1E6PA 2V20A 4QNLA 1SKOA 2ZY4A 2W1TA 4KQDA 3O87A 5B32G 2QMIA 2FJ7D 5B1MA 2OV5A 3AZMD 3G4PA 4HMEA 3LR0A 4XUZA 1P3KD 4I3JA 2F8ND 2A3UA 4NZ5A 5AVCD 5CPIB 3A3JA 3IX3A 3OZHA 3B6GC 1PZPA 2V0UA 1HTZA 3ISGA 5AY8D 4KZ5A 1SDEA 4OOMA 4EV4A 3GR2A 2MJ6A 2Y2KA 3O5YA 3R7WB 5FDHA 3R45A 1FCNA 4K08A 4XT2A 3TU4A 5CECA 5G49B 3LJAA 3MXSA 4LV1A 5GSUD 4MBFA 1FCMA 3JVUA 1G28A 2OAQ1 3MGRA 3OPPA 4U3TA 3AZGB 5E2FA 3X1VD 1YUEA 3OPLA 4Y7PA 1PWDA 4WMCA 1K56D 2RVQC 5B0YA 1W63Q 3G2YA 2V9AA 2W3EA 4S2NC 5EVID 2B95A 1BH9A 3BLSA 4D60A 2Y2OA 1O07A 2PRFA 2PDRA 1OJGA 1KGEA 4GHIA 3SH8A 4FCFA 3JVVA 3IWOA 3DWZA 3EQUA 3AV2C 2VEAA 1CK3A 1U35B 5KSHA 1P3LC 1E8BA 3L27A 5EM0A 3EQVA 4Z66A 4Z5TB 2JKTM 3X1UC 2V1BA 5AVCB 5CPID 4QHCA 5DNMC 4NE6A 4HI4A 3AZHD 3P98A 2H5SA 4FOFA 5BNXB 5TBMB 3GTCA 3KXBB 1MC0A 3EGDC 4P85A 3GRJA 3REJC 3KSFA 3UB7A 1ONHA 2AVXA 4CJNA 5GT3A 3EEAA 4JJNB 4HH3A 3REJA 1N9BA 1P3OB 2F8NB 2WGWA 3UTBD 1EW0A 3AZFD 5B0YC 4KUDD 4DF6A 1W63M 1TAFA 3UPOA 3UMDA 4HESA 5BPVA 4KGCC 4IBDA 5E2EA 1AOIA 4XZQD 4WU8C 4IJEA 4L9EA 3LJAC 2VGLS 2H10A 2ZQ7A 4JGOA 1I2SA 3ZNYA 5CXWA 4YNRA 3E4QA 2WKPA 2HJ9C 2XFTA 4QJGA 3B6FB 5KDMA 4WZ5C 4S2KA 5F99D 4J8VA 5C3IC 1P3BD 4AFIA 4DDSA 1MXOA 1YMSA 5CHUA 3QHYA 4LCMA 3E0YA 1SCWA 5EUAA 4PHTA 3OCLA 2E8IA 4S2IA 5HAPA 2L5AA 3MGPB 3B33A 4WZ4A 3AV2B 4KUDB 2DMWA 2XRNA 3ZNTA 1ZLAB 5AV9A 1SKOB 2W1TB 2Y2NA 3W99C 4K0WA 5B32B 3ZG9B 3S7PA 1PYYA 4M6BA 1HVBA 3AFAD 3TRCA 3WAAB 1BLHA 3X1TC 4JKTA 4AWLB 3SZTA 4FSFA 4PM6A 3WAAC 4O7DA 4TX8A 1ZHHB 1L3LA 3NOUC 5CPKD 2ZC6B 5FUGA 2M1CA 5HL1A 5CTMA 4PM9A 4NYUA 1LI0A 4HHDA 1X0OA 3FKEA 2AROB 3BRMA 1KU5A 4EESA 4UUZB 3E2KA 2K31A 4FH4A 2PYOC 1XGJA 3KYEA 3WKJD 3LZ0A 3IWIA 1OJ5A 4OH0A 3LIFA 4YS3C 1H0IA 1YKDA 4P6ZM 3AFAA 3KWQC 1WWSA 2JKRM 4DRTA 3IXHA 3MQOA 4WUJA 5FQQA 2JCHA 3AZFC 3W98D 2CV5D 1VETA 3AZEC 1J3WA 4RVAA 3AZJD 1K25A 5FASA 4E6WA 1P3MB 3LEQA 3U2AA 2YFVA 3AZFB 3M2KA 4EBLA 3W97B 3KX0X 3MZEA 2EFUA 3VP3A 3IP4C 2P74A 3V39A 3MNNB 1DRMA 2XEPA 2W3HA 3BLMA 1E6ZA 1M18D 3SW1A 5FEFA 5GSUB 1E3UA 5TR7A 3UE3A 3KFUG 2L4RA 2CV5A 1G68A 2V5OA 5DTKA 4G91C 1L0GA 2OWHA 4NZ4A 5F1GA 5EVLA 3QNBA 4KGCA 2W3GA 2VV8A 1P3IA 5BT1D 3ZG8B 4Z2MH 4RQ9A 3IXBA 2CV5C 3W98C 3AYWD 4ZUXC 3T1XA 1A0KA 2E8JA 3MNNA 3REIB 3KWQD 2OSUA 4GS9B 2P9VA 4BENA 5B1MB 4YS3D 4QY5A 4GNUA 5M1AA 3ZHHA 2PYOD 1EROA 4GS9A 3LELD 5FSRA 1F1EA 2WGIA 3F1PA 5F68A 2C5WB 4L9FA 5DF7A 1P3ID 4LPZA 4Z9QA 2GX5A 5B24A 3WAAD 2ZJ9A 1UGUA 4J8XD 5E5AB 3A1IA 1TDLA 4CLCC 1P3FB 4JF4A 4H9RA 3MGSD 4H9QB 2BYKB 5CPKB 2IWCA 4E6XA 4Y0TA 3A3DA 3N7WA 4WMCD 4K0XA 4EUVA 2FFYA 3MNND 5B0ZB 1D06A 3DTMA 4OOLA 3U4LP 1DJBA 3V3RA 3RFBA 4OUIA 3IH9A 1PI5A 3A0SA 4M3KA 1L0FA 5EFWA 4LENA 3M7PA 1NXYA 1GA0A 1P3BC 3AZMC 4WU8B 1JFIA 4NK3A 5HAIA 3AV1B 4QPRA 3AGDA 3R7WA 3AZMB 5A91A 3VP4A 2Y2GA 1CQAA 3MGSA 5B1MD 1PW1A 2ZD8A 5CPJC 3HREA 4S2LA 4QB8A 5CP6C 3ZQ5A 3VOLA 3LYXA 2JBFA 4Q0IA 1P3GA 3LO7A 1MPLA 3L26A 4LCLA 2J3TD 4EO5C 1ZTUA 1XA1A 2Y79A 1N1JB 2QPNA 3LI8A 4C3QA 2F8NA 1BFMA 1P34C 1P3PD 5B31D 1KX5D 5GT3B 2KLIA 4BBVA 1H3OA 3L2AA 5FQKA 5AV8D 3REHC 3C1CD 3BWLA 3UB6A 4UA7A 1TZYA 1YT4A 1E88A 3C7VA 4R3JA 3UB9A 4EQ1A 2VGKA 5B1LB 3BFGA 3AZLD 2GNXA 2KDKA 3IXDA 1TZYB 5GSUA 3B3XA 5FQJA 4NZ3A 4KZBA 5B1LC 5JA4B 3GMWA 2V2FF 4FH2A 4YWZA 4Q0JA 5B31C 3IS2A 4YM6A 2EFXA 4JXSA 5EPHA 3V9RA 2XDMA 3REKD 3O62B 3N8SA 5CP6B 4HBUA 4E44A 3EPHA 1VETB 4G3WA 4UEYA 4BQMA 1UR8A 3AGEA 4G91B 3BFDA 5KSCA 4Z2LA 4C75A 3EPLA 3UB5P 3C1CB 3KYQA 2HGVA 3AZGD 3LFVA 4LD9A 4BL2A 1KX3A 3B6FA 4HP4A 5CHMA 5AJGA 2Y4AA 1OT9A 2QWSA 4H9NA 1S1ZA 2Y2QA 2ZY5A 4UA9A 2PBDP 4KG6A 5EVIB 3MFXA 1P3FA 3S7QA 2CWEA 3WRZA 3B6GB 4I38A 2GJ3A 5GT3D 2PBYA 4OPQA 4J8UD 3Q7VA 3AZKC 3H82B 3KXBC 4R23A 3O62D 5GXQC 3SS4A 1CXWA 1J7MA 5E2HA 2H0TA 1YSQA 3AZNB 5M18A 2KX6A 2IOUA 2UV0E 1H8PA 4UA6A 4XUJD 3AZKA 5AV6C 3MXRA 4IBKA 4Z2IA 3IF6A 4MDZA 4Y2FA 3MGPA 1E6NA 1JWVA 1P9RA 2P08A 2KOIA 4JGRA 1Z09A 2P04A 3MFDA 4H9PA 5AV9B 1TS6A 2V1ZA 3UNWA 4UUZA 2JKTI 4X1MA 1M1AB 3VH5A 4J8UA 4RA7A 4J8XC 4QLCA 4E3JA 3LZ1B 5AV8B 2G2UA 5B2IB 5CRFA 4OP8A 1AOID 3W99B 1E25A 2HIOC 4MBHA 4R8PB 1L2SA 2XA7S 3BEBA 4GN2A 1WA9A 3AZNC 3B42A 4Z2JA 4WBGA 3UN7A 1KOUA 1XPBA 1YAXA 2WZXA 2HUEB 4R8PA 1O6IA 3BFFA 5GT0D 4QLCD 1TD5A 4ZBJB 3F1NA 4Z5TA 4Z2GA 4JF5A 2M7VA 4C6YA 3AZIB 3NQJA 1VEUB 1S6RA 1ERMA 1HTAA 1U35A 5FA7A 5HL6A 1KVLA 3F6TA 3B0BA 4CPKA 3V3SA 3KSHA 1FIKA 3T4LA 5B2ID 4Y13A 2Y91A 1H8MA 2YFWB 3PBRA 5C3IB 3MSHA 3C8CA 3BM6A 3UDFA 4YFMA 4QD4A 1XJ6A 1ES2A 4IHQA 1P97A 3TOIA 3BJNA 3D3OA 1P9WA 4OKPA 3IS2B 5GXQD 3X1VA 4IUKA 5AVBB 2R9XA 1K4FA 4LV0A 2R9WA 2HF6A 5TFQA 3T12B 4NYYA 3WX7A 3HJIA 3EEHA 1S4SA 2L0WA 3H7WA 1P3OA 3VFFA 5B40B 1RGYA 4WELA 4H6JB 1MKIA 2J7VA 5AQ7A 1B6WA 1OTIA 1K6SA 2NQBD 5CGXA 5GXQA 5AVBA 3REIC 3PAEA 3PAGA 1ED7A 1K4EA 4IBRA 5B31A 3NECA 5JRGD 3A3FA 1YLYA 3ULFA 1YU0A 2EX2A 1S32D 3LR3A 1SHVA 3REKC 5B31B 3W99D 4KQOA 3ZVWA 3I7JA 3DTIA 3UT9C 1NZUA 5LBRA 2WGWB 4Y3IA 1KX5A 3LICA 2PYRA 3LIEA 3Q1FA 4X1LA 1O7EA 3X1UA 3C5AA 4OPZA 3OBFA 1I2WA 1JFIB 3IF6B 1P3AB 5E5AD 3H0MC 2D02A 4JGPA 3REHD 2XR0A 5F99C 3BFCA 5MC7A 3SH9A 3WA9B 4HGAC 3M6BA 4Q0HA 2FZ0A 2NZDA 5AV5A 2QHKA 2FH5A 5B40D 1P3OC 4OJ5A 3KUYD 4BD0A 4FD8A 5JA4A 1PRQA 3AZEB 4R4RA 5GLAA 5A92A 4JF6A 3VOZA 4JPMA 3KUYC 2EX9A 4NETA 1BLPA 2WADA 4M4XA 4DRAA 5B40C 2HP9A 2AROA 1YLTA 3VOYA 5GL9A 1BT5A 5G49A 3LJAB 2ZC5B 5HDCA 1S0WA 4DJ3A 2G5HC 1ES4A 2K2NA 3A3IA 4J8WB 1VQQA 4R70A 4MEZA 3P5JB 5AY8B 3ITBA 4B9OA 4DE2A 4WV4B 3KXBA 3T1SA 3REKA 5AQ9A 4LRZE 1IELA 2QJ7A 3NHQA 2OLVA 1K0KA 1P3BA 2GDNA 1K54A 2G2WA 2HDQA 1LLBA 3A0RA 5A90A 3O62A 4KZAA 4X68A 5F99B 2Y59A 3HUOA 4OQHA 2L1MA 1DY6A 4B93A 2ZY3A 1P3AD 3A6NA 2XK1A 3T4JA 3HUNA 3LIDA 2WKQA 5A93A 5DTSA 3MGPC 3G31A 1NLZA 3H0LC 1PWGA 4B4XA 2FJ7A 4ZDXA 4LV2A 2Q0OA 4OJLA 3AZNA 3W4PA 1BULA 1XJ3A 4E3KA 3LELC 1QMEA 3F1PB 2HIOA 4DE1A 3B0CW 4DRBA 3NIAA 3MJQA 5I5LA 4Z5TC 5HX9A 2PAVP 4P0MA 3PR6A 2ZL1B 5GSUC 3TU4B 4OJOA 1ZG4A 3W98A 3EWKA 3O3VA 4F3LA 2F2AC 3HVFA 5AV9C 4NFTA 3Q82A 1LL9A 1XFNA 4DXBA 1E3UD 2CC1A 3B6GA 4Y0UA 4H9QA 4HY8A 3UO9A 3WD0A 1TF1A 2W27A 2ZQ8A 3LZ1C 2PR6A 4P6ZS 1LT0A
chains in the Genus database with same CATH topology
3IF5A 3AZKB 3EPKA 2ZM8A 4E3MA 4JXVA 1VM1A 3N3FA 5E2GA 2AROC 4UPKA 4DE3A 5CEDA 3NBLA 2IWBA 5EE8A 3AZMA 4HGAB 4ZJ2A 2HPBA 3FDDA 1K55C 4WU9C 3ZG0A 2DQNC 2NZDC 4EBNA 3AZHA 3N8RA 2Y2LA 4WEKA 5FI6A 1ZLAD 2QZ6A 1BH8A 5E5AC 3X1TD 2XH9A 4E3LA 5BO0A 1BH8B 1KDWA 5AVCA 3TU4C 2VGJA 3C1BC 2IO5B 3S22A 3MGQC 4R0QA 3L29A 2ZC3B 3UT9A 5GHXA 4KZ8A 3UPPA 5DNMB 2NQBA 3AFAB 5GT0B 1S32C 4S2OA 3RELD 5GT3C 5B0ZD 3X1TA 4F94A 5G18A 4IVKA 4X53A 1XA7A 2ZLYA 2HDUA 3W96A 2Z2LB 1FCOA 4KG5A 4KQRA 1YMXA 5F99A 4J8VD 3LZ0D 5JYPA 1HQ3D 3S4XA 5FQMA 5TGFA 4X23B 3CMZA 1P3MD 3HSHA 3LJAD 3AZGC 4IJFA 1P3BB 3LZ0C 4XZQC 1CEFA 4J8WD 5B0ZA 1WWIA 1P3LB 4KZ7A 3UTBC 3MZFA 4YM6B 4JXWA 1PW8A 3O86A 2ZM0A 3WRTA 4Z66D 4X69A 4P6BA 3X1SA 3C1BD 3NI9A 3SH7A 1M40A 5F82A 4WZ5A 4J8VB 4NZ1A 5FQIA 5IHVA 1M19D 5DNMD 3A6NC 5CPIC 5BNVB 3RELB 3R45B 1GCEA 1ZLAC 3KWQA 4LV3A 5AV5B 3S1YA 1P34D 2VQRA 1P3GB 1P3PC 1LI9A 4U0XA 1KX4A 3LZ1A 2RIQA 1KGFA 4H9OA 4J8UB 3FYZA 4Y0OA 3LZ0B 3AZND 5AV6B 4LD9D 3W98B 5AVBD 3ITAA 4CAYB 1H3OB 1W79A 4XZQA 3B0DB 2BG1A 2DNSA 4Z2MG 1P3FD 1PI4A 4E45A 5CPJD 1Z6FA 5FAQA 3VFHA 3AZEA 1TVFA 2RVQD 3X1VC 1MWTA 1NZOA 3HL9A 2BYMB 2DRWA 4XUJC 5L2FA 1FR1A 3AV1D 1ES5A 3NQJB 2FJ7B 2Y55A 5AY8C 1I5QA 3AZJB 3B6GD 5AV9D 1M19B 3G35A 3FWLA 3MVDC 4XXRA 3B0DC 3CJMA 4NY2A 3OPHA 4GH9A 1NRFA 1AOIB 1BLCA 2EXBA 3MVDA 4Z66B 4OPYA 5KMWA 2XLNA 3H0RC 1P3IC 1N4OA 4HBTA 3RJUA 4WNNA 5AVBC 3REIA 1FQGA 4H9PB 1PWCA 3Q7ZA 2BYKA 1EQZD 3GSGA 5U47A 4S2NA 3AZLB 3MGQB 4KUDA 3GVBA 1TZYD 5GT0A 2PYOB 3VMAA 1SKFA 2ZC7A 1ZG6A 3KSYA 1NJ4A 5BT1C 2WKEA 5B1LD 3CZDA 1DJAA 1U35D 3B6FC 4QLCB 3W97D 3C1CC 1IKGA 5B2IA 1K57C 4OPRA 1Z2CB 3WTPB 3WS5A 1EWZA 3KS4A 5CHJA 4X55A 4J8XA 2W8SA 3WTPA 5BS7C 3PTEA 1QMFA 3B0CT 3V50A 1PZRA 3W96D 4N1XA 3N6IA 4J8WC 4OONA 4PM7A 1P3OD 2I72A 4GB7A 2ZQDA 1HQ3A 5F83A 2Z2MB 4MNRA 2PU2A 3L25A 1KE3A 2X71A 5B2JB 5CPKC 5B24D 3WAAA 2DF4C 5B33D 1JTGA 4GOGA 5B2JC 2EXAA 2JC7A 1ES3A 5B0ZC 5KZHA 4WU9B 2Q9MA 1ALQA 1F66B 3REJB 1HZOA 3HLGA 2JE5A 1AXBA 4JJNC 3V5MA 5FUGB 4ZTKA 3TU4D 1ESIA 3WTPC 3REHB 4HEFA 3AN2D 5GLBA 3WA9D 4BD1A 3MGRD 3UDIA 1W8QA 4KZ4A 5JRGC 1K54C 1BUEA 2IO5C 3IH8A 4DQYB 3KUYB 4H9SA 5EVIA 3X1SB 3FZCA 3HLDA 4ZAMA 4YM6C 1NY0A 3WS2A 1P3PA 5FI7A 3G32A 1BSGA 1JWZA 1ID3C 2CV5B 3WWXA 3AN2A 1XP4A 4DDYA 1PIOA 3ZGAB 1JWPA 4H9NB 4IBBA 4JXGA 3ZCZA 3A3EA 1K38A 4BJPA 4PM8A 5B0YD 4R1GA 5BNVA 3RELA 4PMAA 1GA9A 3BECA 4QU3A 3IHAA 2Y2IA 3REJD 1WE4A 1YU1A 1W2EA 3OC2A 4N9LA 1YLZA 3VP1A 3AZHC 3MGQA 5GXQB 1IYOA 3FV7A 1KX4C 4J8WA 3MKEA 5HARA 3OPRA 4QLCC 5CPIA 2YFVB 3AZFA 4EWFA 2ZQAA 1XGIA 3PBTA 1L0EA 1EQZC 1W5DA 1ID3A 3X1VB 2HIOD 4IBFA 4P87A 4D2OA 1EQZA 1FSWA 3Q81A 3AZHB 1M19A 3UTAB 3MGPD 4KHAA 3WA9C 4RX3A 2EX6A 4B4ZA 3AZIA 3MVDD 3C4OA 2ZY2A 5AV6D 3A6NB 4JJND 1P3AC 1NYMA 4DKIA 3UTBB 5J8XA 1L0DA 3NQUA 4XUJA 3AZKD 3NDEA 4Q8IA 1W7FA 1WYCA 3JYIA 5HFOA 4X23C 1KE4A 3HLBA 2FFFB 1FR6A 2FJ7C 5CPKA 2NQBB 2Y2HA 3X1TB 4JJNA 2ZMAA 3M2JA 5GHYA 3RXWA 4IBIA 4WU8D 5B32C 3WKJA 5B1LA 4LG2A 4E3OA 3AV1A 5B24B 4EBPA 3G30A 3HLWA 5DTTA 2H0YA 1A7WA 4EQIA 3WS0A 2OLUA 5AQAA 1M18B 1ZKJA 1GHPA 4MBKA 1ZLAA 4KG2A 3C7UA 2XF3A 2B5RA 3VSLA 4UHUA 1OMEA 3D4FA 1CEGA 3W97C 5EOOA 3B6FD 1P3AA 4IBJA 2JSSA 4BLMA 4ZBEA 3VH5T 1IEMA 4Z66C 2XQZA 1P3LD 3AV2D 5GLDA 5HW3A 3Q07A 2ZQCA 4GD8A 1XX2A 3E2LA 5E43A 5JRGA 5FQ9A 4WU9A 4S2PA 1WYBA 4X6TA 1RP5A 4DE0A 3REKB 5B32A 4GHAA 3W99A 4J8XB 5CP6D 3LEZA 3MGSB 3IT9A 3W8KA 2WK0A 3N4IA 1LL5A 3BYDA 1M6KA 1HQ3B 4XUXA 4QY6A 2A49A 3HLEA 2HUEC 3V9RB 3BFEA 4G92B 3PBQA 4X23A 5GHZA 1P3KA 4EO5B 3AV1C 2X01A 5AVCC 3NY4A 3WS4A 3LY3A 5B2IC 3PBSA 3MGSC 1Q2QA 5F1FA 4R4SA 1P3IB 5DNND 4WJ3C 1EI5A 1P3KB 3FKVA 3HLFA 3IF6C 3TSGA 2NZDD 5FATA 1YLPA 3VH6A 2ZM5A 3UTAC 3DWKA 3Q7VB 2XGNA 2XD1A 4R3BA 3O88A 3ZDJA 3MGRB 3UTAD 3AYWA 1YQSA 2LY8A 5JYOA 4ZUXD 1AOIC 5DNNA 3AGFA 4AWLC 2AROD 3LELB 1TDGA 1BTLA 1CI9A 4U0TA 4LD9B 5B40A 5AV8A 2PYOA 4N92A 3VH5W 2Y2PA 3LELA 1M19C 5DNNB 1M18C 5KDMB 4UAAA 3AZID 1FSYA 4JBFA 4N9KA 4OLDA 1M18A 1K55A 3P09A 1EQZB 2C6WB 4KZ6A 3UE1A 2Y2MA 1MY8A 3KXBD 1KX3D 3AZJC 4J8UC 1IYQA 4S2JA 4OQ0A 4BL3A 4ZUXA 4CAYA 3OCNA 4RYEA 3AZLA 2J8YA 4Z5TD 1FOFA 2WKHA 3WKJC 3GQZA 1KX5B 1Y54A 4ZBJC 4L0LA 4GD6A 4YM6D 3HLCA 3DW0A 1YM1A 4J8VC 3NCKA 2WZZA 1BH9B 3N8LA 3X1SC 1ESUA 4ZUXB 2J8PA 2F8NK 5B2JA 3RELC 3ZG7B 3UDXA 3ZFZA 3NQUB 4XUJB 5HAQA 3WTPE 2NZDB 2HP6A 2WAEA 1HD8A 5DNMA 3IXGA 3NDGA 1IYSA 4WYYA 4CSRA 5AV5C 3AZLC 2RL3A 5DF8A 1U60A 3EPJA 1MWRA 3UT9B 5B2JD 5B33C 5B24C 3C1CA 5FI2A 3NC8A 1ZC2A 4R8PD 1C3BA 4A5RA 1J9MA 1K57A 4WU9D 3FKWA 4GDBA 4N1HA 3IQAA 2J9OA 4IBEA 1S32A 5CP6A 3PBNA 2ZC4B 3SS5A 1T3UA 1YLWA 1TAFB 3VH6W 2HP5A 5BS7A 1NYYA 4KUDC 5CPJB 4B88A 3AZJA 5B32D 1KX3B 3WKJB 4MLLA 5CGWA 4KGCB 3AL0C 1K56A 1P3LA 5AV6A 4R8PC 1YU4A 3CG5A 4GDNA 4X23D 4ID4A 1JTDA 3ZG5A 5CTNA 4OQIA 1M1AD 4OQGA 1KX4B 4GHLA 3AYWB 3LZ1D 4OOYA 4IBXA 1U35C 5AV5D 1DJCA 1KVMA 3SS3A 5B33B 4JLFA 5D3OA 4PPRA 1MWSA 1P3MA 3A1KA 3UT9D 3MNNC 1KDSA 4KQQA 1TZYC 1Q9CA 4XZQB 3KS8A 1ERQA 3C1BB 4YS3A 3VP2A 2J9PA 1M1AA 5M19A 1R4VA 3M6HA 3VP0A 2X02A 4H9OB 3G2ZA 5BOHA 2XFSA 3REID 4WEJA 5FAOA 4H9SC 5EVIC 2BYMA 4OLGA 5JRGB 5B0YB 1ID3B 2Y2JA 1SDNA 3AZGA 1TEMA 3G34A 2DCFA 5CGSA 1GHIA 1KGGA 3RXXA 3AYWC 1IKIA 3REHA 2Q9NA 2WAFA 1KX3C 4EUZA 3GV9A 2YFWA 1KX4D 1PZOA 4NE5A 3MKFA 4KHAB 3LY4A 1G6AA 5FAPA 1H5XA 1M1AC 1P3KC 4YINA 2EX8A 1MBLA 2WGVA 1XXMA 4OJPA 5DF9A 2F8NH 3VH6T 1N1JA 3HBRA 3ZVTA 4E3IA 2RCXA 1P3FC 3AZED 2P9VB 5GT0C 3MVDB 3W96B 2HDRA 2HDSA 1F66A 1P34B 1P3GD 3LCEA 4IBCA 4LD9C 5E5AA 1H8YA 4H8RA 4WNNB 3W4QA 2PU4A 1RGZA 4H9RB 2UWXA 1ID3D 2WKIA 1P34A 3UPNA 1W8YA 3MBZA 4WZSB 1E4DA 4OVDA 3A6ND 1F66D 2HIOB 3C4PA 3PBOA 4X56A 3HUMA 3AFAC 5DVAA 4KZ3A 3MGRC 3AN2C 5AQBA 3VSKA 3WTPD 3WA9A 3AN2B 3IWQA 2ZM2A 5EECA 5I94A 5GLCA 3O62C 3MZDA 3X1UB 3UTAA 2WYXA 1LHYA 3EG5B 3X1SD 3C1BA 1B67A 4WU8A 4KZ9A 2WUQA 4NE3A 5B33A 5BO0B 5B31G 2NQBC 3UTBA 1YU3A 1KE0A 1P3MC 4ZJ3A 3TG9A 1HQ3C 3W4OA 3L28A 4KGCD 3W96C 4G92C 1RCJA 1CI8A 1ULYA 4IBGA 1YLJA 4IVIA 1ONGA 1S32B 3KWQB 3MGQD 4YS3B 5CEBA 3AZIC 5CERA 3UY6A 4PM5A 4GKUA 2F8NG 3SOIA 5CPJA 2G5IC 5BNXA 1GHMA 1JVJA 2XD5A 1H8ZA 1YU2A 3WS1A 3W97A 1F66C 1BLSA 3UE0A 2IWDA 5AV8C 3X1UD 4OP5A 4CSRB 1KX5C 4S2MA 4GZBA 4E3NA 5CHLB 3IHBA 1Q2PA 1IYPA 3AV2A 4ZJ1A 3HONA 5EOEA 1XKZA 3QNCA 4KENB 5AY8A 1P3GC 1P3PB 2ZQ9A 4IEDA 1MWUA 4DXCA 2BLSA 4K91A 4RX2A 3KUYA 4WM9A 1K6RA 5B1MC 4OJ6A 5DNNC 1BZAA 2V20A 4QNLA 2ZY4A 3O87A 5B32G 2QMIA 2FJ7D 5B1MA 2OV5A 3AZMD 3G4PA 4XUZA 1P3KD 2F8ND 2A3UA 4NZ5A 5AVCD 5CPIB 3A3JA 3OZHA 3B6GC 1PZPA 1HTZA 3ISGA 5AY8D 4KZ5A 1SDEA 4OOMA 4EV4A 3GR2A 2Y2KA 5FDHA 3R45A 1FCNA 3TU4A 5CECA 5G49B 3LJAA 3MXSA 4LV1A 5GSUD 4MBFA 1FCMA 3OPPA 3MGRA 4U3TA 3AZGB 5E2FA 3X1VD 1YUEA 3OPLA 4Y7PA 1PWDA 4WMCA 1K56D 2RVQC 5B0YA 3G2YA 4S2NC 5EVID 1BH9A 3BLSA 2Y2OA 1O07A 1KGEA 3SH8A 4FCFA 3IWOA 3DWZA 3EQUA 3AV2C 1CK3A 1U35B 5KSHA 1P3LC 3L27A 3EQVA 4Z66A 4Z5TB 3X1UC 5AVCB 5CPID 4QHCA 5DNMC 4NE6A 3AZHD 3P98A 2H5SA 5BNXB 3GTCA 3KXBB 4P85A 3GRJA 3REJC 1ONHA 4CJNA 5GT3A 4JJNB 3REJA 1N9BA 1P3OB 2F8NB 2WGWA 3UTBD 3AZFD 5B0YC 4KUDD 4DF6A 3UPOA 1TAFA 4HESA 5BPVA 4KGCC 4IBDA 5E2EA 1AOIA 4XZQD 4WU8C 4IJEA 3LJAC 2H10A 2ZQ7A 1I2SA 3ZNYA 5CXWA 2XFTA 4QJGA 3B6FB 5KDMA 4WZ5C 4S2KA 5F99D 4J8VA 5C3IC 1P3BD 4DDSA 1MXOA 1YMSA 5CHUA 3QHYA 4LCMA 1SCWA 5EUAA 3OCLA 2E8IA 4S2IA 5HAPA 2L5AA 3MGPB 4WZ4A 3AV2B 4KUDB 3ZNTA 1ZLAB 5AV9A 2Y2NA 3W99C 4K0WA 5B32B 3ZG9B 1PYYA 4M6BA 1HVBA 3AFAD 3WAAB 1BLHA 3X1TC 4JKTA 4AWLB 4FSFA 4PM6A 3WAAC 4O7DA 5CPKD 2ZC6B 5FUGA 5HL1A 5CTMA 4PM9A 4NYUA 1LI0A 3FKEA 2AROB 3BRMA 1KU5A 4UUZB 3E2KA 4FH4A 2PYOC 1XGJA 3WKJD 3LZ0A 3IWIA 4OH0A 4YS3C 3AFAA 3KWQC 1WWSA 4DRTA 3IXHA 5FQQA 2JCHA 3AZFC 3W98D 2CV5D 3AZEC 4RVAA 3AZJD 1K25A 5FASA 4E6WA 1P3MB 2YFVA 3AZFB 3M2KA 4EBLA 3W97B 3MZEA 2EFUA 3VP3A 3IP4C 2P74A 3V39A 3MNNB 2XEPA 3BLMA 1M18D 5GSUB 1E3UA 5TR7A 3UE3A 3KFUG 2CV5A 1G68A 5DTKA 4G91C 1L0GA 4NZ4A 5F1GA 5EVLA 3QNBA 4KGCA 1P3IA 5BT1D 3ZG8B 4Z2MH 3IXBA 2CV5C 3W98C 3AYWD 4ZUXC 3MNNA 3REIB 3KWQD 2OSUA 2P9VA 4BENA 5B1MB 4YS3D 4QY5A 4GNUA 5M1AA 3ZHHA 2PYOD 1EROA 3LELD 5FSRA 1F1EA 2WGIA 2C5WB 5DF7A 1P3ID 4Z9QA 5B24A 3WAAD 2ZJ9A 4J8XD 5E5AB 3A1IA 1TDLA 1P3FB 4JF4A 4H9RA 3MGSD 4H9QB 2BYKB 5CPKB 2IWCA 4E6XA 4Y0TA 3A3DA 3N7WA 4WMCD 4K0XA 2FFYA 3MNND 5B0ZB 3DTMA 4OOLA 1DJBA 3V3RA 4OUIA 3IH9A 1PI5A 4M3KA 1L0FA 4LENA 1NXYA 1GA0A 1P3BC 3AZMC 4WU8B 1JFIA 4NK3A 5HAIA 3AV1B 3AGDA 3AZMB 5A91A 3VP4A 2Y2GA 3MGSA 5B1MD 1PW1A 2ZD8A 5CPJC 3HREA 4S2LA 4QB8A 5CP6C 2JBFA 1P3GA 3LO7A 1MPLA 3L26A 4LCLA 4EO5C 1XA1A 1N1JB 2QPNA 4C3QA 2F8NA 1BFMA 1P34C 1P3PD 5B31D 1KX5D 5GT3B 1H3OA 3L2AA 5FQKA 5AV8D 3REHC 3C1CD 4UA7A 1TZYA 1YT4A 3C7VA 4R3JA 2VGKA 5B1LB 3BFGA 3AZLD 3IXDA 1TZYB 5GSUA 3B3XA 5FQJA 4NZ3A 4KZBA 5B1LC 5JA4B 3GMWA 2V2FF 4FH2A 5B31C 4YM6A 2EFXA 4JXSA 5EPHA 3V9RA 2XDMA 3REKD 3O62B 3N8SA 5CP6B 4HBUA 4E44A 3EPHA 4BQMA 3AGEA 4G91B 3BFDA 5KSCA 4C75A 3EPLA 3C1CB 3AZGD 4LD9A 4BL2A 1KX3A 3B6FA 5CHMA 2Y4AA 4H9NA 2Y2QA 2ZY5A 4UA9A 4KG6A 5EVIB 1P3FA 2CWEA 3WRZA 3B6GB 5GT3D 2PBYA 4OPQA 4J8UD 3Q7VA 3AZKC 3KXBC 4R23A 3O62D 5GXQC 3SS4A 5E2HA 2H0TA 3AZNB 5M18A 2IOUA 4UA6A 4XUJD 3AZKA 5AV6C 3MXRA 4IBKA 3IF6A 3MGPA 1JWVA 3MFDA 4H9PA 5AV9B 2V1ZA 3UNWA 4UUZA 1M1AB 3VH5A 4J8UA 4RA7A 4J8XC 4QLCA 4E3JA 3LZ1B 5AV8B 2G2UA 5B2IB 5CRFA 4OP8A 1AOID 3W99B 1E25A 2HIOC 4MBHA 4R8PB 1L2SA 3BEBA 4GN2A 3AZNC 4WBGA 3UN7A 1XPBA 2WZXA 2HUEB 4R8PA 3BFFA 5GT0D 4QLCD 4ZBJB 4Z5TA 4JF5A 4C6YA 3AZIB 3NQJA 1S6RA 1ERMA 1HTAA 1U35A 5FA7A 1KVLA 3F6TA 3B0BA 4CPKA 3V3SA 5B2ID 2Y91A 2YFWB 3PBRA 5C3IB 3BM6A 3UDFA 4YFMA 4QD4A 1ES2A 3TOIA 4OKPA 5GXQD 3X1VA 5AVBB 2R9XA 1K4FA 4LV0A 2R9WA 5TFQA 4NYYA 3WX7A 1P3OA 3VFFA 5B40B 1RGYA 4WELA 1MKIA 2J7VA 5AQ7A 1B6WA 1K6SA 2NQBD 5CGXA 5GXQA 5AVBA 3REIC 3PAEA 3PAGA 1K4EA 4IBRA 5B31A 5JRGD 3A3FA 1YLYA 1YU0A 2EX2A 1S32D 1SHVA 3REKC 5B31B 3W99D 4KQOA 3ZVWA 3I7JA 3UT9C 1NZUA 2WGWB 1KX5A 3Q1FA 1O7EA 3X1UA 3C5AA 4OPZA 1I2WA 1JFIB 3IF6B 1P3AB 5E5AD 3H0MC 3REHD 2XR0A 5F99C 3BFCA 3SH9A 3WA9B 4HGAC 3M6BA 2NZDA 5AV5A 5B40D 1P3OC 4OJ5A 3KUYD 4BD0A 4FD8A 5JA4A 3AZEB 4R4RA 5GLAA 5A92A 4JF6A 3VOZA 4JPMA 3KUYC 4NETA 2EX9A 2WADA 1BLPA 4DRAA 5B40C 2HP9A 2AROA 1YLTA 3VOYA 5GL9A 1BT5A 5G49A 3LJAB 2ZC5B 1S0WA 2G5HC 1ES4A 3A3IA 4J8WB 1VQQA 4MEZA 3P5JB 5AY8B 3ITBA 4DE2A 4WV4B 3KXBA 3REKA 5AQ9A 1IELA 2OLVA 1P3BA 2GDNA 1K54A 2G2WA 2HDQA 1LLBA 5A90A 3O62A 4KZAA 4X68A 5F99B 2Y59A 3HUOA 4OQHA 1DY6A 2ZY3A 1P3AD 3A6NA 2XK1A 3HUNA 5A93A 5DTSA 3MGPC 3G31A 3H0LC 1PWGA 4B4XA 2FJ7A 4ZDXA 4LV2A 4OJLA 3AZNA 3W4PA 1BULA 4E3KA 3LELC 1QMEA 2HIOA 4DE1A 3B0CW 4DRBA 3NIAA 4Z5TC 5HX9A 4P0MA 5GSUC 3TU4B 4OJOA 1ZG4A 3W98A 3O3VA 2F2AC 3HVFA 5AV9C 4NFTA 3Q82A 1LL9A 4DXBA 1E3UD 2CC1A 3B6GA 4Y0UA 4H9QA 3UO9A 2ZQ8A 3LZ1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YIN A;  3IF5 A;  2EX8 A;  1MBL A;  2WGV A;  4Z9Q A;  1XXM A;  1FSW A;  2ZJ9 A;  3Q81 A;  5DF9 A;  2ZM8 A;  1TDL A;  4E3M A;  4JF4 A;  3HBR A;  3ZVT A;  4E3I A;  4JXV A;  2RCX A;  2IWC A;  1VM1 A;  4E6X A;  5E2G A;  4Y0T A;  4RX3 A;  3A3D A;  3N7W A;  2EX6 A;  2P9V B;  4B4Z A;  4DE3 A;  2HDR A;  3C4O A;  4K0X A;  4WMC D;  2FFY A;  2HDS A;  5CED A;  3DTM A;  3NBL A;  4OOL A;  1NYM A;  3LCE A;  2IWB A;  4DKI A;  5EE8 A;  1DJB A;  4ZJ2 A;  5J8X A;  2HPB A;  1H8Y A;  4H8R A;  3V3R A;  1K55 C;  3W4Q A;  1L0D A;  3IH9 A;  2PU4 A;  1RGZ A;  1PI5 A;  2UWX A;  4M3K A;  1L0F A;  3ZG0 A;  2WKI A;  3NDE A;  4LEN A;  4Q8I A;  1NXY A;  3UPN A;  4EBN A;  1W7F A;  3N8R A;  1GA0 A;  2Y2L A;  1WYC A;  3JYI A;  4WEK A;  5HFO A;  4NK3 A;  5HAI A;  1KE4 A;  3HLB A;  5FI6 A;  1W8Y A;  2FFF B;  1FR6 A;  2QZ6 A;  3AGD A;  3MBZ A;  1E4D A;  4OVD A;  5A91 A;  2Y2H A;  3VP4 A;  2Y2G A;  2XH9 A;  4E3L A;  3C4P A;  3PBO A;  4X56 A;  2ZMA A;  3HUM A;  3M2J A;  5GHY A;  5DVA A;  3RXW A;  1PW1 A;  2ZD8 A;  4KZ3 A;  3HRE A;  4S2L A;  4QB8 A;  1KDW A;  5AQB A;  3VSK A;  2JBF A;  2VGJ A;  3S22 A;  4E3O A;  3LO7 A;  1MPL A;  4R0Q A;  4LCL A;  3IWQ A;  2ZM2 A;  2ZC3 B;  5GHX A;  4KZ8 A;  5EEC A;  3UPP A;  4EBP A;  3G30 A;  3HLW A;  5DTT A;  1XA1 A;  2H0Y A;  5I94 A;  5GLC A;  3MZD A;  4S2O A;  2QPN A;  2WYX A;  4C3Q A;  4EQI A;  4F94 A;  3WS0 A;  5G18 A;  4IVK A;  1LHY A;  4X53 A;  2OLU A;  2ZLY A;  1XA7 A;  5AQA A;  1ZKJ A;  2HDU A;  1GHP A;  4MBK A;  2Z2L B;  1FCO A;  4KZ9 A;  4KG2 A;  3C7U A;  2XF3 A;  2WUQ A;  5FQK A;  4KG5 A;  1YMX A;  4KQR A;  2B5R A;  4UA7 A;  5JYP A;  1YT4 A;  3S4X A;  4UHU A;  1OME A;  3VSL A;  3D4F A;  1CEG A;  1KE0 A;  5EOO A;  3C7V A;  4R3J A;  4ZJ3 A;  2VGK A;  5FQM A;  3BFG A;  5TGF A;  3TG9 A;  3IXD A;  3CMZ A;  3W4O A;  3B3X A;  5FQJ A;  4KZB A;  1CEF A;  3GMW A;  4BLM A;  4ZBE A;  2V2F F;  4FH2 A;  1IEM A;  2XQZ A;  1RCJ A;  1CI8 A;  4KZ7 A;  2EFX A;  4JXS A;  5EPH A;  5GLD A;  5HW3 A;  3MZF A;  3Q07 A;  2ZQC A;  2XDM A;  4GD8 A;  1XX2 A;  3E2L A;  3N8S A;  4JXW A;  4HBU A;  1YLJ A;  1PW8 A;  4IVI A;  5E43 A;  4BQM A;  1ONG A;  3AGE A;  3O86 A;  3BFD A;  2ZM0 A;  5KSC A;  3WRT A;  5FQ9 A;  5CEB A;  4X69 A;  4P6B A;  5CER A;  3SH7 A;  3NI9 A;  3UY6 A;  4S2P A;  4C75 A;  1WYB A;  1M40 A;  1RP5 A;  4GKU A;  4X6T A;  5F82 A;  4DE0 A;  4PM5 A;  4WZ5 A;  3SOI A;  1GHM A;  1JVJ A;  3LEZ A;  2XD5 A;  5FQI A;  1H8Z A;  4BL2 A;  3IT9 A;  5CHM A;  3WS1 A;  5IHV A;  3W8K A;  2WK0 A;  2Y4A A;  1BLS A;  2Y2Q A;  3N4I A;  4UA9 A;  1LL5 A;  3UE0 A;  2IWD A;  1GCE A;  4OP5 A;  4KG6 A;  5EVI B;  3BYD A;  1M6K A;  4LV3 A;  3S1Y A;  3WRZ A;  1LI9 A;  4S2M A;  4U0X A;  4XUX A;  4QY6 A;  4GZB A;  1KGF A;  2A49 A;  4E3N A;  3IHB A;  1Q2P A;  1IYP A;  2PBY A;  3FYZ A;  3HLE A;  3Q7V A;  4OPQ A;  4Y0O A;  4ZJ1 A;  5EOE A;  1XKZ A;  4R23 A;  3BFE A;  3SS4 A;  5E2H A;  2H0T A;  3PBQ A;  3QNC A;  4KEN B;  5GHZ A;  5M18 A;  2X01 A;  4UA6 A;  2ZQ9 A;  4IED A;  3ITA A;  1MWU A;  4DXC A;  3MXR A;  3NY4 A;  2BLS A;  4K91 A;  4RX2 A;  3WS4 A;  1W79 A;  2DNS A;  3IF6 A;  2BG1 A;  3LY3 A;  4WM9 A;  1JWV A;  1PI4 A;  1K6R A;  1Z6F A;  3PBS A;  5FAQ A;  3VFH A;  1BZA A;  3MFD A;  1Q2Q A;  2V20 A;  5F1F A;  1TVF A;  2V1Z A;  3UNW A;  4R4S A;  3O87 A;  4RA7 A;  2QMI A;  4E3J A;  5HL1 A;  1MWT A;  1NZO A;  2OV5 A;  2G2U A;  1EI5 A;  3G4P A;  4XUZ A;  5CRF A;  3FKV A;  3HL9 A;  3HLF A;  4OP8 A;  2A3U A;  3IF6 C;  3TSG A;  1E25 A;  2DRW A;  1YLP A;  3A3J A;  4MBH A;  5FAT A;  3DWK A;  3OZH A;  5L2F A;  3Q7V B;  1FR1 A;  1L2S A;  1PZP A;  3BEB A;  1ES5 A;  1HTZ A;  4GN2 A;  3ISG A;  2Y55 A;  4KZ5 A;  1SDE A;  2XGN A;  2XD1 A;  1I5Q A;  4OOM A;  4EV4 A;  3GR2 A;  4R3B A;  3O88 A;  4WBG A;  3ZDJ A;  3UN7 A;  1XPB A;  2Y2K A;  2WZX A;  5FDH A;  1YQS A;  1FCN A;  3G35 A;  3FWL A;  5CEC A;  3BFF A;  3MXS A;  4LV1 A;  5JYO A;  4XXR A;  4MBF A;  1FCM A;  3AGF A;  3OPP A;  4U3T A;  1TDG A;  3CJM A;  3OPH A;  1BTL A;  4JF5 A;  1CI9 A;  1NRF A;  4U0T A;  5E2F A;  4C6Y A;  1BLC A;  2EXB A;  3OPL A;  4Y7P A;  1PWD A;  4N92 A;  4WMC A;  1K56 D;  1S6R A;  1ERM A;  2Y2P A;  5FA7 A;  3G2Y A;  1KVL A;  4OPY A;  4CPK A;  5KMW A;  3V3S A;  4S2N C;  2XLN A;  5EVI D;  2Y91 A;  1N4O A;  4UAA A;  3PBR A;  3BLS A;  4HBT A;  1FSY A;  3RJU A;  4JBF A;  2Y2O A;  4N9K A;  1O07 A;  3BM6 A;  3UDF A;  4YFM A;  1FQG A;  4OLD A;  4QD4 A;  1ES2 A;  1K55 A;  3P09 A;  1PWC A;  3Q7Z A;  2C6W B;  4KZ6 A;  3TOI A;  2Y2M A;  1KGE A;  1MY8 A;  3GSG A;  4OKP A;  5U47 A;  3UE1 A;  3SH8 A;  2R9X A;  4FCF A;  1K4F A;  4S2N A;  1IYQ A;  4S2J A;  3IWO A;  3DWZ A;  2R9W A;  3EQU A;  4LV0 A;  4OQ0 A;  1CK3 A;  3GVB A;  4BL3 A;  5TFQ A;  5KSH A;  3VMA A;  3OCN A;  1SKF A;  2ZC7 A;  1ZG6 A;  3EQV A;  4RYE A;  1NJ4 A;  2J8Y A;  2WKE A;  1FOF A;  2WKH A;  3VFF A;  3CZD A;  1RGY A;  3GQZ A;  4WEL A;  4QHC A;  1DJA A;  1Y54 A;  4L0L A;  4GD6 A;  1MKI A;  2J7V A;  3P98 A;  5AQ7 A;  2H5S A;  1K6S A;  3HLC A;  3DW0 A;  5CGX A;  1YM1 A;  3NCK A;  1IKG A;  2WZZ A;  3GTC A;  3PAE A;  4P85 A;  3GRJ A;  3PAG A;  3N8L A;  1ESU A;  1K4E A;  1K57 C;  4IBR A;  1ONH A;  4OPR A;  4CJN A;  3WS5 A;  1EWZ A;  4D2O A;  3A3F A;  1YLY A;  1N9B A;  2EX2 A;  5CHJ A;  1SHV A;  3ZG7 B;  3UDX A;  4X55 A;  3ZFZ A;  5HAQ A;  2WGW A;  4KQO A;  3ZVW A;  2HP6 A;  2WAE A;  3PTE A;  3I7J A;  4DF6 A;  3UPO A;  1QMF A;  1NZU A;  3V50 A;  4HES A;  2WGW B;  1HD8 A;  4N1X A;  3N6I A;  4OON A;  3IXG A;  3NDG A;  5E2E A;  4PM7 A;  3Q1F A;  1IYS A;  1O7E A;  2I72 A;  3C5A A;  4GB7 A;  4WYY A;  2ZQD A;  5F83 A;  4OPZ A;  2Z2M B;  4MNR A;  2PU2 A;  2ZQ7 A;  1I2W A;  2H10 A;  1I2S A;  2RL3 A;  5DF8 A;  1KE3 A;  2X71 A;  1U60 A;  3IF6 B;  3ZNY A;  5CXW A;  1MWR A;  2XFT A;  4QJG A;  2XR0 A;  3BFC A;  4WZ5 C;  3SH9 A;  4S2K A;  5FI2 A;  3NC8 A;  1JTG A;  4GOG A;  1ZC2 A;  3M6B A;  2EXA A;  1C3B A;  4DDS A;  2JC7 A;  1MXO A;  1YMS A;  4A5R A;  1ES3 A;  5CHU A;  1J9M A;  1K57 A;  5KZH A;  3QHY A;  3FKW A;  4LCM A;  4GDB A;  1SCW A;  2Q9M A;  4N1H A;  3IQA A;  5EUA A;  1ALQ A;  2J9O A;  3OCL A;  1HZO A;  2E8I A;  4S2I A;  5HAP A;  3HLG A;  3PBN A;  2ZC4 B;  3SS5 A;  4WZ4 A;  4BD0 A;  4FD8 A;  3ZNT A;  2JE5 A;  1YLW A;  1AXB A;  2HP5 A;  4R4R A;  3V5M A;  1NYY A;  5GLA A;  4ZTK A;  2Y2N A;  4JF6 A;  3VOZ A;  1ESI A;  5A92 A;  4B88 A;  4HEF A;  2EX9 A;  4JPM A;  4NET A;  4K0W A;  3ZG9 B;  1BLP A;  2WAD A;  1PYY A;  5GLB A;  2HP9 A;  4BD1 A;  1YLT A;  1HVB A;  3UDI A;  3VOY A;  5GL9 A;  1BT5 A;  1W8Q A;  2ZC5 B;  4KZ4 A;  4MLL A;  5CGW A;  1S0W A;  1K54 C;  1BLH A;  1ES4 A;  3A3I A;  1BUE A;  1VQQ A;  1K56 A;  4MEZ A;  3ITB A;  4JKT A;  3CG5 A;  3IH8 A;  4FSF A;  4PM6 A;  4DE2 A;  4O7D A;  4GDN A;  5AQ9 A;  5EVI A;  2ZC6 B;  1IEL A;  2OLV A;  4ID4 A;  1JTD A;  3FZC A;  3HLD A;  4PM9 A;  4OQI A;  5CTN A;  5CTM A;  3ZG5 A;  2GDN A;  4ZAM A;  1NY0 A;  1LI0 A;  1K54 A;  2G2W A;  4OQG A;  5FI7 A;  3WS2 A;  2HDQ A;  3G32 A;  1BSG A;  1JWZ A;  3BRM A;  4IBX A;  4OOY A;  3E2K A;  1LLB A;  4FH4 A;  1XGJ A;  3WWX A;  1DJC A;  5A90 A;  1XP4 A;  1KVM A;  1PIO A;  4KZA A;  3SS3 A;  3IWI A;  4OH0 A;  3ZGA B;  4X68 A;  4JLF A;  4DDY A;  2Y59 A;  3HUO A;  1JWP A;  4OQH A;  5D3O A;  1DY6 A;  4JXG A;  4PPR A;  3A3E A;  3ZCZ A;  4DRT A;  1MWS A;  3IXH A;  1KDS A;  1K38 A;  4BJP A;  4PM8 A;  4KQQ A;  2XK1 A;  5FQQ A;  2JCH A;  3HUN A;  5A93 A;  5DTS A;  4RVA A;  1K25 A;  5FAS A;  4R1G A;  4E6W A;  1ERQ A;  4PMA A;  3M2K A;  3VP2 A;  2J9P A;  4EBL A;  1GA9 A;  3G31 A;  5M19 A;  3M6H A;  3BEC A;  3MZE A;  3VP0 A;  2EFU A;  3IHA A;  4QU3 A;  3VP3 A;  2X02 A;  3G2Z A;  2Y2I A;  2P74 A;  3V39 A;  1PWG A;  2XEP A;  1WE4 A;  4B4X A;  5BOH A;  2XFS A;  3BLM A;  3OC2 A;  4LV2 A;  4ZDX A;  4N9L A;  4WEJ A;  1YLZ A;  1BUL A;  5FAO A;  3W4P A;  5EVI C;  1E3U A;  3VP1 A;  4OLG A;  5TR7 A;  4E3K A;  3UE3 A;  1QME A;  2Y2J A;  1IYO A;  1G68 A;  3FV7 A;  5DTK A;  4DE1 A;  1L0G A;  1SDN A;  5F1G A;  3NIA A;  5EVL A;  3QNB A;  1TEM A;  3G34 A;  3ZG8 B;  3MKE A;  5HX9 A;  2DCF A;  5HAR A;  3OPR A;  4P0M A;  5CGS A;  3IXB A;  1GHI A;  1KGG A;  3RXX A;  1IKI A;  1ZG4 A;  2Q9N A;  2WAF A;  4EWF A;  3O3V A;  2ZQA A;  1XGI A;  3HVF A;  2OSU A;  2P9V A;  3Q82 A;  4BEN A;  3PBT A;  1L0E A;  4QY5 A;  4GNU A;  1LL9 A;  5M1A A;  4DXB A;  3GV9 A;  3ZHH A;  4EUZ A;  1W5D A;  1E3U D;  1PZO A;  1ERO A;  2CC1 A;  3MKF A;  4Y0U A;  3UO9 A;  3LY4 A;  5FSR A;  2ZQ8 A;  1G6A A;  2WGI A;  4P87 A;  5FAP A;  2C5W B;  1H5X A;  5DF7 A; 
#chains in the Genus database with same CATH topology
 1CK7 A;  5IT5 A;  3IF5 A;  4MMN A;  4LFU A;  2Z6C A;  1OTB A;  1OTD A;  3AZK B;  3EPK A;  2ZM8 A;  1OGG A;  2P7J A;  4E3M A;  3E4O A;  1E6R A;  4JXV A;  5HPI A;  2O9B A;  1VM1 A;  3N3F A;  5E2G A;  2ARO C;  4UPK A;  4DE3 A;  1PDC A;  5CED A;  3NBL A;  2IWB A;  4I5S A;  5EE8 A;  3AZM A;  4HGA B;  4ZJ2 A;  2HPB A;  3FDD A;  1K55 C;  4WU9 C;  3ZG0 A;  2DQN C;  3QP5 A;  2NZD C;  3LR5 A;  4EBN A;  3AZH A;  1OTE A;  3N8R A;  2Y2L A;  1UWN X;  5EVE A;  4WEK A;  4WN5 A;  2XSS A;  4HOI A;  5FI6 A;  1ZLA D;  2QZ6 A;  1BH8 A;  2W3F A;  5E5A C;  3LIB A;  3X1T D;  2XH9 A;  4E3L A;  3MS6 A;  4HH2 A;  3FG8 A;  1GSV A;  3MQL A;  5BO0 A;  1LL8 A;  1OT6 A;  1BH8 B;  1KDW A;  5AVC A;  3TU4 C;  2VGJ A;  3C1B C;  2IO5 B;  3S22 A;  3MGQ C;  5K5B A;  4R0Q A;  1CF0 A;  3L29 A;  2ZC3 B;  3RH8 B;  5FEG A;  3UT9 A;  3GDI A;  5GHX A;  4KZ8 A;  3UPP A;  5DNM B;  2NQB A;  3AFA B;  5GT0 B;  1S32 C;  4S2O A;  3REL D;  5GT3 C;  5EM1 A;  5B0Z D;  3X1T A;  4F94 A;  5G18 A;  4IVK A;  1L6J A;  4X53 A;  1XA7 A;  2ZLY A;  2HDU A;  3W96 A;  4Z2K A;  1W1T A;  1T1A A;  2Z2L B;  1FCO A;  4KG5 A;  1YMX A;  5F99 A;  4J8V D;  4KQR A;  3LZ0 D;  5JYP A;  1HQ3 D;  3S4X A;  2PD8 A;  4HQA A;  5FQM A;  1FIL A;  5TGF A;  4X23 B;  3CMZ A;  1P3M D;  3HSH A;  3LJA D;  3AZG C;  4IJF A;  4HMD A;  1P3B B;  3LZ0 C;  4XZQ C;  3C30 A;  1CEF A;  4J8W D;  5B0Z A;  1WWI A;  2VX8 A;  1F5M A;  1P3L B;  4KZ7 A;  3UTB C;  3MZF A;  5L10 A;  4YM6 B;  4JXW A;  3T1R A;  1PW8 A;  3O86 A;  4NXE A;  2ZM0 A;  1TS0 A;  3WRT A;  1QO6 A;  4Z66 D;  4X69 A;  4P6B A;  3X1S A;  3C1B D;  2ZOI A;  3NI9 A;  3QP2 A;  3SH7 A;  1M40 A;  5F82 A;  4WZ5 A;  4J8V B;  4NZ1 A;  5FQI A;  5IHV A;  1M19 D;  5DNM D;  1OTA A;  3A6N C;  5CPI C;  3S7N A;  5BNV B;  3REL B;  3R45 B;  1GCE A;  3BW6 A;  1ZLA C;  3KWQ A;  4LV3 A;  5AV5 B;  1ODV A;  3S1Y A;  1P34 D;  2VQR A;  1P3G B;  1P3P C;  1LI9 A;  4U0X A;  1KX4 A;  3LZ1 A;  2RIQ A;  1KGF A;  4H9O A;  3C38 A;  4J8U B;  3FYZ A;  4Y0O A;  1LSV A;  5HWW A;  3LZ0 B;  3AZN D;  3S7O A;  2OOL A;  5AV6 B;  4LD9 D;  3W98 B;  3WD1 A;  4F3L B;  5AVB D;  3BY9 A;  3ITA A;  4CAY B;  1H3O B;  1W79 A;  4XZQ A;  3B0D B;  2BG1 A;  2DNS A;  4Z2M G;  1P3F D;  1PI4 A;  4E45 A;  5CPJ D;  1Z6F A;  5FAQ A;  3VFH A;  2A2L A;  3AZE A;  1TVF A;  2A24 A;  2RVQ D;  2VGL M;  3X1V C;  1MWT A;  1NZO A;  5HPF A;  3K3C A;  3HL9 A;  1F9I A;  2BYM B;  2ACG A;  2DRW A;  2HZ5 A;  4XUJ C;  5L2F A;  1FR1 A;  3BQA A;  3AV1 D;  1ES5 A;  3NQJ B;  2FJ7 B;  2Y55 A;  5AY8 C;  1NWZ A;  2VJW A;  1I5Q A;  3AZJ B;  3B6G D;  5AV9 D;  1G6O A;  1P0Z A;  1M19 B;  3G35 A;  3FWL A;  3MVD C;  4WL9 A;  2YKF A;  4XXR A;  2VV7 A;  1AWI A;  3B0D C;  2HV1 A;  2PYP A;  3CJM A;  4NY2 A;  3OPH A;  4GH9 A;  1NRF A;  1AOI B;  1BLC A;  2EXB A;  3MVD A;  1GPF A;  4LLO B;  4Z66 B;  4OPY A;  4NEE D;  3EOI A;  3NUL A;  5KMW A;  2XLN A;  3H0R C;  1GOI A;  4EU0 A;  1P3I C;  1XJ2 A;  1N4O A;  5HD5 A;  1E15 A;  4HBT A;  3RJU A;  4WNN A;  3L9K A;  5AVB C;  3REI A;  1FQG A;  4WLA A;  3A0V A;  4ETX A;  4H9P B;  1PWC A;  3Q7Z A;  3NOT C;  2BYK A;  1EQZ D;  3GSG A;  5U47 A;  4S2N A;  3AZL B;  3MGQ B;  4KUD A;  3GVB A;  1TZY D;  5GT0 A;  5J4E A;  4EEU A;  2XRO A;  2PYO B;  3VMA A;  1SKF A;  2ZC7 A;  1ZG6 A;  3KSY A;  1NJ4 A;  5BT1 C;  1D7E A;  1S1Y A;  2WKE A;  5B1L D;  3CZD A;  1DJA A;  3P01 A;  1U35 D;  3B6F C;  4QLC B;  3W97 D;  1N9L A;  3C1C C;  1IKG A;  5B2I A;  4NKP A;  4HJ3 A;  2OWJ A;  1K57 C;  3MMH A;  4OPR A;  1T1B A;  1Z2C B;  3WTP B;  3WS5 A;  1EWZ A;  3KS4 A;  1VEU A;  5CHJ A;  4X55 A;  4J8X A;  2W8S A;  3WTP A;  5BS7 C;  3PTE A;  1QMF A;  3NJA A;  3B0C T;  3V50 A;  1F98 A;  2O99 A;  1PZR A;  3W96 D;  4N1X A;  3N6I A;  4J8W C;  4OON A;  2VKS A;  4PM7 A;  1P3O D;  2I72 A;  1LSX A;  4GB7 A;  2ZQD A;  1HQ3 A;  5F83 A;  2Z2M B;  4MNR A;  2PU2 A;  3L25 A;  1KE3 A;  2X71 A;  4PAU A;  5B2J B;  5CPK C;  5B24 D;  3WAA A;  2DF4 C;  3V67 A;  5B33 D;  1JTG A;  4GOG A;  5B2J C;  2EXA A;  2JC7 A;  1ES3 A;  5DKL A;  5B0Z C;  5KZH A;  4WU9 B;  3W2Z A;  2Q9M A;  4MCW A;  1ALQ A;  1F66 B;  4GHI B;  3REJ B;  1HZO A;  3HLG A;  2H28 A;  2JE5 A;  1AXB A;  4JJN C;  3V5M A;  5IS1 A;  5FUG B;  4ZTK A;  3TU4 D;  2JKG A;  1ESI A;  3WTP C;  3REH B;  4HEF A;  4II7 A;  3AN2 D;  5GLB A;  3WA9 D;  3UME A;  3MGR D;  4KUO A;  3UDI A;  4BD1 A;  1W8Q A;  4KZ4 A;  5JRG C;  1K54 C;  4EER A;  1BUE A;  2K7S A;  4MB4 A;  2J80 A;  4GJ4 A;  4CLC D;  2IO5 C;  3P7N A;  3IH8 A;  4DQY B;  3KUY B;  4H9S A;  4HMC A;  5EVI A;  3TE8 A;  3X1S B;  3FZC A;  1XFQ A;  3HLD A;  1V9Z A;  4ZAM A;  3CUE C;  4YM6 C;  1NY0 A;  3FPV A;  3WS2 A;  1P3P A;  5FI7 A;  3E98 A;  3G32 A;  1BSG A;  1JWZ A;  4CQH A;  1ID3 C;  2CV5 B;  4HP9 A;  3WWX A;  3AN2 A;  1XP4 A;  4DDY A;  1PIO A;  2EA9 A;  3ZGA B;  5DJT A;  4EXO A;  1JWP A;  4H9N B;  4IBB A;  4JXG A;  3ZCZ A;  3A3E A;  4HJ6 A;  4BWI A;  1K38 A;  4BJP A;  4PM8 A;  5B0Y D;  1F2K A;  2FN2 A;  3D9Y A;  4R1G A;  5BNV A;  3REL A;  1W1Y A;  4PMA A;  1GA9 A;  4Z2H A;  1G5U A;  3BEC A;  4QU3 A;  3IHA A;  2Y2I A;  2V0W A;  3REJ D;  1WE4 A;  1YU1 A;  1W2E A;  3OC2 A;  5L8M A;  4PKY G;  4N9L A;  1YLZ A;  3MF0 A;  3VP1 A;  3AZH C;  4R6L A;  5KIZ A;  3MGQ A;  4LRX C;  5GXQ B;  1IYO A;  3FV7 A;  1KX4 C;  3T1Q B;  4J8W A;  5J3W A;  3MKE A;  4UQI S;  5HAR A;  3OPR A;  4QLC C;  2W1R A;  5CPI A;  4ME4 A;  2YFV B;  3AZF A;  5FDS A;  3T4Q A;  4EWF A;  2ZQA A;  1XGI A;  3CIT A;  2R78 A;  3PBT A;  3PYP A;  1L0E A;  5J7E A;  1EQZ C;  1W5D A;  4I3A A;  1ID3 A;  3X1V B;  2HIO D;  4IBF A;  4P87 A;  1JNU A;  5HDD A;  4D2O A;  1EQZ A;  5IU1 A;  1FSW A;  3Q81 A;  3AZH B;  2Y8H A;  1M19 A;  3QP8 A;  1N9N A;  3DTE A;  3H7W B;  2JN7 A;  3UTA B;  3MGP D;  4KHA A;  4XT2 B;  3WA9 C;  4RX3 A;  2EX6 A;  3CPT B;  4I39 A;  4B4Z A;  3AZI A;  3MVD D;  3C4O A;  2ZY2 A;  5AV6 D;  3A6N B;  4JJN D;  1P3A C;  1NYM A;  4DKI A;  3UTB B;  5J8X A;  4I3I A;  4ARZ B;  3MQ0 A;  1L0D A;  3C2W A;  3NQU A;  4XUJ A;  3AZK D;  4LRY C;  2JHE A;  3NDE A;  4Q8I A;  1W7F A;  3IX4 A;  1WYC A;  3JYI A;  5AVF A;  5HFO A;  4X23 C;  1KE4 A;  3HLB A;  4BBU A;  2FFF B;  1FR6 A;  2FJ7 C;  5CPK A;  4GW9 A;  2NQB B;  2Y2H A;  3X1T B;  4JJN A;  4HJ4 A;  2ZMA A;  4CLC E;  3M2J A;  5GHY A;  3RXW A;  2W3D A;  2XA7 M;  1GSX A;  4R38 A;  2ZOH A;  4IBI A;  4WU8 D;  1S66 L;  5B32 C;  3MXQ A;  5L09 A;  3WKJ A;  5B1L A;  3UE6 A;  3KO6 A;  4LG2 A;  4G3V A;  5HSQ A;  4E3O A;  5AVE A;  3AV1 A;  5B24 B;  4EBP A;  3G30 A;  4LGW A;  3HLW A;  5DTT A;  2H0Y A;  2EWV A;  4R3A A;  1A7W A;  4EQI A;  2J3W A;  3WS0 A;  2OLU A;  5AQA A;  1M18 B;  1ZKJ A;  1GHP A;  4MBK A;  1ZLA A;  3BQ8 A;  4KG2 A;  3C7U A;  2XF3 A;  1T19 A;  2B5R A;  3VSL A;  4UHU A;  1OME A;  3D4F A;  1CEG A;  3W97 C;  5EOO A;  3B6F D;  3T4S A;  1T1C A;  1P3A A;  3CAX A;  3CWF A;  4IBJ A;  3FPW A;  1TS7 A;  2JSS A;  3T4K A;  4BLM A;  4ZBE A;  3VH5 T;  4WF0 A;  1IEM A;  4Z66 C;  2YKH A;  2XQZ A;  1P3L D;  3AV2 D;  5GLD A;  5HW3 A;  3H82 A;  2PD7 A;  2ZQC A;  3Q07 A;  4GD8 A;  2B02 A;  1XX2 A;  3E2L A;  5E43 A;  2O9A A;  5JRG A;  5FQ9 A;  4WU9 A;  4S2P A;  5DFX A;  1HLU P;  1WYB A;  1RP5 A;  4X6T A;  4DE0 A;  3REK B;  5B32 A;  4GHA A;  3W99 A;  4J8X B;  5CP6 D;  3LEZ A;  2LB9 A;  3OLO A;  3MGS B;  3IT9 A;  4X25 A;  3W8K A;  2WK0 A;  2VV6 A;  3N4I A;  1LL5 A;  3BYD A;  2LB5 A;  1M6K A;  1HQ3 B;  4XUX A;  4QY6 A;  2A49 A;  4Y5F A;  3HLE A;  4CLC A;  2HUE C;  3EGX C;  3V9R B;  3BFE A;  4G92 B;  3DBA A;  3PBQ A;  5F5Y A;  4X23 A;  5GHZ A;  3CLO A;  3TJZ C;  1P3K A;  4EO5 B;  3AV1 C;  2X01 A;  5AVC C;  2BTF P;  3NY4 A;  1UR9 A;  3WS4 A;  3LY3 A;  5B2I C;  2V1A A;  3T4O A;  3PBS A;  5HDS A;  3MGS C;  1Q2Q A;  5F1F A;  3HCY A;  4R4S A;  1P3I B;  5DNN D;  4WJ3 C;  1EI5 A;  1P3K B;  3FKV A;  3HLF A;  3IF6 C;  2PR5 A;  3TSG A;  1T18 A;  1H0M A;  2NZD D;  4Y15 A;  1YLP A;  5FAT A;  3VH6 A;  2ZM5 A;  3UTA C;  3DWK A;  3Q7V B;  1UWP X;  2VA0 A;  3WD2 A;  2XGN A;  2XD1 A;  2V8C A;  4R3B A;  3O88 A;  3ZDJ A;  3MGR B;  3UTA D;  3AYW A;  1YQS A;  4JGQ A;  2LY8 A;  5JYO A;  4ZUX D;  1AOI C;  5DNN A;  3AGF A;  4AWL C;  2ARO D;  3LEL B;  5G4Y A;  1TDG A;  1BTL A;  1CI9 A;  4U0T A;  2JKR I;  4LD9 B;  5B40 A;  5AV8 A;  2PYO A;  2D01 A;  4N92 A;  3VH5 W;  2Y2P A;  3LEL A;  1M19 C;  1W1P A;  5DNN B;  5CX7 A;  1Y28 A;  1MKM A;  2EWW A;  2OAP 1;  1M18 C;  5KDM B;  4EW7 A;  4UAA A;  3AZI D;  2JKF A;  3PXP A;  1STZ A;  1FSY A;  1H3Q A;  4JBF A;  4N9K A;  5HWT A;  4OLD A;  3T4T A;  1M18 A;  1K55 A;  3P09 A;  1EQZ B;  2C6W B;  4KZ6 A;  3UE1 A;  2Y2M A;  1MY8 A;  2WKR A;  4IJG A;  3KXB D;  1KX3 D;  3AZJ C;  3FC7 A;  4J8U C;  1IYQ A;  4S2J A;  1XJ4 A;  1YPR A;  4OQ0 A;  4BL3 A;  4ZUX A;  4CAY A;  3OCN A;  4RYE A;  3AZL A;  2J8Y A;  1OPX A;  5A8B A;  3HJK A;  4Z5T D;  3QP6 A;  5L07 A;  1FOF A;  2WKH A;  4Z1W A;  3WKJ C;  2PHY A;  3GQZ A;  1KX5 B;  1Y54 A;  4ZBJ C;  4L0L A;  4GD6 A;  1NLY A;  4YM6 D;  3HLC A;  3DW0 A;  1YM1 A;  3G6O A;  1W1V A;  4J8V C;  3NCK A;  2WZZ A;  1BH9 B;  1PFL A;  3TW8 A;  3N8L A;  5DFY A;  3X1S C;  1ESU A;  4ZUX B;  2J8P A;  2F8N K;  3QP1 A;  1KS0 A;  5B2J A;  1VB6 A;  1EAK A;  4NG2 A;  4PKY A;  3REL C;  4O01 A;  3ZG7 B;  3UDX A;  1YSP A;  3VE3 A;  3T50 A;  3NQU B;  4XUJ B;  3ZFZ A;  5HAQ A;  3WTP E;  2NZD B;  5HD3 A;  2HP6 A;  2WAE A;  3LIA A;  2CMN A;  1D1J A;  1HD8 A;  2IA2 A;  4H6J A;  5DNM A;  3OOV A;  3IXG A;  3NDG A;  4GLQ A;  1IYS A;  4WYY A;  1DP8 A;  4CSR A;  5AV5 C;  3AZL C;  2RL3 A;  5DF8 A;  1U60 A;  3EPJ A;  1MWR A;  3UT9 B;  5DJU A;  5B2J D;  1AIW A;  5B33 C;  4HIA A;  5TBM A;  5B24 C;  3C1C A;  5FI2 A;  3NC8 A;  1ZC2 A;  4R8P D;  1C3B A;  4A5R A;  2BAS A;  1TS8 A;  1J9M A;  1K57 A;  4WU9 D;  4NXG A;  3FKW A;  4GDB A;  4N1H A;  2Z6D A;  3IQA A;  3K3D A;  2J9O A;  4IBE A;  1S32 A;  5CP6 A;  2D49 A;  3PBN A;  2ZC4 B;  3SS5 A;  4KUK A;  1T3U A;  1YLW A;  1TAF B;  3VH6 W;  2HP5 A;  5BS7 A;  1NYY A;  4KUD C;  1Y4O A;  5CPJ B;  4B88 A;  3AZJ A;  5B32 D;  1KX3 B;  3WKJ B;  3IBR A;  3LGO A;  4MLL A;  5CGW A;  3K2N A;  4DJ2 A;  4GCZ A;  4KGC B;  3AL0 C;  1K56 A;  1P3L A;  5AV6 A;  4R8P C;  1YU4 A;  3CG5 A;  4GDN A;  5EV0 A;  4X23 D;  4EEP A;  4ID4 A;  1JTD A;  3ZG5 A;  5CTN A;  4OQI A;  1M1A D;  4OQG A;  1KX4 B;  4GHL A;  3AYW B;  3LZ1 D;  4OOY A;  4IBX A;  1U35 C;  5AV5 D;  4MN7 A;  2NUT C;  1DJC A;  4DMZ A;  1KVM A;  3SS3 A;  1NRJ A;  3UB8 A;  5B33 B;  4JLF A;  4O0P A;  5D3O A;  4PPR A;  1DP9 A;  1MWS A;  1P3M A;  3A1K A;  3UT9 D;  3MNN C;  1KDS A;  3IBJ A;  5FL3 A;  3R4K A;  4KQQ A;  1TZY C;  4MB5 A;  4IUH A;  1Q9C A;  2I9V A;  4XZQ B;  5C5K A;  3WD4 A;  3KS8 A;  1ERQ A;  3C1B B;  4YS3 A;  3VP2 A;  2J9P A;  1M1A A;  5M19 A;  1R4V A;  3M6H A;  3BY8 A;  2PT7 A;  3VP0 A;  2X02 A;  4H9O B;  3G2Z A;  1BYW A;  5BOH A;  1PNE A;  3PHY A;  2XFS A;  4UQI M;  3REI D;  3F1N B;  4QWO A;  4WEJ A;  5FAO A;  4H9S C;  5EVI C;  2BYM A;  4OLG A;  5JRG B;  3VV4 A;  3KSG A;  3VE4 A;  2A24 B;  4CLC B;  5B0Y B;  1ID3 B;  2Y2J A;  2ZMF A;  5DKK A;  1SDN A;  3GEC A;  3AZG A;  1TEM A;  5F6A A;  4L9G A;  3G34 A;  2DCF A;  3DAV A;  5CGS A;  1GHI A;  3LI9 A;  1KGG A;  3RXX A;  4MB3 A;  3AYW C;  1CJF A;  1IKI A;  3LUQ A;  3REH A;  2Q9N A;  2WAF A;  1KX3 C;  4EUZ A;  5TJJ A;  3GV9 A;  3IX8 A;  2YFW A;  1KX4 D;  1PZO A;  4NE5 A;  3MKF A;  4KHA B;  3LY4 A;  1G6A A;  5FAP A;  2VLG A;  1H5X A;  1M1A C;  1H0G A;  1P3K C;  4MN5 A;  4YIN A;  2EX8 A;  1MBL A;  2WGV A;  1XXM A;  3RTY A;  4OJP A;  4Y17 A;  5DF9 A;  2F8N H;  3MQQ A;  4ARZ A;  2ZMV A;  3VH6 T;  1N1J A;  3HBR A;  3ZVT A;  4E3I A;  4MN6 A;  2RCX A;  3NOP C;  2INW A;  1P3F C;  2NUP C;  3AZE D;  2P9V B;  5GT0 C;  4ZRR A;  3MVD B;  3W96 B;  2HDR A;  2HDS A;  5HWV A;  1F66 A;  1P34 B;  1P3G D;  1GSW A;  3LCE A;  4HNB A;  3CPT A;  4DN0 A;  4IBC A;  4LD9 C;  3CI6 A;  5E5A A;  1H8Y A;  4H8R A;  4WNN B;  3W4Q A;  2B18 A;  2PU4 A;  1RGZ A;  3D72 A;  4H9R B;  2UWX A;  1ID3 D;  2WKI A;  1P34 A;  3UPN A;  4G3K A;  1DP6 A;  1W8Y A;  3MBZ A;  2O9C A;  3H9W A;  4WZS B;  1E4D A;  4OVD A;  3A6N D;  2M7U A;  1F66 D;  2HIO B;  3C4P A;  2QKP A;  3PBO A;  4X56 A;  4ESP A;  3HUM A;  3AFA C;  4FTX A;  1N9O A;  5DVA A;  4KZ3 A;  3MGR C;  3AN2 C;  4O8G A;  5AQB A;  3VSK A;  3WTP D;  3WA9 A;  4EET B;  2RTS A;  3F1O B;  3AN2 B;  3IWQ A;  2ZM2 A;  3QP4 A;  3ICY A;  4E04 A;  2VZW A;  3LR4 A;  5EEC A;  5I94 A;  2ZBB A;  2V8F A;  3KYZ A;  5GLC A;  3O62 C;  3E4P A;  3MZD A;  3X1U B;  3UTA A;  2WYX A;  1LHY A;  3EG5 B;  4NXB A;  3X1S D;  3C1B A;  1IOU A;  1LSW A;  2HJE A;  1B67 A;  4WU8 A;  3DTK A;  4KZ9 A;  2O0Y A;  2WUQ A;  4NE3 A;  5B33 A;  5BO0 B;  5B31 G;  2NQB C;  2GZA A;  3UTB A;  1YU3 A;  1KE0 A;  3F1O A;  1P3M C;  4ZJ3 A;  1ACF A;  3TG9 A;  4BBT A;  1VHM A;  1HQ3 C;  3W4O A;  1V9Y A;  3L28 A;  3KSI A;  4KGC D;  3W96 C;  4YOF A;  4G92 C;  1GXD A;  1RCJ A;  1CI8 A;  1IFQ A;  1S67 L;  1ULY A;  2QJ5 A;  4IBG A;  1YLJ A;  4IVI A;  5HZH A;  1ONG A;  1S4R A;  1S32 B;  1MZU A;  3KWQ B;  3MGQ D;  4YS3 B;  5CEB A;  3AZI C;  5CER A;  3UY6 A;  4PM5 A;  4GKU A;  2W0N A;  2F8N G;  3SOI A;  5CPJ A;  2G5I C;  5BNX A;  1GHM A;  1JVJ A;  2XD5 A;  1H8Z A;  1YU2 A;  3WS1 A;  3W97 A;  1F66 C;  1OGB A;  3L7H A;  5F69 A;  1BLS A;  3UE0 A;  1SZV A;  2IWD A;  5AV8 C;  3X1U D;  4NXF A;  4OP5 A;  3MR0 A;  4CSR B;  1KX5 C;  5G4Z A;  4FUW A;  4S2M A;  3B47 A;  4GZB A;  4E3N A;  5CHL B;  3IHB A;  1Q2P A;  1IYP A;  3AV2 A;  4ZJ1 A;  3HON A;  5EOE A;  1XKZ A;  3CUE A;  3QNC A;  4KEN B;  3JPU A;  3ZYT A;  5AY8 A;  2J3T C;  1P3G C;  1P3P B;  2ZQ9 A;  4IED A;  4BMW A;  1MWU A;  3CHW P;  4DXC A;  2BLS A;  4K91 A;  4RX2 A;  3KUY A;  4WM9 A;  4ETZ A;  2QYB A;  2VK3 A;  1K6R A;  3WD3 A;  5B1M C;  4OJ6 A;  5DNN C;  2G7U A;  1BZA A;  2ZL1 A;  1E6P A;  2V20 A;  4QNL A;  1SKO A;  2ZY4 A;  2W1T A;  4KQD A;  3O87 A;  5B32 G;  2QMI A;  2FJ7 D;  5B1M A;  2OV5 A;  3AZM D;  3G4P A;  4HME A;  3LR0 A;  4XUZ A;  1P3K D;  4I3J A;  2F8N D;  2A3U A;  4NZ5 A;  5AVC D;  5CPI B;  3A3J A;  3IX3 A;  3OZH A;  3B6G C;  1PZP A;  2V0U A;  1HTZ A;  3ISG A;  5AY8 D;  4KZ5 A;  1SDE A;  4OOM A;  4EV4 A;  3GR2 A;  2MJ6 A;  2Y2K A;  3O5Y A;  3R7W B;  5FDH A;  3R45 A;  1FCN A;  4K08 A;  4XT2 A;  3TU4 A;  5CEC A;  5G49 B;  3LJA A;  3MXS A;  4LV1 A;  5GSU D;  4MBF A;  1FCM A;  3JVU A;  1G28 A;  2OAQ 1;  3MGR A;  3OPP A;  4U3T A;  3AZG B;  5E2F A;  3X1V D;  1YUE A;  3OPL A;  4Y7P A;  1PWD A;  4WMC A;  1K56 D;  2RVQ C;  5B0Y A;  1W63 Q;  3G2Y A;  2V9A A;  2W3E A;  4S2N C;  5EVI D;  2B95 A;  1BH9 A;  3BLS A;  4D60 A;  2Y2O A;  1O07 A;  2PRF A;  2PDR A;  1OJG A;  1KGE A;  4GHI A;  3SH8 A;  4FCF A;  3JVV A;  3IWO A;  3DWZ A;  3EQU A;  3AV2 C;  2VEA A;  1CK3 A;  1U35 B;  5KSH A;  1P3L C;  1E8B A;  3L27 A;  5EM0 A;  3EQV A;  4Z66 A;  4Z5T B;  2JKT M;  3X1U C;  2V1B A;  5AVC B;  5CPI D;  4QHC A;  5DNM C;  4NE6 A;  4HI4 A;  3AZH D;  3P98 A;  2H5S A;  4FOF A;  5BNX B;  5TBM B;  3GTC A;  3KXB B;  1MC0 A;  3EGD C;  4P85 A;  3GRJ A;  3REJ C;  3KSF A;  3UB7 A;  1ONH A;  2AVX A;  4CJN A;  5GT3 A;  3EEA A;  4JJN B;  4HH3 A;  3REJ A;  1N9B A;  1P3O B;  2F8N B;  2WGW A;  3UTB D;  1EW0 A;  3AZF D;  5B0Y C;  4KUD D;  4DF6 A;  1W63 M;  1TAF A;  3UPO A;  3UMD A;  4HES A;  5BPV A;  4KGC C;  4IBD A;  5E2E A;  1AOI A;  4XZQ D;  4WU8 C;  4IJE A;  4L9E A;  3LJA C;  2VGL S;  2H10 A;  2ZQ7 A;  4JGO A;  1I2S A;  3ZNY A;  5CXW A;  4YNR A;  3E4Q A;  2WKP A;  2HJ9 C;  2XFT A;  4QJG A;  3B6F B;  5KDM A;  4WZ5 C;  4S2K A;  5F99 D;  4J8V A;  5C3I C;  1P3B D;  4AFI A;  4DDS A;  1MXO A;  1YMS A;  5CHU A;  3QHY A;  4LCM A;  3E0Y A;  1SCW A;  5EUA A;  4PHT A;  3OCL A;  2E8I A;  4S2I A;  5HAP A;  2L5A A;  3MGP B;  3B33 A;  4WZ4 A;  3AV2 B;  4KUD B;  2DMW A;  2XRN A;  3ZNT A;  1ZLA B;  5AV9 A;  1SKO B;  2W1T B;  2Y2N A;  3W99 C;  4K0W A;  5B32 B;  3ZG9 B;  3S7P A;  1PYY A;  4M6B A;  1HVB A;  3AFA D;  3TRC A;  3WAA B;  1BLH A;  3X1T C;  4JKT A;  4AWL B;  3SZT A;  4FSF A;  4PM6 A;  3WAA C;  4O7D A;  4TX8 A;  1ZHH B;  1L3L A;  3NOU C;  5CPK D;  2ZC6 B;  5FUG A;  2M1C A;  5HL1 A;  5CTM A;  4PM9 A;  4NYU A;  1LI0 A;  4HHD A;  1X0O A;  3FKE A;  2ARO B;  3BRM A;  1KU5 A;  4EES A;  4UUZ B;  3E2K A;  2K31 A;  4FH4 A;  2PYO C;  1XGJ A;  3KYE A;  3WKJ D;  3LZ0 A;  3IWI A;  1OJ5 A;  4OH0 A;  3LIF A;  4YS3 C;  1H0I A;  1YKD A;  4P6Z M;  3AFA A;  3KWQ C;  1WWS A;  2JKR M;  4DRT A;  3IXH A;  3MQO A;  4WUJ A;  5FQQ A;  2JCH A;  3AZF C;  3W98 D;  2CV5 D;  1VET A;  3AZE C;  1J3W A;  4RVA A;  3AZJ D;  1K25 A;  5FAS A;  4E6W A;  1P3M B;  3LEQ A;  3U2A A;  2YFV A;  3AZF B;  3M2K A;  4EBL A;  3W97 B;  3KX0 X;  3MZE A;  2EFU A;  3VP3 A;  3IP4 C;  2P74 A;  3V39 A;  3MNN B;  1DRM A;  2XEP A;  2W3H A;  3BLM A;  1E6Z A;  1M18 D;  3SW1 A;  5FEF A;  5GSU B;  1E3U A;  5TR7 A;  3UE3 A;  3KFU G;  2L4R A;  2CV5 A;  1G68 A;  2V5O A;  5DTK A;  4G91 C;  1L0G A;  2OWH A;  4NZ4 A;  5F1G A;  5EVL A;  3QNB A;  4KGC A;  2W3G A;  2VV8 A;  1P3I A;  5BT1 D;  3ZG8 B;  4Z2M H;  4RQ9 A;  3IXB A;  2CV5 C;  3W98 C;  3AYW D;  4ZUX C;  3T1X A;  1A0K A;  2E8J A;  3MNN A;  3REI B;  3KWQ D;  2OSU A;  4GS9 B;  2P9V A;  4BEN A;  5B1M B;  4YS3 D;  4QY5 A;  4GNU A;  5M1A A;  3ZHH A;  2PYO D;  1ERO A;  4GS9 A;  3LEL D;  5FSR A;  1F1E A;  2WGI A;  3F1P A;  5F68 A;  2C5W B;  4L9F A;  5DF7 A;  1P3I D;  4LPZ A;  4Z9Q A;  2GX5 A;  5B24 A;  3WAA D;  2ZJ9 A;  1UGU A;  4J8X D;  5E5A B;  3A1I A;  1TDL A;  4CLC C;  1P3F B;  4JF4 A;  4H9R A;  3MGS D;  4H9Q B;  2BYK B;  5CPK B;  2IWC A;  4E6X A;  4Y0T A;  3A3D A;  3N7W A;  4WMC D;  4K0X A;  4EUV A;  2FFY A;  3MNN D;  5B0Z B;  1D06 A;  3DTM A;  4OOL A;  3U4L P;  1DJB A;  3V3R A;  3RFB A;  4OUI A;  3IH9 A;  1PI5 A;  3A0S A;  4M3K A;  1L0F A;  5EFW A;  4LEN A;  3M7P A;  1NXY A;  1GA0 A;  1P3B C;  3AZM C;  4WU8 B;  1JFI A;  4NK3 A;  5HAI A;  3AV1 B;  4QPR A;  3AGD A;  3R7W A;  3AZM B;  5A91 A;  3VP4 A;  2Y2G A;  1CQA A;  3MGS A;  5B1M D;  1PW1 A;  2ZD8 A;  5CPJ C;  3HRE A;  4S2L A;  4QB8 A;  5CP6 C;  3ZQ5 A;  3VOL A;  3LYX A;  2JBF A;  4Q0I A;  1P3G A;  3LO7 A;  1MPL A;  3L26 A;  4LCL A;  2J3T D;  4EO5 C;  1ZTU A;  1XA1 A;  2Y79 A;  1N1J B;  2QPN A;  3LI8 A;  4C3Q A;  2F8N A;  1BFM A;  1P34 C;  1P3P D;  5B31 D;  1KX5 D;  5GT3 B;  2KLI A;  4BBV A;  1H3O A;  3L2A A;  5FQK A;  5AV8 D;  3REH C;  3C1C D;  3BWL A;  3UB6 A;  4UA7 A;  1TZY A;  1YT4 A;  1E88 A;  3C7V A;  4R3J A;  3UB9 A;  4EQ1 A;  2VGK A;  5B1L B;  3BFG A;  3AZL D;  2GNX A;  2KDK A;  3IXD A;  1TZY B;  5GSU A;  3B3X A;  5FQJ A;  4NZ3 A;  4KZB A;  5B1L C;  5JA4 B;  3GMW A;  2V2F F;  4FH2 A;  4YWZ A;  4Q0J A;  5B31 C;  3IS2 A;  4YM6 A;  2EFX A;  4JXS A;  5EPH A;  3V9R A;  2XDM A;  3REK D;  3O62 B;  3N8S A;  5CP6 B;  4HBU A;  4E44 A;  3EPH A;  1VET B;  4G3W A;  4UEY A;  4BQM A;  1UR8 A;  3AGE A;  4G91 B;  3BFD A;  5KSC A;  4Z2L A;  4C75 A;  3EPL A;  3UB5 P;  3C1C B;  3KYQ A;  2HGV A;  3AZG D;  3LFV A;  4LD9 A;  4BL2 A;  1KX3 A;  3B6F A;  4HP4 A;  5CHM A;  5AJG A;  2Y4A A;  1OT9 A;  2QWS A;  4H9N A;  1S1Z A;  2Y2Q A;  2ZY5 A;  4UA9 A;  2PBD P;  4KG6 A;  5EVI B;  3MFX A;  1P3F A;  3S7Q A;  2CWE A;  3WRZ A;  3B6G B;  4I38 A;  2GJ3 A;  5GT3 D;  2PBY A;  4OPQ A;  4J8U D;  3Q7V A;  3AZK C;  3H82 B;  3KXB C;  4R23 A;  3O62 D;  5GXQ C;  3SS4 A;  1CXW A;  1J7M A;  5E2H A;  2H0T A;  1YSQ A;  3AZN B;  5M18 A;  2KX6 A;  2IOU A;  2UV0 E;  1H8P A;  4UA6 A;  4XUJ D;  3AZK A;  5AV6 C;  3MXR A;  4IBK A;  4Z2I A;  3IF6 A;  4MDZ A;  4Y2F A;  3MGP A;  1E6N A;  1JWV A;  1P9R A;  2P08 A;  2KOI A;  4JGR A;  1Z09 A;  2P04 A;  3MFD A;  4H9P A;  5AV9 B;  1TS6 A;  2V1Z A;  3UNW A;  4UUZ A;  2JKT I;  4X1M A;  1M1A B;  3VH5 A;  4J8U A;  4RA7 A;  4J8X C;  4QLC A;  4E3J A;  3LZ1 B;  5AV8 B;  2G2U A;  5B2I B;  5CRF A;  4OP8 A;  1AOI D;  3W99 B;  1E25 A;  2HIO C;  4MBH A;  4R8P B;  1L2S A;  2XA7 S;  3BEB A;  4GN2 A;  1WA9 A;  3AZN C;  3B42 A;  4Z2J A;  4WBG A;  3UN7 A;  1KOU A;  1XPB A;  1YAX A;  2WZX A;  2HUE B;  4R8P A;  1O6I A;  3BFF A;  5GT0 D;  4QLC D;  1TD5 A;  4ZBJ B;  3F1N A;  4Z5T A;  4Z2G A;  4JF5 A;  2M7V A;  4C6Y A;  3AZI B;  3NQJ A;  1VEU B;  1S6R A;  1ERM A;  1HTA A;  1U35 A;  5FA7 A;  5HL6 A;  1KVL A;  3F6T A;  3B0B A;  4CPK A;  3V3S A;  3KSH A;  1FIK A;  3T4L A;  5B2I D;  4Y13 A;  2Y91 A;  1H8M A;  2YFW B;  3PBR A;  5C3I B;  3MSH A;  3C8C A;  3BM6 A;  3UDF A;  4YFM A;  4QD4 A;  1XJ6 A;  1ES2 A;  4IHQ A;  1P97 A;  3TOI A;  3BJN A;  3D3O A;  1P9W A;  4OKP A;  3IS2 B;  5GXQ D;  3X1V A;  4IUK A;  5AVB B;  2R9X A;  1K4F A;  4LV0 A;  2R9W A;  2HF6 A;  5TFQ A;  3T12 B;  4NYY A;  3WX7 A;  3HJI A;  3EEH A;  1S4S A;  2L0W A;  3H7W A;  1P3O A;  3VFF A;  5B40 B;  1RGY A;  4WEL A;  4H6J B;  1MKI A;  2J7V A;  5AQ7 A;  1B6W A;  1OTI A;  1K6S A;  2NQB D;  5CGX A;  5GXQ A;  5AVB A;  3REI C;  3PAE A;  3PAG A;  1ED7 A;  1K4E A;  4IBR A;  5B31 A;  3NEC A;  5JRG D;  3A3F A;  1YLY A;  3ULF A;  1YU0 A;  2EX2 A;  1S32 D;  3LR3 A;  1SHV A;  3REK C;  5B31 B;  3W99 D;  4KQO A;  3ZVW A;  3I7J A;  3DTI A;  3UT9 C;  1NZU A;  5LBR A;  2WGW B;  4Y3I A;  1KX5 A;  3LIC A;  2PYR A;  3LIE A;  3Q1F A;  4X1L A;  1O7E A;  3X1U A;  3C5A A;  4OPZ A;  3OBF A;  1I2W A;  1JFI B;  3IF6 B;  1P3A B;  5E5A D;  3H0M C;  2D02 A;  4JGP A;  3REH D;  2XR0 A;  5F99 C;  3BFC A;  5MC7 A;  3SH9 A;  3WA9 B;  4HGA C;  3M6B A;  4Q0H A;  2FZ0 A;  2NZD A;  5AV5 A;  2QHK A;  2FH5 A;  5B40 D;  1P3O C;  4OJ5 A;  3KUY D;  4BD0 A;  4FD8 A;  5JA4 A;  1PRQ A;  3AZE B;  4R4R A;  5GLA A;  5A92 A;  4JF6 A;  3VOZ A;  4JPM A;  3KUY C;  2EX9 A;  4NET A;  1BLP A;  2WAD A;  4M4X A;  4DRA A;  5B40 C;  2HP9 A;  2ARO A;  1YLT A;  3VOY A;  5GL9 A;  1BT5 A;  5G49 A;  3LJA B;  2ZC5 B;  5HDC A;  1S0W A;  4DJ3 A;  2G5H C;  1ES4 A;  2K2N A;  3A3I A;  4J8W B;  1VQQ A;  4R70 A;  4MEZ A;  3P5J B;  5AY8 B;  3ITB A;  4B9O A;  4DE2 A;  4WV4 B;  3KXB A;  3T1S A;  3REK A;  5AQ9 A;  4LRZ E;  1IEL A;  2QJ7 A;  3NHQ A;  2OLV A;  1K0K A;  1P3B A;  2GDN A;  1K54 A;  2G2W A;  2HDQ A;  1LLB A;  3A0R A;  5A90 A;  3O62 A;  4KZA A;  4X68 A;  5F99 B;  2Y59 A;  3HUO A;  4OQH A;  2L1M A;  1DY6 A;  4B93 A;  2ZY3 A;  1P3A D;  3A6N A;  2XK1 A;  3T4J A;  3HUN A;  3LID A;  2WKQ A;  5A93 A;  5DTS A;  3MGP C;  3G31 A;  1NLZ A;  3H0L C;  1PWG A;  4B4X A;  2FJ7 A;  4ZDX A;  4LV2 A;  2Q0O A;  4OJL A;  3AZN A;  3W4P A;  1BUL A;  1XJ3 A;  4E3K A;  3LEL C;  1QME A;  3F1P B;  2HIO A;  4DE1 A;  3B0C W;  4DRB A;  3NIA A;  3MJQ A;  5I5L A;  4Z5T C;  5HX9 A;  2PAV P;  4P0M A;  3PR6 A;  2ZL1 B;  5GSU C;  3TU4 B;  4OJO A;  1ZG4 A;  3W98 A;  3EWK A;  3O3V A;  4F3L A;  2F2A C;  3HVF A;  5AV9 C;  4NFT A;  3Q82 A;  1LL9 A;  1XFN A;  4DXB A;  1E3U D;  2CC1 A;  3B6G A;  4Y0U A;  4H9Q A;  4HY8 A;  3UO9 A;  3WD0 A;  1TF1 A;  2W27 A;  2ZQ8 A;  3LZ1 C;  2PR6 A;  4P6Z S;  1LT0 A; 
#chains in the Genus database with same CATH homology
 3IF5 A;  3AZK B;  3EPK A;  2ZM8 A;  4E3M A;  4JXV A;  1VM1 A;  3N3F A;  5E2G A;  2ARO C;  4UPK A;  4DE3 A;  5CED A;  3NBL A;  2IWB A;  5EE8 A;  3AZM A;  4HGA B;  4ZJ2 A;  2HPB A;  3FDD A;  1K55 C;  4WU9 C;  3ZG0 A;  2DQN C;  2NZD C;  4EBN A;  3AZH A;  3N8R A;  2Y2L A;  4WEK A;  5FI6 A;  1ZLA D;  2QZ6 A;  1BH8 A;  5E5A C;  3X1T D;  2XH9 A;  4E3L A;  5BO0 A;  1BH8 B;  1KDW A;  5AVC A;  3TU4 C;  2VGJ A;  3C1B C;  2IO5 B;  3S22 A;  3MGQ C;  4R0Q A;  3L29 A;  2ZC3 B;  3UT9 A;  5GHX A;  4KZ8 A;  3UPP A;  5DNM B;  2NQB A;  3AFA B;  5GT0 B;  1S32 C;  4S2O A;  3REL D;  5GT3 C;  5B0Z D;  3X1T A;  4F94 A;  5G18 A;  4IVK A;  4X53 A;  1XA7 A;  2ZLY A;  2HDU A;  3W96 A;  2Z2L B;  1FCO A;  4KG5 A;  4KQR A;  1YMX A;  5F99 A;  4J8V D;  3LZ0 D;  5JYP A;  1HQ3 D;  3S4X A;  5FQM A;  5TGF A;  4X23 B;  3CMZ A;  1P3M D;  3HSH A;  3LJA D;  3AZG C;  4IJF A;  1P3B B;  3LZ0 C;  4XZQ C;  1CEF A;  4J8W D;  5B0Z A;  1WWI A;  1P3L B;  4KZ7 A;  3UTB C;  3MZF A;  4YM6 B;  4JXW A;  1PW8 A;  3O86 A;  2ZM0 A;  3WRT A;  4Z66 D;  4X69 A;  4P6B A;  3X1S A;  3C1B D;  3NI9 A;  3SH7 A;  1M40 A;  5F82 A;  4WZ5 A;  4J8V B;  4NZ1 A;  5FQI A;  5IHV A;  1M19 D;  5DNM D;  3A6N C;  5CPI C;  5BNV B;  3REL B;  3R45 B;  1GCE A;  1ZLA C;  3KWQ A;  4LV3 A;  5AV5 B;  3S1Y A;  1P34 D;  2VQR A;  1P3G B;  1P3P C;  1LI9 A;  4U0X A;  1KX4 A;  3LZ1 A;  2RIQ A;  1KGF A;  4H9O A;  4J8U B;  3FYZ A;  4Y0O A;  3LZ0 B;  3AZN D;  5AV6 B;  4LD9 D;  3W98 B;  5AVB D;  3ITA A;  4CAY B;  1H3O B;  1W79 A;  4XZQ A;  3B0D B;  2BG1 A;  2DNS A;  4Z2M G;  1P3F D;  1PI4 A;  4E45 A;  5CPJ D;  1Z6F A;  5FAQ A;  3VFH A;  3AZE A;  1TVF A;  2RVQ D;  3X1V C;  1MWT A;  1NZO A;  3HL9 A;  2BYM B;  2DRW A;  4XUJ C;  5L2F A;  1FR1 A;  3AV1 D;  1ES5 A;  3NQJ B;  2FJ7 B;  2Y55 A;  5AY8 C;  1I5Q A;  3AZJ B;  3B6G D;  5AV9 D;  1M19 B;  3G35 A;  3FWL A;  3MVD C;  4XXR A;  3B0D C;  3CJM A;  4NY2 A;  3OPH A;  4GH9 A;  1NRF A;  1AOI B;  1BLC A;  2EXB A;  3MVD A;  4Z66 B;  4OPY A;  5KMW A;  2XLN A;  3H0R C;  1P3I C;  1N4O A;  4HBT A;  3RJU A;  4WNN A;  5AVB C;  3REI A;  1FQG A;  4H9P B;  1PWC A;  3Q7Z A;  2BYK A;  1EQZ D;  3GSG A;  5U47 A;  4S2N A;  3AZL B;  3MGQ B;  4KUD A;  3GVB A;  1TZY D;  5GT0 A;  2PYO B;  3VMA A;  1SKF A;  2ZC7 A;  1ZG6 A;  3KSY A;  1NJ4 A;  5BT1 C;  2WKE A;  5B1L D;  3CZD A;  1DJA A;  1U35 D;  3B6F C;  4QLC B;  3W97 D;  3C1C C;  1IKG A;  5B2I A;  1K57 C;  4OPR A;  1Z2C B;  3WTP B;  3WS5 A;  1EWZ A;  3KS4 A;  5CHJ A;  4X55 A;  4J8X A;  2W8S A;  3WTP A;  5BS7 C;  3PTE A;  1QMF A;  3B0C T;  3V50 A;  1PZR A;  3W96 D;  4N1X A;  3N6I A;  4J8W C;  4OON A;  4PM7 A;  1P3O D;  2I72 A;  4GB7 A;  2ZQD A;  1HQ3 A;  5F83 A;  2Z2M B;  4MNR A;  2PU2 A;  3L25 A;  1KE3 A;  2X71 A;  5B2J B;  5CPK C;  5B24 D;  3WAA A;  2DF4 C;  5B33 D;  1JTG A;  4GOG A;  5B2J C;  2EXA A;  2JC7 A;  1ES3 A;  5B0Z C;  5KZH A;  4WU9 B;  2Q9M A;  1ALQ A;  1F66 B;  3REJ B;  1HZO A;  3HLG A;  2JE5 A;  1AXB A;  4JJN C;  3V5M A;  5FUG B;  4ZTK A;  3TU4 D;  1ESI A;  3WTP C;  3REH B;  4HEF A;  3AN2 D;  5GLB A;  3WA9 D;  4BD1 A;  3MGR D;  3UDI A;  1W8Q A;  4KZ4 A;  5JRG C;  1K54 C;  1BUE A;  2IO5 C;  3IH8 A;  4DQY B;  3KUY B;  4H9S A;  5EVI A;  3X1S B;  3FZC A;  3HLD A;  4ZAM A;  4YM6 C;  1NY0 A;  3WS2 A;  1P3P A;  5FI7 A;  3G32 A;  1BSG A;  1JWZ A;  1ID3 C;  2CV5 B;  3WWX A;  3AN2 A;  1XP4 A;  4DDY A;  1PIO A;  3ZGA B;  1JWP A;  4H9N B;  4IBB A;  4JXG A;  3ZCZ A;  3A3E A;  1K38 A;  4BJP A;  4PM8 A;  5B0Y D;  4R1G A;  5BNV A;  3REL A;  4PMA A;  1GA9 A;  3BEC A;  4QU3 A;  3IHA A;  2Y2I A;  3REJ D;  1WE4 A;  1YU1 A;  1W2E A;  3OC2 A;  4N9L A;  1YLZ A;  3VP1 A;  3AZH C;  3MGQ A;  5GXQ B;  1IYO A;  3FV7 A;  1KX4 C;  4J8W A;  3MKE A;  5HAR A;  3OPR A;  4QLC C;  5CPI A;  2YFV B;  3AZF A;  4EWF A;  2ZQA A;  1XGI A;  3PBT A;  1L0E A;  1EQZ C;  1W5D A;  1ID3 A;  3X1V B;  2HIO D;  4IBF A;  4P87 A;  4D2O A;  1EQZ A;  1FSW A;  3Q81 A;  3AZH B;  1M19 A;  3UTA B;  3MGP D;  4KHA A;  3WA9 C;  4RX3 A;  2EX6 A;  4B4Z A;  3AZI A;  3MVD D;  3C4O A;  2ZY2 A;  5AV6 D;  3A6N B;  4JJN D;  1P3A C;  1NYM A;  4DKI A;  3UTB B;  5J8X A;  1L0D A;  3NQU A;  4XUJ A;  3AZK D;  3NDE A;  4Q8I A;  1W7F A;  1WYC A;  3JYI A;  5HFO A;  4X23 C;  1KE4 A;  3HLB A;  2FFF B;  1FR6 A;  2FJ7 C;  5CPK A;  2NQB B;  2Y2H A;  3X1T B;  4JJN A;  2ZMA A;  3M2J A;  5GHY A;  3RXW A;  4IBI A;  4WU8 D;  5B32 C;  3WKJ A;  5B1L A;  4LG2 A;  4E3O A;  3AV1 A;  5B24 B;  4EBP A;  3G30 A;  3HLW A;  5DTT A;  2H0Y A;  1A7W A;  4EQI A;  3WS0 A;  2OLU A;  5AQA A;  1M18 B;  1ZKJ A;  1GHP A;  4MBK A;  1ZLA A;  4KG2 A;  3C7U A;  2XF3 A;  2B5R A;  3VSL A;  4UHU A;  1OME A;  3D4F A;  1CEG A;  3W97 C;  5EOO A;  3B6F D;  1P3A A;  4IBJ A;  2JSS A;  4BLM A;  4ZBE A;  3VH5 T;  1IEM A;  4Z66 C;  2XQZ A;  1P3L D;  3AV2 D;  5GLD A;  5HW3 A;  3Q07 A;  2ZQC A;  4GD8 A;  1XX2 A;  3E2L A;  5E43 A;  5JRG A;  5FQ9 A;  4WU9 A;  4S2P A;  1WYB A;  4X6T A;  1RP5 A;  4DE0 A;  3REK B;  5B32 A;  4GHA A;  3W99 A;  4J8X B;  5CP6 D;  3LEZ A;  3MGS B;  3IT9 A;  3W8K A;  2WK0 A;  3N4I A;  1LL5 A;  3BYD A;  1M6K A;  1HQ3 B;  4XUX A;  4QY6 A;  2A49 A;  3HLE A;  2HUE C;  3V9R B;  3BFE A;  4G92 B;  3PBQ A;  4X23 A;  5GHZ A;  1P3K A;  4EO5 B;  3AV1 C;  2X01 A;  5AVC C;  3NY4 A;  3WS4 A;  3LY3 A;  5B2I C;  3PBS A;  3MGS C;  1Q2Q A;  5F1F A;  4R4S A;  1P3I B;  5DNN D;  4WJ3 C;  1EI5 A;  1P3K B;  3FKV A;  3HLF A;  3IF6 C;  3TSG A;  2NZD D;  5FAT A;  1YLP A;  3VH6 A;  2ZM5 A;  3UTA C;  3DWK A;  3Q7V B;  2XGN A;  2XD1 A;  4R3B A;  3O88 A;  3ZDJ A;  3MGR B;  3UTA D;  3AYW A;  1YQS A;  2LY8 A;  5JYO A;  4ZUX D;  1AOI C;  5DNN A;  3AGF A;  4AWL C;  2ARO D;  3LEL B;  1TDG A;  1BTL A;  1CI9 A;  4U0T A;  4LD9 B;  5B40 A;  5AV8 A;  2PYO A;  4N92 A;  3VH5 W;  2Y2P A;  3LEL A;  1M19 C;  5DNN B;  1M18 C;  5KDM B;  4UAA A;  3AZI D;  1FSY A;  4JBF A;  4N9K A;  4OLD A;  1M18 A;  1K55 A;  3P09 A;  1EQZ B;  2C6W B;  4KZ6 A;  3UE1 A;  2Y2M A;  1MY8 A;  3KXB D;  1KX3 D;  3AZJ C;  4J8U C;  1IYQ A;  4S2J A;  4OQ0 A;  4BL3 A;  4ZUX A;  4CAY A;  3OCN A;  4RYE A;  3AZL A;  2J8Y A;  4Z5T D;  1FOF A;  2WKH A;  3WKJ C;  3GQZ A;  1KX5 B;  1Y54 A;  4ZBJ C;  4L0L A;  4GD6 A;  4YM6 D;  3HLC A;  3DW0 A;  1YM1 A;  4J8V C;  3NCK A;  2WZZ A;  1BH9 B;  3N8L A;  3X1S C;  1ESU A;  4ZUX B;  2J8P A;  2F8N K;  5B2J A;  3REL C;  3ZG7 B;  3UDX A;  3ZFZ A;  3NQU B;  4XUJ B;  5HAQ A;  3WTP E;  2NZD B;  2HP6 A;  2WAE A;  1HD8 A;  5DNM A;  3IXG A;  3NDG A;  1IYS A;  4WYY A;  4CSR A;  5AV5 C;  3AZL C;  2RL3 A;  5DF8 A;  1U60 A;  3EPJ A;  1MWR A;  3UT9 B;  5B2J D;  5B33 C;  5B24 C;  3C1C A;  5FI2 A;  3NC8 A;  1ZC2 A;  4R8P D;  1C3B A;  4A5R A;  1J9M A;  1K57 A;  4WU9 D;  3FKW A;  4GDB A;  4N1H A;  3IQA A;  2J9O A;  4IBE A;  1S32 A;  5CP6 A;  3PBN A;  2ZC4 B;  3SS5 A;  1T3U A;  1YLW A;  1TAF B;  3VH6 W;  2HP5 A;  5BS7 A;  1NYY A;  4KUD C;  5CPJ B;  4B88 A;  3AZJ A;  5B32 D;  1KX3 B;  3WKJ B;  4MLL A;  5CGW A;  4KGC B;  3AL0 C;  1K56 A;  1P3L A;  5AV6 A;  4R8P C;  1YU4 A;  3CG5 A;  4GDN A;  4X23 D;  4ID4 A;  1JTD A;  3ZG5 A;  5CTN A;  4OQI A;  1M1A D;  4OQG A;  1KX4 B;  4GHL A;  3AYW B;  3LZ1 D;  4OOY A;  4IBX A;  1U35 C;  5AV5 D;  1DJC A;  1KVM A;  3SS3 A;  5B33 B;  4JLF A;  5D3O A;  4PPR A;  1MWS A;  1P3M A;  3A1K A;  3UT9 D;  3MNN C;  1KDS A;  4KQQ A;  1TZY C;  1Q9C A;  4XZQ B;  3KS8 A;  1ERQ A;  3C1B B;  4YS3 A;  3VP2 A;  2J9P A;  1M1A A;  5M19 A;  1R4V A;  3M6H A;  3VP0 A;  2X02 A;  4H9O B;  3G2Z A;  5BOH A;  2XFS A;  3REI D;  4WEJ A;  5FAO A;  4H9S C;  5EVI C;  2BYM A;  4OLG A;  5JRG B;  5B0Y B;  1ID3 B;  2Y2J A;  1SDN A;  3AZG A;  1TEM A;  3G34 A;  2DCF A;  5CGS A;  1GHI A;  1KGG A;  3RXX A;  3AYW C;  1IKI A;  3REH A;  2Q9N A;  2WAF A;  1KX3 C;  4EUZ A;  3GV9 A;  2YFW A;  1KX4 D;  1PZO A;  4NE5 A;  3MKF A;  4KHA B;  3LY4 A;  1G6A A;  5FAP A;  1H5X A;  1M1A C;  1P3K C;  4YIN A;  2EX8 A;  1MBL A;  2WGV A;  1XXM A;  4OJP A;  5DF9 A;  2F8N H;  3VH6 T;  1N1J A;  3HBR A;  3ZVT A;  4E3I A;  2RCX A;  1P3F C;  3AZE D;  2P9V B;  5GT0 C;  3MVD B;  3W96 B;  2HDR A;  2HDS A;  1F66 A;  1P34 B;  1P3G D;  3LCE A;  4IBC A;  4LD9 C;  5E5A A;  1H8Y A;  4H8R A;  4WNN B;  3W4Q A;  2PU4 A;  1RGZ A;  4H9R B;  2UWX A;  1ID3 D;  2WKI A;  1P34 A;  3UPN A;  1W8Y A;  3MBZ A;  4WZS B;  1E4D A;  4OVD A;  3A6N D;  1F66 D;  2HIO B;  3C4P A;  3PBO A;  4X56 A;  3HUM A;  3AFA C;  5DVA A;  4KZ3 A;  3MGR C;  3AN2 C;  5AQB A;  3VSK A;  3WTP D;  3WA9 A;  3AN2 B;  3IWQ A;  2ZM2 A;  5EEC A;  5I94 A;  5GLC A;  3O62 C;  3MZD A;  3X1U B;  3UTA A;  2WYX A;  1LHY A;  3EG5 B;  3X1S D;  3C1B A;  1B67 A;  4WU8 A;  4KZ9 A;  2WUQ A;  4NE3 A;  5B33 A;  5BO0 B;  5B31 G;  2NQB C;  3UTB A;  1YU3 A;  1KE0 A;  1P3M C;  4ZJ3 A;  3TG9 A;  1HQ3 C;  3W4O A;  3L28 A;  4KGC D;  3W96 C;  4G92 C;  1RCJ A;  1CI8 A;  1ULY A;  4IBG A;  1YLJ A;  4IVI A;  1ONG A;  1S32 B;  3KWQ B;  3MGQ D;  4YS3 B;  5CEB A;  3AZI C;  5CER A;  3UY6 A;  4PM5 A;  4GKU A;  2F8N G;  3SOI A;  5CPJ A;  2G5I C;  5BNX A;  1GHM A;  1JVJ A;  2XD5 A;  1H8Z A;  1YU2 A;  3WS1 A;  3W97 A;  1F66 C;  1BLS A;  3UE0 A;  2IWD A;  5AV8 C;  3X1U D;  4OP5 A;  4CSR B;  1KX5 C;  4S2M A;  4GZB A;  4E3N A;  5CHL B;  3IHB A;  1Q2P A;  1IYP A;  3AV2 A;  4ZJ1 A;  3HON A;  5EOE A;  1XKZ A;  3QNC A;  4KEN B;  5AY8 A;  1P3G C;  1P3P B;  2ZQ9 A;  4IED A;  1MWU A;  4DXC A;  2BLS A;  4K91 A;  4RX2 A;  3KUY A;  4WM9 A;  1K6R A;  5B1M C;  4OJ6 A;  5DNN C;  1BZA A;  2V20 A;  4QNL A;  2ZY4 A;  3O87 A;  5B32 G;  2QMI A;  2FJ7 D;  5B1M A;  2OV5 A;  3AZM D;  3G4P A;  4XUZ A;  1P3K D;  2F8N D;  2A3U A;  4NZ5 A;  5AVC D;  5CPI B;  3A3J A;  3OZH A;  3B6G C;  1PZP A;  1HTZ A;  3ISG A;  5AY8 D;  4KZ5 A;  1SDE A;  4OOM A;  4EV4 A;  3GR2 A;  2Y2K A;  5FDH A;  3R45 A;  1FCN A;  3TU4 A;  5CEC A;  5G49 B;  3LJA A;  3MXS A;  4LV1 A;  5GSU D;  4MBF A;  1FCM A;  3OPP A;  3MGR A;  4U3T A;  3AZG B;  5E2F A;  3X1V D;  1YUE A;  3OPL A;  4Y7P A;  1PWD A;  4WMC A;  1K56 D;  2RVQ C;  5B0Y A;  3G2Y A;  4S2N C;  5EVI D;  1BH9 A;  3BLS A;  2Y2O A;  1O07 A;  1KGE A;  3SH8 A;  4FCF A;  3IWO A;  3DWZ A;  3EQU A;  3AV2 C;  1CK3 A;  1U35 B;  5KSH A;  1P3L C;  3L27 A;  3EQV A;  4Z66 A;  4Z5T B;  3X1U C;  5AVC B;  5CPI D;  4QHC A;  5DNM C;  4NE6 A;  3AZH D;  3P98 A;  2H5S A;  5BNX B;  3GTC A;  3KXB B;  4P85 A;  3GRJ A;  3REJ C;  1ONH A;  4CJN A;  5GT3 A;  4JJN B;  3REJ A;  1N9B A;  1P3O B;  2F8N B;  2WGW A;  3UTB D;  3AZF D;  5B0Y C;  4KUD D;  4DF6 A;  3UPO A;  1TAF A;  4HES A;  5BPV A;  4KGC C;  4IBD A;  5E2E A;  1AOI A;  4XZQ D;  4WU8 C;  4IJE A;  3LJA C;  2H10 A;  2ZQ7 A;  1I2S A;  3ZNY A;  5CXW A;  2XFT A;  4QJG A;  3B6F B;  5KDM A;  4WZ5 C;  4S2K A;  5F99 D;  4J8V A;  5C3I C;  1P3B D;  4DDS A;  1MXO A;  1YMS A;  5CHU A;  3QHY A;  4LCM A;  1SCW A;  5EUA A;  3OCL A;  2E8I A;  4S2I A;  5HAP A;  2L5A A;  3MGP B;  4WZ4 A;  3AV2 B;  4KUD B;  3ZNT A;  1ZLA B;  5AV9 A;  2Y2N A;  3W99 C;  4K0W A;  5B32 B;  3ZG9 B;  1PYY A;  4M6B A;  1HVB A;  3AFA D;  3WAA B;  1BLH A;  3X1T C;  4JKT A;  4AWL B;  4FSF A;  4PM6 A;  3WAA C;  4O7D A;  5CPK D;  2ZC6 B;  5FUG A;  5HL1 A;  5CTM A;  4PM9 A;  4NYU A;  1LI0 A;  3FKE A;  2ARO B;  3BRM A;  1KU5 A;  4UUZ B;  3E2K A;  4FH4 A;  2PYO C;  1XGJ A;  3WKJ D;  3LZ0 A;  3IWI A;  4OH0 A;  4YS3 C;  3AFA A;  3KWQ C;  1WWS A;  4DRT A;  3IXH A;  5FQQ A;  2JCH A;  3AZF C;  3W98 D;  2CV5 D;  3AZE C;  4RVA A;  3AZJ D;  1K25 A;  5FAS A;  4E6W A;  1P3M B;  2YFV A;  3AZF B;  3M2K A;  4EBL A;  3W97 B;  3MZE A;  2EFU A;  3VP3 A;  3IP4 C;  2P74 A;  3V39 A;  3MNN B;  2XEP A;  3BLM A;  1M18 D;  5GSU B;  1E3U A;  5TR7 A;  3UE3 A;  3KFU G;  2CV5 A;  1G68 A;  5DTK A;  4G91 C;  1L0G A;  4NZ4 A;  5F1G A;  5EVL A;  3QNB A;  4KGC A;  1P3I A;  5BT1 D;  3ZG8 B;  4Z2M H;  3IXB A;  2CV5 C;  3W98 C;  3AYW D;  4ZUX C;  3MNN A;  3REI B;  3KWQ D;  2OSU A;  2P9V A;  4BEN A;  5B1M B;  4YS3 D;  4QY5 A;  4GNU A;  5M1A A;  3ZHH A;  2PYO D;  1ERO A;  3LEL D;  5FSR A;  1F1E A;  2WGI A;  2C5W B;  5DF7 A;  1P3I D;  4Z9Q A;  5B24 A;  3WAA D;  2ZJ9 A;  4J8X D;  5E5A B;  3A1I A;  1TDL A;  1P3F B;  4JF4 A;  4H9R A;  3MGS D;  4H9Q B;  2BYK B;  5CPK B;  2IWC A;  4E6X A;  4Y0T A;  3A3D A;  3N7W A;  4WMC D;  4K0X A;  2FFY A;  3MNN D;  5B0Z B;  3DTM A;  4OOL A;  1DJB A;  3V3R A;  4OUI A;  3IH9 A;  1PI5 A;  4M3K A;  1L0F A;  4LEN A;  1NXY A;  1GA0 A;  1P3B C;  3AZM C;  4WU8 B;  1JFI A;  4NK3 A;  5HAI A;  3AV1 B;  3AGD A;  3AZM B;  5A91 A;  3VP4 A;  2Y2G A;  3MGS A;  5B1M D;  1PW1 A;  2ZD8 A;  5CPJ C;  3HRE A;  4S2L A;  4QB8 A;  5CP6 C;  2JBF A;  1P3G A;  3LO7 A;  1MPL A;  3L26 A;  4LCL A;  4EO5 C;  1XA1 A;  1N1J B;  2QPN A;  4C3Q A;  2F8N A;  1BFM A;  1P34 C;  1P3P D;  5B31 D;  1KX5 D;  5GT3 B;  1H3O A;  3L2A A;  5FQK A;  5AV8 D;  3REH C;  3C1C D;  4UA7 A;  1TZY A;  1YT4 A;  3C7V A;  4R3J A;  2VGK A;  5B1L B;  3BFG A;  3AZL D;  3IXD A;  1TZY B;  5GSU A;  3B3X A;  5FQJ A;  4NZ3 A;  4KZB A;  5B1L C;  5JA4 B;  3GMW A;  2V2F F;  4FH2 A;  5B31 C;  4YM6 A;  2EFX A;  4JXS A;  5EPH A;  3V9R A;  2XDM A;  3REK D;  3O62 B;  3N8S A;  5CP6 B;  4HBU A;  4E44 A;  3EPH A;  4BQM A;  3AGE A;  4G91 B;  3BFD A;  5KSC A;  4C75 A;  3EPL A;  3C1C B;  3AZG D;  4LD9 A;  4BL2 A;  1KX3 A;  3B6F A;  5CHM A;  2Y4A A;  4H9N A;  2Y2Q A;  2ZY5 A;  4UA9 A;  4KG6 A;  5EVI B;  1P3F A;  2CWE A;  3WRZ A;  3B6G B;  5GT3 D;  2PBY A;  4OPQ A;  4J8U D;  3Q7V A;  3AZK C;  3KXB C;  4R23 A;  3O62 D;  5GXQ C;  3SS4 A;  5E2H A;  2H0T A;  3AZN B;  5M18 A;  2IOU A;  4UA6 A;  4XUJ D;  3AZK A;  5AV6 C;  3MXR A;  4IBK A;  3IF6 A;  3MGP A;  1JWV A;  3MFD A;  4H9P A;  5AV9 B;  2V1Z A;  3UNW A;  4UUZ A;  1M1A B;  3VH5 A;  4J8U A;  4RA7 A;  4J8X C;  4QLC A;  4E3J A;  3LZ1 B;  5AV8 B;  2G2U A;  5B2I B;  5CRF A;  4OP8 A;  1AOI D;  3W99 B;  1E25 A;  2HIO C;  4MBH A;  4R8P B;  1L2S A;  3BEB A;  4GN2 A;  3AZN C;  4WBG A;  3UN7 A;  1XPB A;  2WZX A;  2HUE B;  4R8P A;  3BFF A;  5GT0 D;  4QLC D;  4ZBJ B;  4Z5T A;  4JF5 A;  4C6Y A;  3AZI B;  3NQJ A;  1S6R A;  1ERM A;  1HTA A;  1U35 A;  5FA7 A;  1KVL A;  3F6T A;  3B0B A;  4CPK A;  3V3S A;  5B2I D;  2Y91 A;  2YFW B;  3PBR A;  5C3I B;  3BM6 A;  3UDF A;  4YFM A;  4QD4 A;  1ES2 A;  3TOI A;  4OKP A;  5GXQ D;  3X1V A;  5AVB B;  2R9X A;  1K4F A;  4LV0 A;  2R9W A;  5TFQ A;  4NYY A;  3WX7 A;  1P3O A;  3VFF A;  5B40 B;  1RGY A;  4WEL A;  1MKI A;  2J7V A;  5AQ7 A;  1B6W A;  1K6S A;  2NQB D;  5CGX A;  5GXQ A;  5AVB A;  3REI C;  3PAE A;  3PAG A;  1K4E A;  4IBR A;  5B31 A;  5JRG D;  3A3F A;  1YLY A;  1YU0 A;  2EX2 A;  1S32 D;  1SHV A;  3REK C;  5B31 B;  3W99 D;  4KQO A;  3ZVW A;  3I7J A;  3UT9 C;  1NZU A;  2WGW B;  1KX5 A;  3Q1F A;  1O7E A;  3X1U A;  3C5A A;  4OPZ A;  1I2W A;  1JFI B;  3IF6 B;  1P3A B;  5E5A D;  3H0M C;  3REH D;  2XR0 A;  5F99 C;  3BFC A;  3SH9 A;  3WA9 B;  4HGA C;  3M6B A;  2NZD A;  5AV5 A;  5B40 D;  1P3O C;  4OJ5 A;  3KUY D;  4BD0 A;  4FD8 A;  5JA4 A;  3AZE B;  4R4R A;  5GLA A;  5A92 A;  4JF6 A;  3VOZ A;  4JPM A;  3KUY C;  4NET A;  2EX9 A;  2WAD A;  1BLP A;  4DRA A;  5B40 C;  2HP9 A;  2ARO A;  1YLT A;  3VOY A;  5GL9 A;  1BT5 A;  5G49 A;  3LJA B;  2ZC5 B;  1S0W A;  2G5H C;  1ES4 A;  3A3I A;  4J8W B;  1VQQ A;  4MEZ A;  3P5J B;  5AY8 B;  3ITB A;  4DE2 A;  4WV4 B;  3KXB A;  3REK A;  5AQ9 A;  1IEL A;  2OLV A;  1P3B A;  2GDN A;  1K54 A;  2G2W A;  2HDQ A;  1LLB A;  5A90 A;  3O62 A;  4KZA A;  4X68 A;  5F99 B;  2Y59 A;  3HUO A;  4OQH A;  1DY6 A;  2ZY3 A;  1P3A D;  3A6N A;  2XK1 A;  3HUN A;  5A93 A;  5DTS A;  3MGP C;  3G31 A;  3H0L C;  1PWG A;  4B4X A;  2FJ7 A;  4ZDX A;  4LV2 A;  4OJL A;  3AZN A;  3W4P A;  1BUL A;  4E3K A;  3LEL C;  1QME A;  2HIO A;  4DE1 A;  3B0C W;  4DRB A;  3NIA A;  4Z5T C;  5HX9 A;  4P0M A;  5GSU C;  3TU4 B;  4OJO A;  1ZG4 A;  3W98 A;  3O3V A;  2F2A C;  3HVF A;  5AV9 C;  4NFT A;  3Q82 A;  1LL9 A;  4DXB A;  1E3U D;  2CC1 A;  3B6G A;  4Y0U A;  4H9Q A;  3UO9 A;  2ZQ8 A;  3LZ1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...