2FFFB

Open form of a class a transpeptidase domain
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
453
structure length
453
Chain Sequence
b'DYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSRRAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords penicillin-binding protein 1B
publication title Structural analysis of an "open" form of PBP1B from Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Membrane protein, transferase
total genus 147
structure length 453
sequence length 453
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2fffB01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2fffB03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2fffB02
1IYOA 1DJBA 3G32A 1LHYA 1KGEA 3DWKA 3QNBA 1IYPA 4JKTA 4BENA 3PBNA 3W8KA 1GA0A 1JWVA 5TFQA 2QZ6A 4DE0A 3UPOA 1GHMA 2UWXA 1HZOA 1SDNA 3G30A 1L0EA 5DTKA 3DW0A 1G68A 4D2OA 4WBGA 3S1YA 3C7VA 3PBSA 2XQZA 2G2UA 3O86A 4N92A 4N9KA 1IYSA 4BL3A 3DWZA 5DF9A 1Q2QA 5KMWA 3QHYA 3Q7VB 2X01A 2QPNA 3C4PA 3FKWA 3Q1FA 4QHCA 2Y2LA 1LL5A 2HP9A 4X68A 4LENA 4ZJ3A 1YMXA 1IEMA 2ZC4B 4FCFA 3VP1A 1EWZA 1XGJA 1H8ZA 1IYQA 2PBYA 2I72A 3BFCA 3OPRA 4BD1A 4GD6A 4JF4A 4RX3A 3W4PA 2Y2KA 1KVLA 3SS3A 2H0TA 4EQIA 1MBLA 2ZQDA 4OOLA 5FI6A 5IHVA 1MPLA 3SH8A 3TOIA 1IKIA 4OP8A 1LL9A 2HDQA 1E3UA 3HLWA 2Y2PA 1YLWA 3ZG5A 4IVKA 3LO7A 1L0GA 1S6RA 4DE3A 4UHUA 1KE0A 3HUOA 4KZ8A 2V2FF 3Q7ZA 4R0QA 2JC7A 3ZNYA 3OCNA 3GVBA 1E3UD 4WM9A 3O3VA 1I2SA 4WMCA 3JYIA 4LV2A 3UPNA 4DDSA 3ZVTA 4JXGA 4PM9A 3GMWA 4YINA 3HLBA 3PBRA 2XLNA 4H8RA 3NIAA 1G6AA 5E43A 5F1GA 2HDUA 1KE4A 3ZG0A 4E3OA 2V20A 4E3KA 2EX2A 2DNSA 3HREA 4LV1A 4IBRA 2WZXA 5FQMA 4RYEA 1L0FA 3IHBA 4K0XA 4XUXA 3RJUA 3IF6B 3UO9A 5HL1A 4MNRA 1KGFA 2XFSA 5FATA 4UAAA 3UY6A 4WELA 4E3MA 3HBRA 2Y2GA 4DE1A 1FR6A 5FAPA 4B4XA 3HUMA 4EWFA 4UA7A 5GLCA 5DTSA 1ZKJA 2E8IA 4KZ6A 3SH9A 4C6YA 5HW3A 3ISGA 4GN2A 1YLPA 3A3EA 1CI9A 4KZ4A 2IWDA 3IWOA 1BLCA 1SHVA 4MLLA 1W7FA 2EXAA 1W79A 2ZC5B 4BL2A 4ID4A 1K6SA 3CJMA 2C5WB 4PM8A 4KG2A 4OPZA 2CC1A 3A3JA 3N7WA 4X53A 1GCEA 4QY5A 3HLFA 5DF8A 4P85A 1MWSA 1PIOA 5G18A 1HVBA 4M3KA 3PBTA 5D3OA 1YT4A 3N6IA 2XEPA 4OPRA 4S2LA 4JF6A 4Y0UA 4BD0A 2BG1A 2DCFA 2P9VA 3C7UA 3A3IA 1K54C 1MWUA 1KGGA 1NRFA 4OPYA 2ZM0A 5FDHA 5GLDA 1KE3A 3SS5A 5M19A 1JTDA 1ONHA 1XGIA 2H5SA 2R9WA 1RP5A 3IWQA 3VOZA 3Q82A 4OQGA 3ITBA 1FQGA 4CJNA 2C6WB 2Y4AA 5E2FA 5JYOA 3IXBA 3I7JA 4HEFA 2RL3A 1MXOA 1CEGA 1YM1A 2Q9MA 4FD8A 4OKPA 5FSRA 4R4RA 3GTCA 4OONA 1XP4A 4LV3A 1N9BA 3FZCA 4PM6A 4EV4A 3BEBA 2WUQA 3BLMA 4F94A 4S2KA 4JLFA 1YMSA 2WGWA 4LCLA 3VP0A 4JXVA 4RVAA 3RXWA 1PW1A 1ZG4A 4OOYA 3BECA 3HUNA 4O7DA 5A92A 1CK3A 1J9MA 3S4XA 4PM5A 5FAQA 3ZGAB 3GV9A 4KQRA 5F1FA 4A5RA 4KG6A 5HARA 3FV7A 5F83A 1ZG6A 4Y0TA 5FQIA 4KG5A 5FQ9A 3IF6C 4PMAA 2P74A 3IF5A 3NDGA 5FQKA 3D4FA 4MBHA 3WRTA 3GQZA 4CPKA 4L0LA 1IKGA 3CZDA 1NY0A 1OMEA 5GLAA 4MBFA 2V1ZA 1JVJA 1VQQA 3BYDA 1IELA 4KZBA 4ZJ1A 2Y2NA 5CGSA 5HAQA 5CEBA 2VGJA 1ONGA 1K25A 3O88A 2PU2A 2JCHA 5HX9A 1PW8A 2HDSA 1NJ4A 3IH9A 1K57C 1S0WA 4WEKA 1EROA 1PI4A 4DXBA 1DJAA 5FAOA 4WZ4A 4WZ5C 1WE4A 4JXWA 5J8XA 1W8YA 3CMZA 3OZHA 2Y55A 4P0MA 5E2HA 5AQBA 2Y2JA 4EUZA 5EVIA 3PBOA 2J9PA 1K55C 2XH9A 4U0TA 2B5RA 1SKFA 3OCLA 5TR7A 1NZUA 3M6BA 3ZG9B 4EBLA 3V5MA 3ITAA 3P09A 3WS4A 2G2WA 5EVID 2WKIA 1W5DA 4QY6A 4QB8A 3ZVWA 3HLEA 1NZOA 4PPRA 3IQAA 2X02A 5I94A 5GLBA 3HL9A 3S22A 4Y7PA 4PM7A 4P6BA 3N8SA 3AGFA 5DTTA 3E2KA 1YLJA 3G35A 1N4OA 4S2NA 3WRZA 3NBLA 2A3UA 2ZQ9A 3UE3A 4WMCD 1JWPA 1HD8A 2Z2LB 5M1AA 1ZC2A 4P87A 4BQMA 3ZFZA 5FI2A 1ERMA 1ALQA 3TSGA 4X69A 3PTEA 4N9LA 2ZLYA 4X56A 3PAGA 3RXXA 3ZG8B 1ES2A 3P98A 2ZJ9A 5FQJA 4E3IA 5EOOA 1XX2A 1K4EA 5A91A 4E6XA 1FCOA 4K0WA 2OSUA 5KSHA 3MFDA 4KQQA 4QD4A 3LY3A 3MXRA 2IWBA 1H8YA 1YLZA 3OC2A 3VFFA 1PWGA 1K56A 1K6RA 4N1XA 2JBFA 2EXBA 4MBKA 3ZG7B 3WS1A 1BLHA 3MZDA 5FQQA 4DF6A 4Q8IA 1PYYA 4FSFA 2OLVA 3GRJA 1TDGA 5CTMA 1E4DA 4WEJA 3GSGA 2WKEA 2RCXA 1K56D 2WGWB 3UPPA 2WAFA 1PI5A 2J7VA 2FFYA 3FYZA 4MEZA 1GA9A 3IXDA 4GB7A 1FSWA 4GZBA 1PZPA 5CHJA 2ZMAA 4DE2A 1RGYA 2EX9A 4OQHA 5FASA 3LCEA 4B88A 2H10A 1NXYA 4EBNA 1O7EA 3VSKA 3M2JA 4LV0A 2Y2MA 3UN7A 5CEDA 1M40A 4JPMA 2XD1A 1YLYA 4ZAMA 5GL9A 4DDYA 1KVMA 2ZC6B 1XA1A 2HP6A 3BLSA 3WS5A 2XFTA 1Q2PA 3OPLA 4JXSA 3NCKA 4KZ3A 3VP2A 1YLTA 3B3XA 1RGZA 1DY6A 3W4QA 3IXHA 5EUAA 3ZNTA 2JE5A 2VGKA 2PU4A 1CI8A 1O07A 3V50A 2H0YA 3M6HA 4FH4A 5A90A 5DF7A 4ZBEA 4Z9QA 1JWZA 2R9XA 4BJPA 4UA9A 1JTGA 1QMFA 3V3SA 1EI5A 2ZQCA 4S2JA 5CTNA 4HESA 3QNCA 3TG9A 1LI0A 1BUEA 4GNUA 4XUZA 1XKZA 1FCNA 3AGDA 1WYCA 3EQUA 5EVIB 3LEZA 1H5XA 3UDFA 5CGXA 3G2ZA 4R23A 2Y2IA 5EVLA 2ZM2A 3A3DA 4R3JA 5CGWA 1BLPA 4UA6A 4XXRA 4OOMA 3DTMA 3W4OA 4E6WA 3MKEA 5CXWA 1PWCA 2EFUA 5EPHA 3A3FA 1I5QA 2OLUA 5GHZA 1ES5A 1WYBA 3MXSA 4U0XA 1LI9A 4GOGA 5CHUA 3AGEA 3IT9A 3O87A 4ZDXA 2WGIA 3WS0A 2WK0A 3VFHA 1KDWA 2WAEA 1AXBA 2XGNA 5EECA 4E3LA 1BT5A 5E2EA 3C4OA 5M18A 2WGVA 1DJCA 1ESUA 5GHXA 1ESIA 3VP4A 1ES3A 4E3NA 2HPBA 5KSCA 3G4PA 1XPBA 4OVDA 5CECA 1Z6FA 2X71A 3PBQA 4KZAA 3V39A 5AQAA 1MWRA 4EBPA 1QMEA 3BFGA 1GHPA 2Y91A 1HTZA 2ZQ8A 2DRWA 5CHMA 5CERA 3PAEA 4OPQA 4K91A 2BLSA 1TDLA 2EFXA 4GDBA 1LLBA 3SS4A 3C5AA 1BULA 4YFMA 1ERQA 4X6TA 4HBUA 3WS2A 3HLGA 5E2GA 3G34A 4OP5A 2GDNA 2Y59A 4S2OA 4JBFA 4QU3A 3M2KA 1I2WA 3FWLA 1SDEA 2ZQ7A 4IBXA 1CEFA 4S2MA 2ZD8A 2J9OA 1Y54A 3IXGA 4KZ7A 3Q7VA 3HVFA 3N4IA 1KDSA 4OQ0A 1U60A 4RX2A 4U3TA 2ZC3B 4OQIA 3ZDJA 1ES4A 4DRTA 4LCMA 1BTLA 2HP5A 5AQ7A 2XK1A 5HAPA 4C3QA 1K38A 5L2FA 2A49A 3G2YA 3ZCZA 1XXMA 2XF3A 5U47A 1TVFA 2P9VB 2ZM8A 4Y0OA 1C3BA 1SCWA 1FSYA 3BFFA 1K54A 3WWXA 1BZAA 3MBZA 5EOEA 5EVIC 3EQVA 1M6KA 2Q9NA 3UNWA 1BLSA 4N1HA 3FKVA 2J8YA 4KENB 5DVAA 4R4SA 2Y2QA 4R1GA 1PWDA 1YQSA 1L0DA 5EE8A 2Y2OA 4OLDA 2XR0A 5GHYA 1PZOA 1GHIA 1BSGA 2EX8A 3SOIA 4GDNA 3VOYA 4OLGA 4RA7A 5F82A 3E2LA 2WKHA 4QJGA 3LY4A 1RCJA 3VP3A 3NC8A 4GD8A 4R3BA 3SH7A 2IWCA 5HAIA 2WADA 3OPHA 4KZ9A 3MKFA 2Z2MB 4S2NC 1FR1A 3Q07A 3VSLA 5AQ9A 4NK3A 1NYYA 1W8QA 2ZC7A 3BM6A 3NDEA 4C75A 2QMIA 3IF6A 3MZEA 2XDMA 5HFOA 2XD5A 1E25A 2WYXA 3BFEA 3GR2A 3UDXA 4BLMA 1MY8A 4NETA 3MZFA 5KZHA 3V3RA 4JF5A 4WYYA 3UE0A 3UDIA 3G31A 3VMAA 4GKUA 3IWIA 1VM1A 3NI9A 4X55A 4DXCA 3CG5A 4S2PA 1K4FA 3IHAA 1TEMA 3N8LA 2ZQAA 5FI7A 3HLCA 5TGFA 2EX6A 4S2IA 1MKIA 3NY4A 4ZTKA 3Q81A 5FA7A 5CRFA 4B4ZA 1K57A 2Y2HA 1XA7A 1FCMA 4IVIA 4OH0A 5A93A 3UE1A 4E3JA 4KZ5A 2OV5A 1NYMA 3IH8A 2WZZA 1MWTA 3BRMA 3N8RA 4WZ5A 4DKIA 4ZJ2A 1L2SA 3OPPA 4FH2A 1FOFA 5JYPA 2HDRA 2FFFB 3ZHHA 5BOHA 1K55A 3BFDA 4KQOA 3HLDA 4IEDA 4HBTA
chains in the Genus database with same CATH superfamily
1YU1A 1M1AB 1IYPA 4JKTA 1P3LA 3PBNA 3W8KA 3KSIA 4NE6A 3LZ1A 3MGSB 2QZ6A 3RTYA 4R8PC 4J8VA 3UPOA 2UWXA 4J8WD 2W27A 5DTKA 5B2IC 1P3LD 3S1YA 5AY8D 2G2UA 3CWFA 4J8VD 3REHC 4N92A 1IYSA 3MQOA 5DF9A 5KMWA 5CX7A 1LT0A 3Q7VB 1ED7A 1TZYA 2O9BA 1LL5A 2HP9A 3VH6W 4X68A 2Z6CA 5DNMD 2PAVP 2W3GA 3L9KA 4LENA 5B1LA 4ZJ3A 1DP9A 2VGLM 4HGAC 2ZC4B 1XJ6A 3AZEC 5CPJC 1TZYD 4J8UB 3REIB 1IYQA 4B93A 4JF4A 4RX3A 3QP5A 1T1CA 1MBLA 4LD9B 1IKIA 5DNND 4IBDA 2J3TD 2Y2PA 2NUPC 3WA9A 1P3KB 2P04A 3W99B 2VLGA 4R0QA 3ZNYA 3AZGD 3HJKA 5B2JA 1I2SA 2DMWA 2VEAA 3JYIA 2JKTM 3WA9D 4LV2A 3L27A 3ZVTA 3GMWA 4H8RA 1YU4A 3B47A 5DNMC 1M19D 3AZHD 3WD0A 4R8PB 2DNSA 5B2JD 1L0FA 1YAXA 3IHBA 2QKPA 1UGUA 3IF6B 1L3LA 4MNRA 5B2IB 3AFAA 4UAAA 4DE1A 4H9SC 1S32A 3KSHA 5DTSA 1ZKJA 3PXPA 1TF1A 5DNNC 3AFAD 1YLPA 2J3TC 4KZ4A 1JFIB 1OTEA 2ZY4A 3O62A 4MLLA 1BYWA 4WU8B 1KX5D 4BL2A 4NZ4A 3W97A 2A24B 3CJMA 3AZKC 4OPZA 1VETA 3AZGC 3KSYA 2F8ND 3O62D 4QY5A 2XA7M 1YU0A 4P85A 1MWSA 5G18A 3W97D 2LY8A 3F1OB 4Y15A 1M19C 3AZHC 4OPRA 3N6IA 1LSXA 4R3AA 4JF6A 4J8WB 2IO5C 2P9VA 3LIAA 1QO6A 1MWUA 2OOLA 3NOUC 2PR6A 2ZM0A 5FDHA 5AY8B 5B24C 4YNRA 5CPKD 4J8VB 2UV0E 4OQGA 3ITBA 1FQGA 4IBEA 2C6WB 4HEFA 1CEGA 4IUKA 4LV3A 3E4OA 2NQBD 3TU4A 5DNMB 2W1RA 3LIEA 4JLFA 1YMSA 2WGWA 1A7WA 2A2LA 4X23D 4OOYA 1TZYB 3BECA 5A92A 3S4XA 4PM5A 3ZGAB 2VGLS 4LGWA 4E44A 3EWKA 4MB3A 5FQ9A 1ID3A 4XZQC 5DNNB 2P74A 3IF5A 2OWJA 3WTPE 5BPVA 3WRTA 3IP4C 2L0WA 5CPKC 5AV6D 1CQAA 5AVCA 1IFQA 4CAYA 1ID3D 4IBCA 1IELA 5IS1A 3AZGB 1G28A 1DRMA 1ONGA 5HX9A 3WA9B 4Z2KA 1PW8A 1GOIA 3WTPC 5AVCD 1NJ4A 2VKSA 3IH9A 2NQBC 4I3AA 3VH5W 1M19B 3AZHB 4DXBA 3R7WA 4JGOA 5B2JB 4X23C 4JXWA 1W8YA 2CWEA 3CMZA 3OZHA 5AQBA 3UT9A 1HTAA 4U0TA 2VX8A 3AFAB 3ITAA 4YOFA 2AROA 5G49A 3WS4A 3MQQA 4QY6A 4QB8A 3ZVWA 4PPRA 1T3UA 1KX5B 3IQAA 5GLBA 5A8BA 5BO0A 2F8NB 3O62B 3N8SA 3WRZA 3W97B 1YPRA 4IBFA 1VETB 3DTIA 3UE3A 5M1AA 2XA7S 4P87A 3ZFZA 4WZSB 1B67A 3TSGA 4N9LA 2ZLYA 2B95A 5CPKB 2MJ6A 1P3PD 5AVFA 1PFLA 1E8BA 5A91A 3H0LC 4DRAA 5KSHA 3MXRA 2NQBB 3VFFA 3LZ0A 1P3GC 2EXBA 2JBFA 3WS1A 4Q8IA 4X23B 1HQ3D 2OLVA 3GRJA 3OBFA 2WGWB 3WAAC 1PI5A 2J7VA 2FFYA 3ULFA 1GA9A 1E6ZA 4AWLB 2BTFP 3HCYA 4HMEA 1RGYA 5C3IC 4OQHA 3LCEA 2H10A 2BYMA 4BWIA 5C5KA 4Z66A 5AV6B 3UN7A 3MFXA 1ID3B 4JPMA 1P3PC 4PHTA 5GL9A 4R38A 1KVMA 2ZC6B 2HP6A 4JXSA 4KZ3A 3NQUA 3VP2A 4Z66D 5AVCB 3W4QA 3IXHA 3ZNTA 5EM0A 2JE5A 4QPRA 2VGKA 2HF6A 1O07A 1AOID 4FH4A 1HQ3C 2KLIA 4EUVA 2BASA 4WNNB 1IOUA 1JWZA 1CK7A 4HIAA 2VV7A 1QMFA 3T4QA 3IBRA 3TE8A 3KYEA 5CTNA 1K0KA 3QNCA 4JGQA 1BUEA 5AV5C 4XUZA 3AGDA 1F2KA 3LEZA 3AZJA 2V9AA 3LEQA 3UDFA 5EVLA 2Y2IA 5CGWA 4XXRA 2H28A 4OOMA 3QP1A 5G49B 3P7NA 4U0XA 4UUZB 4Q0HA 1LI9A 1KX3A 3AYWA 1EQZA 4E04A 2PYOD 4ZDXA 1AOIC 3VFHA 1AXBA 4IBBA 1BT5A 4ZBJC 2YKFA 1EQZD 5GHXA 1ES3A 1P3PB 5CECA 2V1BA 3MR0A 1A0KA 3WD1A 1MWRA 3LI9A 3BFGA 2DRWA 2ZBBA 3PAEA 3FPWA 2BLSA 1TDLA 3ICYA 3JVVA 3C5AA 1BULA 5E2GA 3G34A 3LJAA 4OP5A 5FL3A 1HQ3B 3M2KA 1I2WA 1SDEA 2ZQ7A 3T4OA 1CEFA 4KZ7A 1Y54A 3IXGA 2QJ7A 3AV2A 3ZDJA 2ZC3B 2PYOC 1ES4A 3IBJA 5AQ7A 4WF0A 1K38A 3EPKA 1FIKA 1BFMA 3AV2D 5KIZA 1GPFA 1C3BA 4MCWA 1FSYA 3KYQA 1K54A 2R78A 1BZAA 5EVIC 1OJ5A 2Q9NA 5HWVA 5BT1C 1UWNX 4Z66B 3R45B 4J8XC 4KENB 1U35A 4NKPA 5L8MA 5B40A 5B0YA 5KDMA 2Y2QA 1P3IA 5HWWA 3DAVA 5E5AA 1AOIB 1PZOA 1BSGA 5F99A 3UMEA 1WWIA 1U35D 3MNNC 5B0YD 4ZBJB 3LI8A 1P3ID 4I39A 4R3BA 3AV1A 5E5AD 4QLCA 3LIDA 5F99D 2Z2MB 3VSLA 4H9QA 2ZC7A 3BM6A 1STZA 3ZQ5A 3MGRC 3AV1D 2HJEA 5HFOA 2XD5A 4QLCD 3RFBA 4DJ3A 3UDXA 1MY8A 3MZFA 4JF5A 4O0PA 4WYYA 3A0SA 3G31A 4CLCC 4GKUA 3KXBC 3IWIA 3QP8A 3KUYC 3NI9A 3QP6A 1SKOA 4R70A 1E6PA 1OTAA 2I9VA 3U2AA 2PYOB 1E6RA 5AV9D 3LYXA 3Q81A 5GSUA 5B32D 3AZIC 2HIOD 1XA7A 4IVIA 2OV5A 1X0OA 1EQZB 1N9LA 3N8RA 3X1SD 5EFWA 2FJ7A 1P3FD 1W1VA 1L2SA 4G3VA 5GSUD 1V9ZA 5JYPA 5FUGB 2VA0A 4R6LA 1K55A 4UEYA 2RVQD 3HLDA 4HBTA 3LR5A 4J8XB 3E0YA 3DWKA 2FJ7D 1S1ZA 5CP6C 1XFNA 3MGQA 5TFQA 4OJPA 1N1JA 4NYYA 1OGBA 3W2ZA 2W3HA 1G68A 3AZLA 3KS4A 2F8NH 1KS0A 3MF0A 4WBGA 4D2OA 3MGQD 1XJ3A 2XQZA 5AV9C 3L29A 4BL3A 5B32C 1P3BA 3DWZA 4HI4A 4Z2LA 3AV2B 3FKWA 1P34A 3X1SC 4QHCA 1P3FC 1S67L 3NOPC 5GXQA 3EPLA 1M18A 4FCFA 2BYKA 4K08A 4UQIM 3VP1A 5L09A 1EWZA 1P34D 1XGJA 2W3DA 3BWLA 2I72A 4GD6A 4Z2HA 1P3OA 5GXQD 3WX7A 2WKQA 3E4PA 3W4PA 1KVLA 3SS3A 5KZHA 3E98A 4OOLA 4OP8A 2ZM5A 2KX6A 4L9GA 1U35B 3OLOA 2G5IC 5B0YB 1E3UA 2HDQA 5F68A 1P3OD 1P3IB 1BH9A 5B33A 3ZG5A 3LFVA 3PR6A 2F8NG 5AVBC 4NZ3A 5F99B 3LGOA 3OCNA 1E3UD 5BNVA 1T18A 4WMCA 3UPNA 4DDSA 4JXGA 2JKTI 4YINA 3AV1B 5B31A 4QLCB 3NIAA 5E43A 5F1GA 1KE4A 4E3OA 5JA4A 3HREA 4EXOA 4H9QB 4GW9A 4II7A 3UO9A 4NZ5A 2ZOHA 4ZUXA 2XFSA 2D49A 1XJ2A 3MS6A 4WELA 4E3MA 3HBRA 3A6NA 4BMWA 4B4XA 3HUMA 4PKYA 5AV9B 4GS9A 4UA7A 3H7WA 5GLCA 2DF4C 4NXBA 4Y17A 3SH9A 5HW3A 4H9NB 5B32B 2HIOB 3AN2A 2D02A 3D9YA 4GN2A 1CI9A 1SKOB 2IWDA 1BLCA 3X1SB 2EXAA 1P3FB 1W79A 3NULA 4ID4A 5GSUB 3NOTC 3AN2D 4PM8A 4KG2A 3LR3A 2CC1A 3V67A 1T1AA 4NXFA 1VEUA 1GCEA 3HLFA 2FJ7B 2QHKA 2Y8HA 3UTAA 1WWSA 4S2LA 3REIC 3NJAA 2O9AA 3C7UA 3A3IA 4WUJA 5GLDA 3MGQB 1Q9CA 3SS5A 3H0MC 4G91B 3UTAD 4JJNC 4LD9C 3WKJD 1OT6A 2Y4AA 5E2FA 3KSGA 3IXBA 4HNBA 4BBTA 3AZFA 1MXOA 3C1BA 1YM1A 4FD8A 4OKPA 5FSRA 4G3WA 1GSXA 1XP4A 3W96D 3W99C 4HMCA 3FZCA 4PM6A 3BLMA 4NE5A 4S2KA 3EEAA 4JXVA 2HZ5A 3AZFD 2VJWA 3RXWA 3C1BD 1P34B 4WJ3C 4HHDA 3T1RA 1CK3A 3CLOA 3VOLA 3GV9A 5GXQB 1J7MA 4NEED 3D3OA 5HARA 3KS8A 3FV7A 4Y0TA 2OAP1 3IF6C 3X1UA 1T1BA 3LZ1D 1P3OB 4NXEA 1G5UA 4MBHA 5B1MA 1SZVA 3CZDA 4KGCA 3CUEA 4MBFA 3N3FA 3WKJC 2V5OA 2JN7A 2F8NK 4ZJ1A 4GH9A 5CGSA 5CEBA 1BH9B 2VGJA 1K25A 2HDSA 4WU8C 4KGCD 4NG2A 3W96C 1K57C 4WEKA 1PI4A 2W3EA 5FAOA 4MN5A 4WZ4A 3U4LP 4WZ5C 2ZY5A 1WE4A 5J8XA 4EUZA 5B1LD 4EO5B 2B5RA 4JJNB 4J8WC 5F6AA 5TR7A 3M6BA 3C1CA 5I5LA 3V5MA 1P3LC 3LZ1C 5AY8C 5HD5A 4J8VC 4GS9B 3H7WB 3UB6A 4YM6A 3QP2A 3AN2B 2PD7A 4IBGA 1F66A 5DTTA 4YM6D 4H9PA 3G35A 3AZNA 3EPHA 1N4OA 1Z09A 3NBLA 4S2NA 5J4EA 1TZYC 2V0UA 5FI2A 1F66D 1ERMA 2WKPA 2Z6DA 5B1LC 3PAGA 3UTAB 3P98A 3WKJB 4E3IA 1OJGA 3K3DA 1XX2A 2YFWA 1FCOA 5GT3A 1S32D 3CPTA 4LG2A 3LY3A 4GCZA 3W96B 2FH5A 1ZLAA 5AJGA 2M7VA 1K56A 1K6RA 5GT3D 3AZFB 3WA9C 3MZDA 5G4YA 4DF6A 3C1BB 4FUWA 4EU0A 1ZLAD 2RCXA 1K56D 3UPPA 2WAFA 5B2JC 1OTIA 1FSWA 2NZDA 3S7QA 1P3LB 3LZ1B 1NXYA 1O7EA 3VSKA 1KU5A 3M2JA 4LV0A 2F2AC 2VZWA 2W0NA 2NZDD 1M40A 1YLYA 3AFAC 4HMDA 2ZOIA 1VHMA 2CV5A 1S32C 4MN6A 4KGCB 1KX5C 4DMZA 5FEGA 2L4RA 4OUIA 5EUAA 2PR5A 2CV5D 3O62C 2H0YA 5A90A 1MZUA 5BS7A 1H0GA 3WTPA 3TU4D 2XSSA 2O9CA 3W97C 4LLOB 5B1LB 4ARZA 4E45A 3EOIA 1GSVA 1JTGA 2J80A 4Z5TA 3V3SA 1EI5A 3VV4A 2PT7A 1TD5A 4HESA 3H82A 3BQ8A 1LI0A 1B6WA 4Z2GA 3NHQA 1H5XA 4Z5TD 2RIQA 4R23A 3A3DA 3W4OA 4UA6A 3DTMA 4E6WA 3MKEA 5BNXA 2PRFA 1KOUA 2OLUA 4QNLA 1WYBA 3MXSA 4YM6B 5CHUA 1TS7A 4WU9A 3JPUA 1DP8A 1F66B 3TU4C 4H9PB 5E2EA 5M18A 4UPKA 1YUEA 5K5BA 2HPBA 4AWLC 3G4PA 3PBQA 3UT9D 4KZAA 3V39A 4OJ6A 3PYPA 1S32B 5HPFA 1HTZA 5AV6C 5DFYA 5CERA 2OWHA 1ID3C 2AROD 2YFWB 1ERQA 4G3KA 1JNUA 4X6TA 4H9RA 3HLGA 5GT3B 3WS2A 2P7JA 2FN2A 3CPTB 5AVCC 5HDDA 4JBFA 4I3IA 4QU3A 3FWLA 2JSSA 1ZLAB 3EGDC 3IS2A 3P01A 4C75A 3RJUA 3EEHA 4RX2A 4U3TA 3HVFA 3N4IA 4OQ0A 3TW8A 4WLAA 5CHLB 1BTLA 1OPXA 2G7UA 2XK1A 5HAPA 2KOIA 1H3QA 2A49A 4DJ2A 2JKRI 2XF3A 5U47A 4Z2MH 2P9VB 5AV8A 2NZDB 4GHAA 1SCWA 3UT9C 3MBZA 1YU3A 3EQVA 3UNWA 4CSRA 1BLSA 2O99A 1PRQA 3AZMA 5DVAA 5AV8D 5B32G 2ZY3A 4R1GA 2AROC 1T19A 2CV5B 1F98A 4OLDA 5CPIA 3TU4B 3AZMD 3LZ0D 5F82A 3T1XA 1RCJA 4GD8A 1DP6A 3K3CA 1CF0A 5HAIA 5HPIA 4KZ9A 3L26A 3Q07A 5AQ9A 4NK3A 3REJA 4Z5TB 1NYYA 3NDEA 3LR0A 3MZEA 3JVUA 1KX4A 4EEUA 5HD3A 4BLMA 1NRJA 4Z2MG 3MSHA 3UDIA 4MB5A 3VMAA 3REJD 4YWZA 4CAYB 1VM1A 1P97A 1E88A 4DRBA 3H0RC 2RTSA 3IX3A 1KX4D 4S2PA 1YSPA 2K2NA 2L1MA 5BNXB 4Z2JA 3F1PA 5GT0A 3RH8B 4ZTKA 4B4ZA 3LZ0C 2PBDP 3S7PA 4E3JA 4KZ5A 3R7WB 1P3AA 2WZZA 1N9NA 2QWSA 3LIFA 4ZJ2A 5GT0D 3UT9B 3OPPA 2HDRA 3BFDA 3TG9A 1P3AD 4IEDA 1IYOA 1DJBA 1LHYA 1KGEA 3QNBA 2YKHA 4BENA 1GA0A 2AROB 1E6NA 4DE0A 3AZJD 2IOUA 1ACFA 1GHMA 4Z66C 4GJ4A 1L0EA 4GHIA 4YS3A 3DW0A 2QJ5A 5BO0B 4IJFA 3C7VA 3PBSA 4H9RB 1D1JA 3O86A 5MC7A 4N9KA 4YS3D 3IS2B 1KX3D 3AYWD 1F9IA 2X01A 2XRNA 5HSQA 1OT9A 3T12B 3QP4A 2W1TA 4BD1A 1H8ZA 3KWQA 3BFCA 5AV8B 2HJ9C 1F1EA 2HUEC 4Y13A 4AFIA 3AZJC 4EQIA 5FI6A 4CSRB 2V8CA 4ZRRA 3SH8A 3TOIA 3KWQD 3AZMB 3LZ0B 3MGPA 4X1LA 1WA9A 1YKDA 2PD8A 3LO7A 3LJAD 1S6RA 2ZMVA 4DE3A 1N9OA 2Y79A 4KZ8A 3NECA 2D01A 3CITA 5FDSA 2JKRM 2GJ3A 2JC7A 3CI6A 1KX3C 3AYWC 1EQZC 3EG5B 4PM9A 3PBRA 2HDUA 1D06A 2BYMB 1UR8A 4MDZA 3LELA 3X1VA 2XROA 1P3MA 4IBRA 1G6OA 2VQRA 3REJB 4RYEA 4LRYC 1KGFA 2E8JA 5FATA 2PYRA 1KX4B 3UY6A 3SZTA 1FR6A 3LELD 3NQUB 5B40D 3ISGA 3UB8A 2NUTC 1LSWA 1ZTUA 3F1PB 3NQJA 1W7FA 5GT0B 4CLCE 1K6SA 1F5MA 3AV2C 3A3JA 2VV8A 4JGRA 5DF8A 2HUEB 4ME4A 1PIOA 4CQHA 1HVBA 3CHWP 3AZJB 3PBTA 3B6FA 2XEPA 4Y0UA 3C8CA 2DCFA 3REKA 1LL8A 1K54C 1KGGA 4OPYA 1KE3A 2QYBA 3IWQA 3B6FD 3VOZA 3DTEA 5DJTA 1U35C 4GHIB 3REKD 1EAKA 4CJNA 5B0YC 5JYOA 3I7JA 1KX3B 1P3IC 3AYWB 2G5HC 2RL3A 5E5AC 4OONA 5F99C 1N9BA 4F94A 4XUJA 2EA9A 3UB7A 4LCLA 4RVAA 3W98A 4H6JA 3AV1C 3HUNA 3HSHA 4QLCC 4L9EA 3X1TA 4XUJD 5F1FA 4KG6A 2W1TB 3BW6A 5FQIA 4KG5A 1TS6A 3KWQB 4I3JA 4FOFA 3NDGA 5FQKA 3D4FA 3GQZA 1IKGA 3LJAB 1OMEA 4G92C 4KUDA 2V1ZA 3UTBA 2HIOC 3BYDA 3AZLD 4KZBA 5HAQA 5JRGA 4BBVA 2PU2A 2ZMFA 3D72A 2M7UA 4LRZE 5GSUC 1P3BD 1S0WA 1EROA 3B6GA 1DJAA 2RVQC 5JRGD 3E4QA 5EM1A 2FJ7C 2PHYA 4P0MA 3VE4A 2Y55A 1NLZA 2Y2JA 4P6ZM 1M18D 3B6GD 2J9PA 1K55C 3PBOA 3LELB 1SKFA 3OCLA 4KUOA 3UB9A 1M1AA 5B40B 1NZUA 4HP4A 4EBLA 5KDMB 3P09A 3MGQC 3MGSA 2WKIA 4G91C 1W5DA 5E5AB 4PAUA 5B33D 3G6OA 4PM7A 3NQJB 3E2KA 1W63M 3EGXC 3MVDA 1P3BC 4M6BA 4TX8A 4LPZA 3T50A 2ZQ9A 4WMCD 1HD8A 2Z2LB 1S1YA 1P34C 1ZC2A 4BQMA 5B31D 5TBMA 5GXQC 3PTEA 3MVDD 3RELA 1CJFA 1M18C 5L10A 3B6FB 4G92B 3WD2A 2ZJ9A 4J8UA 1UWPX 4ZUXD 5EOOA 1P3OC 4E6XA 3A6ND 2OSUA 1H3OA 3RELD 4QD4A 4X1MA 3OC2A 1PWGA 3ZG7B 3VH6A 5B0ZA 5B33C 1PYYA 4FSFA 1P3KA 1E4DA 4XUJB 4WEJA 3GSGA 1O6IA 1W2EA 3FYZA 5B0ZD 4MEZA 4GB7A 4H6JB 5CHJA 4DE2A 5FASA 5B31C 2V8FA 4EO5C 3B0CT 2LB9A 3IX8A 3DBAA 3PHYA 4R8PA 1N1JB 1XFQA 5DJUA 2XD1A 4ZUXC 3AZLB 5B2IA 2INWA 4DDYA 3WS5A 4ETXA 3OPLA 3A6NC 3REHA 3T4KA 4IJGA 1YLTA 1BH8A 3B3XA 1P3BB 3AN2C 1RGZA 4NE3A 5JRGB 2PU4A 1CI8A 3V50A 3REHD 5DF7A 4BJPA 2A24A 2JKFA 3IX4A 1M18B 3B6GB 4UQIS 2BYKB 3AZEA 5CPJA 5EV0A 4S2JA 1OGGA 4P6ZS 4GNUA 1FCNA 2B18A 1WYCA 3B0BA 3UTAC 3F1NA 3AZED 5CPJD 1TAFA 2ZM2A 1BLPA 3X1UD 4NYUA 1Y28A 3BQAA 5B33B 3T1SA 5B1MD 5AY8A 1NWZA 1I5QA 1ULYA 3T4TA 4GOGA 5BNVB 3HONA 3AZFC 3IT9A 3O87A 2WGIA 3C1BC 3WS0A 5B31B 1KDWA 2WAEA 5EECA 5DNMA 3MVDB 3B0DC 5JA4B 1ESUA 2WGVA 3VP4A 4E3NA 5KSCA 2HV1A 4OVDA 4ZUXB 1Z6FA 5F5YA 4QWOA 5TBMB 4KHAA 5AQAA 3A6NB 4EBPA 4H9SA 3RELB 5CHMA 3C2WA 1R4VA 4M4XA 4GDBA 3C1CD 5DNNA 1LLBA 3X1UC 3T4JA 1PZRA 3A0VA 1H3OB 5B1MC 4HP9A 2OAQ1 4MMNA 4KGCC 2GDNA 3CUEC 4S2OA 2AVXA 4S2MA 1OTBA 4IBXA 2J9OA 3AZKA 3WD4A 1KDSA 3AZGA 1U60A 4OQIA 5B0ZB 1VEUB 4DRTA 2HP5A 2FZ0A 3AZND 5L2FA 3G2YA 1M19A 3AZKD 3AZHA 3ZCZA 1XXMA 1V9YA 3KFUG 1W63Q 1TS0A 2ZM8A 4MN7A 4Y0OA 3LR4A 3VH6T 5B24A 3FKVA 4I38A 4GLQA 3C1CC 5B24D 1YQSA 3VH5A 5GHYA 4KUKA 2IA2A 3REHB 1GHIA 2EX8A 3LICA 1KX5A 4YM6C 1BH8B 4NZ1A 4OLGA 2WKHA 3B0DB 3LY4A 3SH7A 4EESA 2F8NA 1F66C 2WADA 1OTDA 2GNXA 3MKFA 3AZNC 4S2NC 1FR1A 4HGAB 2YFVA 1W8QA 2ZY2A 3AZEB 5FEFA 5CPJB 2QMIA 4XZQA 3X1UB 2WYXA 3BFEA 3GR2A 2JHEA 5B1MB 5CPKA 3F1NB 2VV6A 1TAFB 2W8SA 4XZQD 3MJQA 4HJ4A 4X55A 4DXCA 3IHAA 1TEMA 5GT3C 3S7NA 2EX6A 2W3FA 4IUHA 5FA7A 1ZLAC 2NQBA 2Y2HA 1NYMA 3IH8A 1CXWA 4X23A 4DKIA 3WTPD 1S4SA 4FH2A 2FFFB 4WN5A 3G32A 2NZDC 3FKEA 3C1CB 5DFXA 4KHAB 1JWVA 5G4ZA 4HJ6A 3T4SA 3G30A 1HZOA 1SDNA 5AV6A 4XT2A 4O8GA 2CV5C 3AZNB 1Q2QA 5HZHA 3QHYA 3AZKB 2QPNA 4WU9D 3C4PA 3Q1FA 3P5JB 4Q0IA 2Y2LA 5BS7C 4WNNA 1MKMA 1IEMA 1YMXA 2GZAA 5J7EA 3FC7A 4Z5TC 3BY9A 2PBYA 2IO5B 3OPRA 3L2AA 4DQYB 4I5SA 4EEPA 3T4LA 2Y2KA 5B24B 2H0TA 2ZQDA 5IHVA 1MPLA 4OJOA 1GSWA 1LL9A 3HLWA 4H9OA 1P3GA 4EW7A 1YLWA 4IVKA 1L0GA 2P08A 4UHUA 1KE0A 3HUOA 1H8MA 4UUZA 2V2FF 3Q7ZA 3GVBA 4WM9A 1P3GD 3R4KA 3WAAA 3O3VA 4MB4A 4WU9C 4RQ9A 1ODVA 3HLBA 2XLNA 1G6AA 3ZG0A 2V20A 4WL9A 3M7PA 4E3KA 2EX2A 4LV1A 3VH5T 3WAAD 2YFVB 2K7SA 2WZXA 5FQMA 4XUXA 4K0XA 5HL1A 4XZQB 1P3PA 4WV4B 2Y2GA 1Y4OA 5FAPA 4EWFA 2PDRA 4ESPA 3WD3A 2E8IA 3B42A 4KZ6A 4C6YA 3A3EA 1FILA 3IWOA 1SHVA 5CPID 1AIWA 1HQ3A 4X25A 2ZC5B 3WTPB 4ARZB 2C5WB 1H0MA 3N7WA 4X53A 4IBJA 3H82B 3KSFA 4HY8A 4LRXC 5AV5A 4M3KA 5D3OA 1YT4A 3FDDA 4BD0A 4ETZA 2BG1A 5AV8C 5AV5D 1NRFA 2ACGA 3UE6A 5M19A 1JTDA 1ONHA 1XGIA 2H5SA 2R9WA 1RP5A 3TJZC 3Q82A 3R45A 4FTXA 3AZMC 4XT2B 2V1AA 2Q9MA 4WU9B 5CPIC 1AOIA 4O01A 3GTCA 4R4RA 1D7EA 4EV4A 2V0WA 3BEBA 2J3WA 2WUQA 3VP0A 1PW1A 3BY8A 1ZG4A 2Q0OA 4O7DA 1J9MA 5FAQA 4KQRA 5DKLA 1P0ZA 4A5RA 3REJC 4Q0JA 5DKKA 5F83A 1ZG6A 3O5YA 4PMAA 5HL6A 1KX4C 1W1YA 3GECA 4CPKA 4L0LA 1NY0A 5GLAA 3MQ0A 1S4RA 3VE3A 1JVJA 1VQQA 3L25A 2M1CA 2Y2NA 3K2NA 4H9OB 1P3GB 4HOIA 1GXDA 3O88A 2JCHA 2PYOA 4JGPA 5GT0C 5B31G 1P3AC 3WAAB 1VB6A 2EWWA 5C3IB 4IHQA 5E2HA 4HH2A 3ZYTA 5FUGA 5EVIA 2XH9A 3C30A 2J8PA 4PKYG 4J8XA 3A1IA 3ZG9B 3DTKA 3EPJA 2G2WA 4HQAA 5EVID 5BT1D 1LSVA 5CPIB 3HLEA 5TJJA 1NZOA 4J8XD 2X02A 4YS3C 1H8PA 5I94A 3MNNA 3MGPD 2CMNA 5AVEA 3HL9A 3S22A 4Y7PA 1PDCA 3MQLA 4P6BA 3AL0C 3AGFA 1MC0A 1YLJA 2LB5A 3MNND 2A3UA 1JWPA 3V9RA 3MGRA 4F3LA 2ZL1A 1ALQA 4X69A 3LIBA 5AV5B 3BJNA 4X56A 3X1VD 2PYPA 1P3MD 3B33A 3RXXA 3ZG8B 4CLCA 3KXBA 1ZHHB 1ES2A 3MGRD 3KUYA 3KWQC 2B02A 5FQJA 1K4EA 4D60A 5J3WA 4K0WA 3MMHA 3LJAC 3MFDA 4KQQA 4CLCD 3KXBD 3KUYD 3AZIA 3HJIA 1H8YA 1YLZA 2IWBA 3MGPC 1W1PA 1S66L 4N1XA 3T1QB 4MBKA 1P3AB 3F6TA 1BLHA 5FQQA 1TDGA 5HDSA 3AZID 5CTMA 2WKEA 1P9RA 4OJ5A 3IXDA 4GZBA 1PZPA 1XJ4A 2ZMAA 2EX9A 4B88A 5CP6A 2VK3A 4EBNA 4NXGA 3LELC 4EETB 3X1VC 1P3MC 1YSQA 1NLYA 3TRCA 2Y2MA 5CEDA 5B40C 4YS3B 4ZAMA 1XA1A 3BLSA 5CP6D 2DQNC 2XFTA 1Q2PA 3OOVA 3NCKA 5HDCA 5AV9A 4H9NA 5B32A 3FG8A 2HIOA 1DY6A 2KDKA 3SW1A 1H0IA 3X1SA 3M6HA 1P3FA 4IBKA 4ZBEA 4Z9QA 2R9XA 2JKGA 4UA9A 3W98D 1PNEA 2ZQCA 4KQDA 4Z1WA 3X1TD 1L6JA 1XKZA 3EQUA 3FPVA 5EVIB 5CGXA 3B6FC 3G2ZA 1AWIA 4R3JA 3REKC 3MGPB 5CXWA 1PWCA 2EFUA 3A1KA 5EPHA 4LFUA 3A3FA 5GHZA 5AVBA 4KUDD 1ES5A 3UTBD 3MNNB 4DN0A 3AGEA 4EQ1A 4GHLA 1J3WA 2WK0A 1P9WA 5AVBD 4E3LA 2XGNA 4NFTA 1W1TA 4XUJC 1YU2A 3C4OA 1EW0A 1E15A 3X1VB 1P3MB 3W98C 1DJCA 1ESIA 3V9RB 3MGRB 1XPBA 3C38A 2X71A 4F3LB 4HJ3A 2ZL1B 4OJLA 3X1TC 2HGVA 1QMEA 1GHPA 2Y91A 2GX5A 2ZQ8A 4CLCB 3CAXA 4OPQA 4K91A 3KXBB 1M1AD 3UB5P 2L5AA 2EFXA 3MXQA 3KUYB 3AZLC 3LUQA 5EVEA 3SS4A 2EWVA 4YFMA 3MGSD 4HBUA 1TS8A 4L9FA 2WKRA 4IBIA 4Z2IA 2Y59A 4KUDC 3UTBC 3AZIB 2ZD8A 2K31A 3Q7VA 5JRGC 3KO6A 4LCMA 3B0CW 1HLUP 4C3QA 4Y3IA 3B6GC 3L7HA 3REIA 1TVFA 3REKB 5LBRA 3KX0X 3BFFA 5IT5A 3WWXA 5CP6B 5EOEA 3A0RA 1M6KA 4JJNA 4LD9A 4N1HA 2J8YA 4J8UD 3REID 1M1AC 4R4SA 3MGSC 3GDIA 1PWDA 1UR9A 1L0DA 5EE8A 2Y2OA 2XR0A 4JJND 4LD9D 3SOIA 3W99A 4GDNA 5HWTA 3VOYA 4RA7A 3E2LA 4QJGA 3VP3A 4IJEA 3W98B 3NC8A 5IU1A 2IWCA 1P3KD 3OPHA 3W99D 3X1TB 4Y5FA 3S7OA 3MVDC 4BBUA 3H9WA 3IF6A 2XDMA 1E25A 4NETA 3RELC 3V3RA 4R8PD 3UE0A 3UMDA 5F69A 4KUDB 3WKJA 3UTBB 4J8UC 3L28A 4HH3A 4EERA 5B2ID 3CG5A 1K4FA 1JFIA 3N8LA 2ZQAA 5L07A 5FI7A 3HLCA 5TGFA 4WU8A 4S2IA 4NY2A 1MKIA 5AVBB 3NY4A 3W96A 3KYZA 5CRFA 1K57A 1Z2CB 1FCMA 4OH0A 5A93A 3UE1A 5B0ZC 1MWTA 3BRMA 4WZ5A 4Y2FA 4B9OA 4WU8D 1P3KC 1FOFA 3F1OA 2O0YA 3ZHHA 5BOHA 4KQOA 4J8WA
chains in the Genus database with same CATH topology
1YU1A 1M1AB 1IYPA 4JKTA 1P3LA 3PBNA 3W8KA 4NE6A 3LZ1A 3MGSB 2QZ6A 4R8PC 4J8VA 3UPOA 2UWXA 4J8WD 5DTKA 5B2IC 1P3LD 3S1YA 5AY8D 2G2UA 4J8VD 3REHC 4N92A 1IYSA 5DF9A 5KMWA 3Q7VB 1TZYA 1LL5A 2HP9A 3VH6W 4X68A 5DNMD 4LENA 5B1LA 4ZJ3A 4HGAC 2ZC4B 3AZEC 5CPJC 1TZYD 4J8UB 3REIB 1IYQA 4JF4A 4RX3A 1MBLA 4LD9B 1IKIA 5DNND 4IBDA 2Y2PA 3WA9A 1P3KB 3W99B 4R0QA 3ZNYA 3AZGD 5B2JA 1I2SA 3JYIA 4LV2A 3WA9D 3L27A 3ZVTA 3GMWA 4H8RA 1YU4A 5DNMC 1M19D 3AZHD 4R8PB 2DNSA 5B2JD 1L0FA 3IHBA 3IF6B 4MNRA 5B2IB 3AFAA 4UAAA 4DE1A 4H9SC 1S32A 5DTSA 1ZKJA 5DNNC 3AFAD 1YLPA 4KZ4A 1JFIB 2ZY4A 3O62A 4MLLA 4WU8B 1KX5D 4BL2A 4NZ4A 3W97A 3CJMA 3AZKC 4OPZA 3AZGC 3KSYA 2F8ND 3O62D 4QY5A 1YU0A 4P85A 1MWSA 5G18A 3W97D 2LY8A 1M19C 3AZHC 4OPRA 3N6IA 4JF6A 4J8WB 2IO5C 2P9VA 1MWUA 2ZM0A 5FDHA 5AY8B 5B24C 5CPKD 4J8VB 4OQGA 3ITBA 1FQGA 4IBEA 2C6WB 4HEFA 1CEGA 4LV3A 2NQBD 3TU4A 5DNMB 4JLFA 1YMSA 2WGWA 1A7WA 4X23D 4OOYA 1TZYB 3BECA 5A92A 3S4XA 4PM5A 3ZGAB 4E44A 5FQ9A 1ID3A 4XZQC 5DNNB 2P74A 3IF5A 3WTPE 5BPVA 3WRTA 3IP4C 5CPKC 5AV6D 5AVCA 4CAYA 1ID3D 4IBCA 1IELA 3AZGB 1ONGA 5HX9A 3WA9B 1PW8A 3WTPC 5AVCD 1NJ4A 3IH9A 2NQBC 3VH5W 1M19B 3AZHB 4DXBA 5B2JB 4X23C 4JXWA 1W8YA 2CWEA 3CMZA 3OZHA 5AQBA 3UT9A 1HTAA 4U0TA 3AFAB 3ITAA 2AROA 5G49A 3WS4A 4QY6A 4QB8A 3ZVWA 4PPRA 1T3UA 1KX5B 3IQAA 5GLBA 5BO0A 2F8NB 3O62B 3N8SA 3WRZA 3W97B 4IBFA 3UE3A 5M1AA 4P87A 3ZFZA 4WZSB 1B67A 3TSGA 4N9LA 2ZLYA 5CPKB 1P3PD 5A91A 3H0LC 4DRAA 5KSHA 3MXRA 2NQBB 3VFFA 3LZ0A 1P3GC 2EXBA 2JBFA 3WS1A 4Q8IA 4X23B 1HQ3D 2OLVA 3GRJA 2WGWB 3WAAC 1PI5A 2J7VA 2FFYA 1GA9A 4AWLB 1RGYA 5C3IC 4OQHA 3LCEA 2H10A 2BYMA 4Z66A 5AV6B 3UN7A 1ID3B 4JPMA 1P3PC 5GL9A 1KVMA 2ZC6B 2HP6A 4JXSA 4KZ3A 3NQUA 3VP2A 4Z66D 5AVCB 3W4QA 3IXHA 3ZNTA 2JE5A 2VGKA 1O07A 1AOID 4FH4A 1HQ3C 4WNNB 1JWZA 1QMFA 5CTNA 3QNCA 1BUEA 5AV5C 4XUZA 3AGDA 3LEZA 3AZJA 3UDFA 5EVLA 2Y2IA 5CGWA 4XXRA 4OOMA 5G49B 4U0XA 4UUZB 1LI9A 1KX3A 3AYWA 1EQZA 2PYOD 4ZDXA 1AOIC 3VFHA 1AXBA 4IBBA 1BT5A 4ZBJC 1EQZD 5GHXA 1ES3A 1P3PB 5CECA 1MWRA 3BFGA 2DRWA 3PAEA 2BLSA 1TDLA 3C5AA 1BULA 5E2GA 3G34A 3LJAA 4OP5A 1HQ3B 3M2KA 1I2WA 1SDEA 2ZQ7A 1CEFA 4KZ7A 1Y54A 3IXGA 3AV2A 3ZDJA 2ZC3B 2PYOC 1ES4A 5AQ7A 1K38A 3EPKA 1BFMA 3AV2D 1C3BA 1FSYA 1K54A 1BZAA 5EVIC 2Q9NA 5BT1C 4Z66B 3R45B 4J8XC 4KENB 1U35A 5B40A 5B0YA 5KDMA 2Y2QA 1P3IA 5E5AA 1AOIB 1PZOA 1BSGA 5F99A 1WWIA 1U35D 3MNNC 5B0YD 4ZBJB 1P3ID 4R3BA 3AV1A 5E5AD 4QLCA 5F99D 2Z2MB 3VSLA 4H9QA 2ZC7A 3BM6A 3MGRC 3AV1D 5HFOA 2XD5A 4QLCD 3UDXA 1MY8A 3MZFA 4JF5A 4WYYA 3G31A 4GKUA 3KXBC 3IWIA 3KUYC 3NI9A 2PYOB 5AV9D 3Q81A 5GSUA 5B32D 3AZIC 2HIOD 1XA7A 4IVIA 2OV5A 1EQZB 3N8RA 3X1SD 2FJ7A 1P3FD 1L2SA 5GSUD 5JYPA 5FUGB 1K55A 3HLDA 2RVQD 4HBTA 4J8XB 3DWKA 2FJ7D 5CP6C 3MGQA 5TFQA 4OJPA 1N1JA 4NYYA 1G68A 3AZLA 3KS4A 2F8NH 4D2OA 4WBGA 3MGQD 2XQZA 5AV9C 3L29A 4BL3A 5B32C 1P3BA 3DWZA 3AV2B 3FKWA 1P34A 3X1SC 4QHCA 1P3FC 5GXQA 3EPLA 1M18A 4FCFA 2BYKA 3VP1A 1EWZA 1P34D 1XGJA 2I72A 4GD6A 1P3OA 5GXQD 3WX7A 3W4PA 1KVLA 3SS3A 5KZHA 4OOLA 4OP8A 2ZM5A 1U35B 2G5IC 5B0YB 1E3UA 2HDQA 1P3OD 1P3IB 1BH9A 5B33A 3ZG5A 2F8NG 5AVBC 4NZ3A 5F99B 3OCNA 1E3UD 5BNVA 4WMCA 3UPNA 4DDSA 4JXGA 4YINA 3AV1B 5B31A 4QLCB 3NIAA 5E43A 5F1GA 1KE4A 4E3OA 5JA4A 3HREA 4H9QB 3UO9A 4NZ5A 4ZUXA 2XFSA 4WELA 4E3MA 3HBRA 3A6NA 4B4XA 3HUMA 5AV9B 4UA7A 5GLCA 2DF4C 3SH9A 5HW3A 4H9NB 5B32B 2HIOB 3AN2A 4GN2A 1CI9A 2IWDA 1BLCA 3X1SB 2EXAA 1P3FB 1W79A 4ID4A 5GSUB 3AN2D 4PM8A 4KG2A 2CC1A 1GCEA 3HLFA 2FJ7B 3UTAA 1WWSA 4S2LA 3REIC 3C7UA 3A3IA 5GLDA 3MGQB 1Q9CA 3SS5A 3H0MC 4G91B 3UTAD 4JJNC 4LD9C 3WKJD 2Y4AA 5E2FA 3IXBA 3AZFA 1MXOA 3C1BA 1YM1A 4FD8A 4OKPA 5FSRA 1XP4A 3W96D 3W99C 3FZCA 4PM6A 3BLMA 4NE5A 4S2KA 4JXVA 3AZFD 3RXWA 3C1BD 1P34B 4WJ3C 1CK3A 3GV9A 5GXQB 5HARA 3KS8A 3FV7A 4Y0TA 3IF6C 3X1UA 3LZ1D 1P3OB 4MBHA 5B1MA 3CZDA 4KGCA 4MBFA 3N3FA 3WKJC 2F8NK 4ZJ1A 4GH9A 5CGSA 5CEBA 1BH9B 2VGJA 1K25A 2HDSA 4WU8C 4KGCD 3W96C 1K57C 4WEKA 1PI4A 5FAOA 4WZ4A 4WZ5C 2ZY5A 1WE4A 5J8XA 4EUZA 5B1LD 4EO5B 2B5RA 4JJNB 4J8WC 5TR7A 3M6BA 3C1CA 3V5MA 1P3LC 3LZ1C 5AY8C 4J8VC 4YM6A 3AN2B 4IBGA 1F66A 5DTTA 4YM6D 4H9PA 3G35A 3AZNA 3EPHA 1N4OA 4S2NA 3NBLA 1TZYC 5FI2A 1F66D 1ERMA 5B1LC 3PAGA 3UTAB 3P98A 3WKJB 4E3IA 1XX2A 2YFWA 1FCOA 5GT3A 1S32D 4LG2A 3LY3A 3W96B 1ZLAA 1K56A 1K6RA 5GT3D 3AZFB 3WA9C 3MZDA 4DF6A 3C1BB 1ZLAD 2RCXA 1K56D 3UPPA 2WAFA 5B2JC 1FSWA 2NZDA 1P3LB 3LZ1B 1NXYA 1O7EA 3VSKA 1KU5A 3M2JA 4LV0A 2F2AC 2NZDD 1M40A 1YLYA 3AFAC 2CV5A 1S32C 4KGCB 1KX5C 4OUIA 5EUAA 2CV5D 3O62C 2H0YA 5A90A 5BS7A 3WTPA 3TU4D 3W97C 5B1LB 4E45A 1JTGA 4Z5TA 3V3SA 1EI5A 4HESA 1LI0A 1B6WA 1H5XA 4Z5TD 2RIQA 4R23A 3A3DA 3W4OA 4UA6A 3DTMA 4E6WA 3MKEA 5BNXA 2OLUA 4QNLA 1WYBA 3MXSA 4YM6B 5CHUA 4WU9A 1F66B 3TU4C 4H9PB 5E2EA 5M18A 4UPKA 1YUEA 2HPBA 4AWLC 3G4PA 3PBQA 3UT9D 4KZAA 3V39A 4OJ6A 1S32B 1HTZA 5AV6C 5CERA 1ID3C 2AROD 2YFWB 1ERQA 4X6TA 3WS2A 4H9RA 3HLGA 5GT3B 5AVCC 4JBFA 4QU3A 3FWLA 2JSSA 1ZLAB 4C75A 3RJUA 4RX2A 4U3TA 3HVFA 3N4IA 4OQ0A 5CHLB 1BTLA 2XK1A 5HAPA 2A49A 2XF3A 5U47A 4Z2MH 2P9VB 5AV8A 2NZDB 4GHAA 1SCWA 3UT9C 3MBZA 1YU3A 3EQVA 3UNWA 4CSRA 1BLSA 3AZMA 5DVAA 5AV8D 5B32G 2ZY3A 4R1GA 2AROC 2CV5B 4OLDA 5CPIA 3TU4B 3AZMD 3LZ0D 5F82A 1RCJA 4GD8A 5HAIA 4KZ9A 3L26A 3Q07A 5AQ9A 4NK3A 3REJA 4Z5TB 1NYYA 3NDEA 3MZEA 1KX4A 4BLMA 4Z2MG 3UDIA 3VMAA 3REJD 4CAYB 1VM1A 4DRBA 3H0RC 1KX4D 4S2PA 5BNXB 5GT0A 4B4ZA 4ZTKA 3LZ0C 4E3JA 4KZ5A 1P3AA 2WZZA 4ZJ2A 5GT0D 3UT9B 3OPPA 2HDRA 3BFDA 3TG9A 1P3AD 4IEDA 1IYOA 1DJBA 1LHYA 1KGEA 3QNBA 4BENA 1GA0A 2AROB 4DE0A 3AZJD 2IOUA 1GHMA 4Z66C 1L0EA 4YS3A 3DW0A 5BO0B 4IJFA 3C7VA 3PBSA 4H9RB 3O86A 4N9KA 4YS3D 1KX3D 3AYWD 2X01A 4BD1A 1H8ZA 3KWQA 3BFCA 5AV8B 1F1EA 2HUEC 3AZJC 4EQIA 5FI6A 4CSRB 3SH8A 3TOIA 3KWQD 3AZMB 3LZ0B 3MGPA 3LO7A 3LJAD 1S6RA 4DE3A 4KZ8A 2JC7A 1KX3C 3AYWC 1EQZC 3EG5B 4PM9A 3PBRA 2HDUA 2BYMB 3LELA 3X1VA 1P3MA 4IBRA 2VQRA 3REJB 4RYEA 1KGFA 5FATA 1KX4B 3UY6A 1FR6A 3LELD 3NQUB 5B40D 3ISGA 3NQJA 1W7FA 5GT0B 1K6SA 3AV2C 3A3JA 5DF8A 2HUEB 1PIOA 1HVBA 3AZJB 3PBTA 3B6FA 2XEPA 4Y0UA 2DCFA 3REKA 1K54C 1KGGA 4OPYA 1KE3A 3IWQA 3B6FD 3VOZA 1U35C 3REKD 4CJNA 5B0YC 5JYOA 3I7JA 1KX3B 1P3IC 3AYWB 2G5HC 2RL3A 5E5AC 4OONA 5F99C 1N9BA 4F94A 4XUJA 4LCLA 4RVAA 3W98A 3AV1C 3HUNA 3HSHA 4QLCC 3X1TA 4XUJD 5F1FA 4KG6A 5FQIA 4KG5A 3KWQB 3NDGA 5FQKA 3D4FA 3GQZA 1IKGA 3LJAB 1OMEA 4G92C 4KUDA 2V1ZA 3UTBA 2HIOC 3BYDA 3AZLD 4KZBA 5HAQA 5JRGA 2PU2A 5GSUC 1P3BD 1S0WA 1EROA 3B6GA 1DJAA 2RVQC 5JRGD 2FJ7C 4P0MA 2Y55A 2Y2JA 1M18D 3B6GD 2J9PA 1K55C 3PBOA 3LELB 1SKFA 3OCLA 1M1AA 5B40B 1NZUA 4EBLA 5KDMB 3P09A 3MGQC 3MGSA 2WKIA 4G91C 1W5DA 5E5AB 5B33D 4PM7A 3NQJB 3E2KA 3MVDA 1P3BC 4M6BA 2ZQ9A 4WMCD 1HD8A 2Z2LB 1P34C 1ZC2A 4BQMA 5B31D 5GXQC 3PTEA 3MVDD 3RELA 1M18C 3B6FB 4G92B 2ZJ9A 4J8UA 4ZUXD 5EOOA 1P3OC 4E6XA 3A6ND 2OSUA 1H3OA 3RELD 4QD4A 3OC2A 1PWGA 3ZG7B 3VH6A 5B0ZA 5B33C 1PYYA 4FSFA 1P3KA 1E4DA 4XUJB 4WEJA 3GSGA 1W2EA 3FYZA 5B0ZD 4MEZA 4GB7A 5CHJA 4DE2A 5FASA 5B31C 4EO5C 3B0CT 4R8PA 1N1JB 2XD1A 4ZUXC 3AZLB 5B2IA 4DDYA 3WS5A 3OPLA 3A6NC 3REHA 1YLTA 1BH8A 3B3XA 1P3BB 3AN2C 1RGZA 4NE3A 5JRGB 2PU4A 1CI8A 3V50A 3REHD 5DF7A 4BJPA 1M18B 3B6GB 2BYKB 3AZEA 5CPJA 4S2JA 4GNUA 1FCNA 1WYCA 3B0BA 3UTAC 3AZED 5CPJD 1TAFA 2ZM2A 1BLPA 3X1UD 4NYUA 5B33B 5B1MD 5AY8A 1I5QA 1ULYA 4GOGA 5BNVB 3HONA 3AZFC 3IT9A 3O87A 2WGIA 3C1BC 3WS0A 5B31B 1KDWA 2WAEA 5EECA 5DNMA 3MVDB 3B0DC 5JA4B 1ESUA 2WGVA 3VP4A 4E3NA 5KSCA 4OVDA 4ZUXB 1Z6FA 4KHAA 5AQAA 3A6NB 4EBPA 4H9SA 3RELB 5CHMA 1R4VA 4GDBA 3C1CD 5DNNA 1LLBA 3X1UC 1PZRA 1H3OB 5B1MC 4KGCC 2GDNA 4S2OA 4S2MA 4IBXA 2J9OA 3AZKA 1KDSA 3AZGA 1U60A 4OQIA 5B0ZB 4DRTA 2HP5A 3AZND 5L2FA 3G2YA 1M19A 3AZKD 3AZHA 3ZCZA 1XXMA 3KFUG 2ZM8A 4Y0OA 3VH6T 5B24A 3FKVA 3C1CC 5B24D 1YQSA 3VH5A 5GHYA 3REHB 1GHIA 2EX8A 1KX5A 4YM6C 1BH8B 4NZ1A 4OLGA 2WKHA 3B0DB 3LY4A 3SH7A 2F8NA 1F66C 2WADA 3MKFA 3AZNC 4S2NC 1FR1A 4HGAB 2YFVA 1W8QA 2ZY2A 3AZEB 5CPJB 2QMIA 4XZQA 3X1UB 2WYXA 3BFEA 3GR2A 5B1MB 5CPKA 1TAFB 2W8SA 4XZQD 4X55A 4DXCA 3IHAA 1TEMA 5GT3C 2EX6A 5FA7A 1ZLAC 2NQBA 2Y2HA 1NYMA 3IH8A 4X23A 4DKIA 3WTPD 4FH2A 2FFFB 3G32A 2NZDC 3FKEA 3C1CB 4KHAB 1JWVA 3G30A 1HZOA 1SDNA 5AV6A 2CV5C 3AZNB 1Q2QA 3QHYA 3AZKB 2QPNA 4WU9D 3C4PA 3Q1FA 3P5JB 2Y2LA 5BS7C 4WNNA 1YMXA 1IEMA 4Z5TC 2PBYA 2IO5B 3OPRA 3L2AA 4DQYB 2Y2KA 5B24B 2H0TA 2ZQDA 5IHVA 1MPLA 4OJOA 1LL9A 3HLWA 4H9OA 1P3GA 1YLWA 4IVKA 1L0GA 4UHUA 1KE0A 3HUOA 2V2FF 4UUZA 3Q7ZA 3GVBA 4WM9A 1P3GD 3WAAA 3O3VA 4WU9C 3HLBA 2XLNA 1G6AA 3ZG0A 2V20A 4E3KA 2EX2A 4LV1A 3VH5T 3WAAD 2YFVB 2WZXA 5FQMA 4XUXA 4K0XA 5HL1A 4XZQB 1P3PA 4WV4B 2Y2GA 5FAPA 4EWFA 2E8IA 4KZ6A 4C6YA 3A3EA 3IWOA 1SHVA 5CPID 1HQ3A 2ZC5B 3WTPB 2C5WB 3N7WA 4X53A 4IBJA 5AV5A 4M3KA 5D3OA 1YT4A 3FDDA 4BD0A 2BG1A 5AV8C 5AV5D 1NRFA 5M19A 1JTDA 1ONHA 1XGIA 2H5SA 2R9WA 1RP5A 3Q82A 3R45A 3AZMC 2Q9MA 4WU9B 5CPIC 1AOIA 4R4RA 3GTCA 4EV4A 3BEBA 2WUQA 3VP0A 1PW1A 1ZG4A 4O7DA 1J9MA 5FAQA 4KQRA 4A5RA 3REJC 5F83A 1ZG6A 4PMAA 1KX4C 4CPKA 4L0LA 1NY0A 5GLAA 1JVJA 1VQQA 3L25A 2Y2NA 4H9OB 1P3GB 3O88A 2JCHA 2PYOA 5GT0C 5B31G 1P3AC 3WAAB 5C3IB 5E2HA 5FUGA 5EVIA 2XH9A 2J8PA 4J8XA 3A1IA 3ZG9B 3EPJA 2G2WA 5EVID 5BT1D 5CPIB 3HLEA 1NZOA 4J8XD 2X02A 4YS3C 5I94A 3MNNA 3MGPD 3HL9A 3S22A 4Y7PA 4P6BA 3AL0C 3AGFA 1YLJA 3MNND 2A3UA 1JWPA 3V9RA 3MGRA 1ALQA 4X69A 5AV5B 4X56A 3X1VD 1P3MD 3RXXA 3ZG8B 3KXBA 1ES2A 3MGRD 3KUYA 3KWQC 5FQJA 1K4EA 4K0WA 3LJAC 3MFDA 4KQQA 3KXBD 3KUYD 3AZIA 2IWBA 1H8YA 1YLZA 3MGPC 4N1XA 4MBKA 1P3AB 3F6TA 1BLHA 5FQQA 1TDGA 3AZID 5CTMA 2WKEA 4OJ5A 3IXDA 4GZBA 1PZPA 2ZMAA 2EX9A 4B88A 5CP6A 4EBNA 3LELC 3X1VC 1P3MC 2Y2MA 5CEDA 5B40C 4YS3B 4ZAMA 1XA1A 3BLSA 5CP6D 2DQNC 2XFTA 1Q2PA 3NCKA 5AV9A 4H9NA 5B32A 2HIOA 1DY6A 3X1SA 3M6HA 1P3FA 4IBKA 4ZBEA 4Z9QA 2R9XA 4UA9A 3W98D 2ZQCA 3X1TD 1XKZA 3EQUA 5EVIB 5CGXA 3B6FC 3G2ZA 4R3JA 3REKC 3MGPB 5CXWA 1PWCA 2EFUA 3A1KA 5EPHA 3A3FA 5GHZA 5AVBA 4KUDD 1ES5A 3UTBD 3MNNB 3AGEA 4GHLA 2WK0A 5AVBD 4E3LA 2XGNA 4NFTA 4XUJC 1YU2A 3C4OA 3X1VB 1P3MB 3W98C 1DJCA 1ESIA 3V9RB 3MGRB 1XPBA 2X71A 4OJLA 3X1TC 1QMEA 1GHPA 2Y91A 2ZQ8A 4OPQA 4K91A 3KXBB 1M1AD 2L5AA 2EFXA 3KUYB 3AZLC 3SS4A 4YFMA 3MGSD 4HBUA 4IBIA 2Y59A 4KUDC 3UTBC 3AZIB 2ZD8A 3Q7VA 5JRGC 4LCMA 3B0CW 4C3QA 3B6GC 3REIA 1TVFA 3REKB 3BFFA 3WWXA 5CP6B 5EOEA 1M6KA 4JJNA 4LD9A 4N1HA 2J8YA 4J8UD 3REID 1M1AC 4R4SA 3MGSC 1PWDA 1L0DA 5EE8A 2Y2OA 2XR0A 4JJND 4LD9D 3SOIA 3W99A 4GDNA 3VOYA 4RA7A 3E2LA 4QJGA 3VP3A 4IJEA 3W98B 3NC8A 2IWCA 1P3KD 3OPHA 3W99D 3X1TB 3MVDC 3IF6A 2XDMA 1E25A 4NETA 3RELC 3V3RA 4R8PD 3UE0A 4KUDB 3WKJA 3UTBB 4J8UC 3L28A 5B2ID 3CG5A 1K4FA 1JFIA 3N8LA 2ZQAA 5FI7A 3HLCA 5TGFA 4WU8A 4S2IA 4NY2A 1MKIA 5AVBB 3NY4A 3W96A 5CRFA 1K57A 1Z2CB 1FCMA 4OH0A 5A93A 3UE1A 5B0ZC 1MWTA 3BRMA 4WZ5A 4WU8D 1P3KC 1FOFA 3ZHHA 5BOHA 4KQOA 4J8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYO A;  1DJB A;  3G32 A;  1LHY A;  1KGE A;  3DWK A;  3QNB A;  1IYP A;  4JKT A;  4BEN A;  3PBN A;  3W8K A;  1GA0 A;  1JWV A;  5TFQ A;  2QZ6 A;  4DE0 A;  3UPO A;  1GHM A;  2UWX A;  1HZO A;  1SDN A;  3G30 A;  1L0E A;  5DTK A;  3DW0 A;  1G68 A;  4D2O A;  4WBG A;  3S1Y A;  3C7V A;  3PBS A;  2XQZ A;  2G2U A;  3O86 A;  4N92 A;  4N9K A;  1IYS A;  4BL3 A;  3DWZ A;  5DF9 A;  1Q2Q A;  5KMW A;  3QHY A;  3Q7V B;  2X01 A;  2QPN A;  3C4P A;  3FKW A;  3Q1F A;  4QHC A;  2Y2L A;  1LL5 A;  2HP9 A;  4X68 A;  4LEN A;  4ZJ3 A;  1YMX A;  1IEM A;  2ZC4 B;  4FCF A;  3VP1 A;  1EWZ A;  1XGJ A;  1H8Z A;  1IYQ A;  2PBY A;  2I72 A;  3BFC A;  3OPR A;  4BD1 A;  4GD6 A;  4JF4 A;  4RX3 A;  3W4P A;  2Y2K A;  1KVL A;  3SS3 A;  2H0T A;  4EQI A;  1MBL A;  2ZQD A;  4OOL A;  5FI6 A;  5IHV A;  1MPL A;  3SH8 A;  3TOI A;  1IKI A;  4OP8 A;  1LL9 A;  2HDQ A;  1E3U A;  3HLW A;  2Y2P A;  1YLW A;  3ZG5 A;  4IVK A;  3LO7 A;  1L0G A;  1S6R A;  4DE3 A;  4UHU A;  1KE0 A;  3HUO A;  4KZ8 A;  2V2F F;  3Q7Z A;  4R0Q A;  2JC7 A;  3ZNY A;  3OCN A;  3GVB A;  1E3U D;  4WM9 A;  3O3V A;  1I2S A;  4WMC A;  3JYI A;  4LV2 A;  3UPN A;  4DDS A;  3ZVT A;  4JXG A;  4PM9 A;  3GMW A;  4YIN A;  3HLB A;  3PBR A;  2XLN A;  4H8R A;  3NIA A;  1G6A A;  5E43 A;  5F1G A;  2HDU A;  1KE4 A;  3ZG0 A;  4E3O A;  2V20 A;  4E3K A;  2EX2 A;  2DNS A;  3HRE A;  4LV1 A;  4IBR A;  2WZX A;  5FQM A;  4RYE A;  1L0F A;  3IHB A;  4K0X A;  4XUX A;  3RJU A;  3IF6 B;  3UO9 A;  5HL1 A;  4MNR A;  1KGF A;  2XFS A;  5FAT A;  4UAA A;  3UY6 A;  4WEL A;  4E3M A;  3HBR A;  2Y2G A;  4DE1 A;  1FR6 A;  5FAP A;  4B4X A;  3HUM A;  4EWF A;  4UA7 A;  5GLC A;  5DTS A;  1ZKJ A;  2E8I A;  4KZ6 A;  3SH9 A;  4C6Y A;  5HW3 A;  3ISG A;  4GN2 A;  1YLP A;  3A3E A;  1CI9 A;  4KZ4 A;  2IWD A;  3IWO A;  1BLC A;  1SHV A;  4MLL A;  1W7F A;  2EXA A;  1W79 A;  2ZC5 B;  4BL2 A;  4ID4 A;  1K6S A;  3CJM A;  2C5W B;  4PM8 A;  4KG2 A;  4OPZ A;  2CC1 A;  3A3J A;  3N7W A;  4X53 A;  1GCE A;  4QY5 A;  3HLF A;  5DF8 A;  4P85 A;  1MWS A;  1PIO A;  5G18 A;  1HVB A;  4M3K A;  3PBT A;  5D3O A;  1YT4 A;  3N6I A;  2XEP A;  4OPR A;  4S2L A;  4JF6 A;  4Y0U A;  4BD0 A;  2BG1 A;  2DCF A;  2P9V A;  3C7U A;  3A3I A;  1K54 C;  1MWU A;  1KGG A;  1NRF A;  4OPY A;  2ZM0 A;  5FDH A;  5GLD A;  1KE3 A;  3SS5 A;  5M19 A;  1JTD A;  1ONH A;  1XGI A;  2H5S A;  2R9W A;  1RP5 A;  3IWQ A;  3VOZ A;  3Q82 A;  4OQG A;  3ITB A;  1FQG A;  4CJN A;  2C6W B;  2Y4A A;  5E2F A;  5JYO A;  3IXB A;  3I7J A;  4HEF A;  2RL3 A;  1MXO A;  1CEG A;  1YM1 A;  2Q9M A;  4FD8 A;  4OKP A;  5FSR A;  4R4R A;  3GTC A;  4OON A;  1XP4 A;  4LV3 A;  1N9B A;  3FZC A;  4PM6 A;  4EV4 A;  3BEB A;  2WUQ A;  3BLM A;  4F94 A;  4S2K A;  4JLF A;  1YMS A;  2WGW A;  4LCL A;  3VP0 A;  4JXV A;  4RVA A;  3RXW A;  1PW1 A;  1ZG4 A;  4OOY A;  3BEC A;  3HUN A;  4O7D A;  5A92 A;  1CK3 A;  1J9M A;  3S4X A;  4PM5 A;  5FAQ A;  3ZGA B;  3GV9 A;  4KQR A;  5F1F A;  4A5R A;  4KG6 A;  5HAR A;  3FV7 A;  5F83 A;  1ZG6 A;  4Y0T A;  5FQI A;  4KG5 A;  5FQ9 A;  3IF6 C;  4PMA A;  2P74 A;  3IF5 A;  3NDG A;  5FQK A;  3D4F A;  4MBH A;  3WRT A;  3GQZ A;  4CPK A;  4L0L A;  1IKG A;  3CZD A;  1NY0 A;  1OME A;  5GLA A;  4MBF A;  2V1Z A;  1JVJ A;  1VQQ A;  3BYD A;  1IEL A;  4KZB A;  4ZJ1 A;  2Y2N A;  5CGS A;  5HAQ A;  5CEB A;  2VGJ A;  1ONG A;  1K25 A;  3O88 A;  2PU2 A;  2JCH A;  5HX9 A;  1PW8 A;  2HDS A;  1NJ4 A;  3IH9 A;  1K57 C;  1S0W A;  4WEK A;  1ERO A;  1PI4 A;  4DXB A;  1DJA A;  5FAO A;  4WZ4 A;  4WZ5 C;  1WE4 A;  4JXW A;  5J8X A;  1W8Y A;  3CMZ A;  3OZH A;  2Y55 A;  4P0M A;  5E2H A;  5AQB A;  2Y2J A;  4EUZ A;  5EVI A;  3PBO A;  2J9P A;  1K55 C;  2XH9 A;  4U0T A;  2B5R A;  1SKF A;  3OCL A;  5TR7 A;  1NZU A;  3M6B A;  3ZG9 B;  4EBL A;  3V5M A;  3ITA A;  3P09 A;  3WS4 A;  2G2W A;  5EVI D;  2WKI A;  1W5D A;  4QY6 A;  4QB8 A;  3ZVW A;  3HLE A;  1NZO A;  4PPR A;  3IQA A;  2X02 A;  5I94 A;  5GLB A;  3HL9 A;  3S22 A;  4Y7P A;  4PM7 A;  4P6B A;  3N8S A;  3AGF A;  5DTT A;  3E2K A;  1YLJ A;  3G35 A;  1N4O A;  4S2N A;  3WRZ A;  3NBL A;  2A3U A;  2ZQ9 A;  3UE3 A;  4WMC D;  1JWP A;  1HD8 A;  2Z2L B;  5M1A A;  1ZC2 A;  4P87 A;  4BQM A;  3ZFZ A;  5FI2 A;  1ERM A;  1ALQ A;  3TSG A;  4X69 A;  3PTE A;  4N9L A;  2ZLY A;  4X56 A;  3PAG A;  3RXX A;  3ZG8 B;  1ES2 A;  3P98 A;  2ZJ9 A;  5FQJ A;  4E3I A;  5EOO A;  1XX2 A;  1K4E A;  5A91 A;  4E6X A;  1FCO A;  4K0W A;  2OSU A;  5KSH A;  3MFD A;  4KQQ A;  4QD4 A;  3LY3 A;  3MXR A;  2IWB A;  1H8Y A;  1YLZ A;  3OC2 A;  3VFF A;  1PWG A;  1K56 A;  1K6R A;  4N1X A;  2JBF A;  2EXB A;  4MBK A;  3ZG7 B;  3WS1 A;  1BLH A;  3MZD A;  5FQQ A;  4DF6 A;  4Q8I A;  1PYY A;  4FSF A;  2OLV A;  3GRJ A;  1TDG A;  5CTM A;  1E4D A;  4WEJ A;  3GSG A;  2WKE A;  2RCX A;  1K56 D;  2WGW B;  3UPP A;  2WAF A;  1PI5 A;  2J7V A;  2FFY A;  3FYZ A;  4MEZ A;  1GA9 A;  3IXD A;  4GB7 A;  1FSW A;  4GZB A;  1PZP A;  5CHJ A;  2ZMA A;  4DE2 A;  1RGY A;  2EX9 A;  4OQH A;  5FAS A;  3LCE A;  4B88 A;  2H10 A;  1NXY A;  4EBN A;  1O7E A;  3VSK A;  3M2J A;  4LV0 A;  2Y2M A;  3UN7 A;  5CED A;  1M40 A;  4JPM A;  2XD1 A;  1YLY A;  4ZAM A;  5GL9 A;  4DDY A;  1KVM A;  2ZC6 B;  1XA1 A;  2HP6 A;  3BLS A;  3WS5 A;  2XFT A;  1Q2P A;  3OPL A;  4JXS A;  3NCK A;  4KZ3 A;  3VP2 A;  1YLT A;  3B3X A;  1RGZ A;  1DY6 A;  3W4Q A;  3IXH A;  5EUA A;  3ZNT A;  2JE5 A;  2VGK A;  2PU4 A;  1CI8 A;  1O07 A;  3V50 A;  2H0Y A;  3M6H A;  4FH4 A;  5A90 A;  5DF7 A;  4ZBE A;  4Z9Q A;  1JWZ A;  2R9X A;  4BJP A;  4UA9 A;  1JTG A;  1QMF A;  3V3S A;  1EI5 A;  2ZQC A;  4S2J A;  5CTN A;  4HES A;  3QNC A;  3TG9 A;  1LI0 A;  1BUE A;  4GNU A;  4XUZ A;  1XKZ A;  1FCN A;  3AGD A;  1WYC A;  3EQU A;  5EVI B;  3LEZ A;  1H5X A;  3UDF A;  5CGX A;  3G2Z A;  4R23 A;  2Y2I A;  5EVL A;  2ZM2 A;  3A3D A;  4R3J A;  5CGW A;  1BLP A;  4UA6 A;  4XXR A;  4OOM A;  3DTM A;  3W4O A;  4E6W A;  3MKE A;  5CXW A;  1PWC A;  2EFU A;  5EPH A;  3A3F A;  1I5Q A;  2OLU A;  5GHZ A;  1ES5 A;  1WYB A;  3MXS A;  4U0X A;  1LI9 A;  4GOG A;  5CHU A;  3AGE A;  3IT9 A;  3O87 A;  4ZDX A;  2WGI A;  3WS0 A;  2WK0 A;  3VFH A;  1KDW A;  2WAE A;  1AXB A;  2XGN A;  5EEC A;  4E3L A;  1BT5 A;  5E2E A;  3C4O A;  5M18 A;  2WGV A;  1DJC A;  1ESU A;  5GHX A;  1ESI A;  3VP4 A;  1ES3 A;  4E3N A;  2HPB A;  5KSC A;  3G4P A;  1XPB A;  4OVD A;  5CEC A;  1Z6F A;  2X71 A;  3PBQ A;  4KZA A;  3V39 A;  5AQA A;  1MWR A;  4EBP A;  1QME A;  3BFG A;  1GHP A;  2Y91 A;  1HTZ A;  2ZQ8 A;  2DRW A;  5CHM A;  5CER A;  3PAE A;  4OPQ A;  4K91 A;  2BLS A;  1TDL A;  2EFX A;  4GDB A;  1LLB A;  3SS4 A;  3C5A A;  1BUL A;  4YFM A;  1ERQ A;  4X6T A;  4HBU A;  3WS2 A;  3HLG A;  5E2G A;  3G34 A;  4OP5 A;  2GDN A;  2Y59 A;  4S2O A;  4JBF A;  4QU3 A;  3M2K A;  1I2W A;  3FWL A;  1SDE A;  2ZQ7 A;  4IBX A;  1CEF A;  4S2M A;  2ZD8 A;  2J9O A;  1Y54 A;  3IXG A;  4KZ7 A;  3Q7V A;  3HVF A;  3N4I A;  1KDS A;  4OQ0 A;  1U60 A;  4RX2 A;  4U3T A;  2ZC3 B;  4OQI A;  3ZDJ A;  1ES4 A;  4DRT A;  4LCM A;  1BTL A;  2HP5 A;  5AQ7 A;  2XK1 A;  5HAP A;  4C3Q A;  1K38 A;  5L2F A;  2A49 A;  3G2Y A;  3ZCZ A;  1XXM A;  2XF3 A;  5U47 A;  1TVF A;  2P9V B;  2ZM8 A;  4Y0O A;  1C3B A;  1SCW A;  1FSY A;  3BFF A;  1K54 A;  3WWX A;  1BZA A;  3MBZ A;  5EOE A;  5EVI C;  3EQV A;  1M6K A;  2Q9N A;  3UNW A;  1BLS A;  4N1H A;  3FKV A;  2J8Y A;  4KEN B;  5DVA A;  4R4S A;  2Y2Q A;  4R1G A;  1PWD A;  1YQS A;  1L0D A;  5EE8 A;  2Y2O A;  4OLD A;  2XR0 A;  5GHY A;  1PZO A;  1GHI A;  1BSG A;  2EX8 A;  3SOI A;  4GDN A;  3VOY A;  4OLG A;  4RA7 A;  5F82 A;  3E2L A;  2WKH A;  4QJG A;  3LY4 A;  1RCJ A;  3VP3 A;  3NC8 A;  4GD8 A;  4R3B A;  3SH7 A;  2IWC A;  5HAI A;  2WAD A;  3OPH A;  4KZ9 A;  3MKF A;  2Z2M B;  4S2N C;  1FR1 A;  3Q07 A;  3VSL A;  5AQ9 A;  4NK3 A;  1NYY A;  1W8Q A;  2ZC7 A;  3BM6 A;  3NDE A;  4C75 A;  2QMI A;  3IF6 A;  3MZE A;  2XDM A;  5HFO A;  2XD5 A;  1E25 A;  2WYX A;  3BFE A;  3GR2 A;  3UDX A;  4BLM A;  1MY8 A;  4NET A;  3MZF A;  5KZH A;  3V3R A;  4JF5 A;  4WYY A;  3UE0 A;  3UDI A;  3G31 A;  3VMA A;  4GKU A;  3IWI A;  1VM1 A;  3NI9 A;  4X55 A;  4DXC A;  3CG5 A;  4S2P A;  1K4F A;  3IHA A;  1TEM A;  3N8L A;  2ZQA A;  5FI7 A;  3HLC A;  5TGF A;  2EX6 A;  4S2I A;  1MKI A;  3NY4 A;  4ZTK A;  3Q81 A;  5FA7 A;  5CRF A;  4B4Z A;  1K57 A;  2Y2H A;  1XA7 A;  1FCM A;  4IVI A;  4OH0 A;  5A93 A;  3UE1 A;  4E3J A;  4KZ5 A;  2OV5 A;  1NYM A;  3IH8 A;  2WZZ A;  1MWT A;  3BRM A;  3N8R A;  4WZ5 A;  4DKI A;  4ZJ2 A;  1L2S A;  3OPP A;  4FH2 A;  1FOF A;  5JYP A;  2HDR A;  2FFF B;  3ZHH A;  5BOH A;  1K55 A;  3BFD A;  4KQO A;  3HLD A;  4IED A;  4HBT A; 
#chains in the Genus database with same CATH topology
 1YU1 A;  1M1A B;  1IYP A;  4JKT A;  1P3L A;  3PBN A;  3W8K A;  3KSI A;  4NE6 A;  3LZ1 A;  3MGS B;  2QZ6 A;  3RTY A;  4R8P C;  4J8V A;  3UPO A;  2UWX A;  4J8W D;  2W27 A;  5DTK A;  5B2I C;  1P3L D;  3S1Y A;  5AY8 D;  2G2U A;  3CWF A;  4J8V D;  3REH C;  4N92 A;  1IYS A;  3MQO A;  5DF9 A;  5KMW A;  5CX7 A;  1LT0 A;  3Q7V B;  1ED7 A;  1TZY A;  2O9B A;  1LL5 A;  2HP9 A;  3VH6 W;  4X68 A;  2Z6C A;  5DNM D;  2PAV P;  2W3G A;  3L9K A;  4LEN A;  5B1L A;  4ZJ3 A;  1DP9 A;  2VGL M;  4HGA C;  2ZC4 B;  1XJ6 A;  3AZE C;  5CPJ C;  1TZY D;  4J8U B;  3REI B;  1IYQ A;  4B93 A;  4JF4 A;  4RX3 A;  3QP5 A;  1T1C A;  1MBL A;  4LD9 B;  1IKI A;  5DNN D;  4IBD A;  2J3T D;  2Y2P A;  2NUP C;  3WA9 A;  1P3K B;  2P04 A;  3W99 B;  2VLG A;  4R0Q A;  3ZNY A;  3AZG D;  3HJK A;  5B2J A;  1I2S A;  2DMW A;  2VEA A;  3JYI A;  2JKT M;  3WA9 D;  4LV2 A;  3L27 A;  3ZVT A;  3GMW A;  4H8R A;  1YU4 A;  3B47 A;  5DNM C;  1M19 D;  3AZH D;  3WD0 A;  4R8P B;  2DNS A;  5B2J D;  1L0F A;  1YAX A;  3IHB A;  2QKP A;  1UGU A;  3IF6 B;  1L3L A;  4MNR A;  5B2I B;  3AFA A;  4UAA A;  4DE1 A;  4H9S C;  1S32 A;  3KSH A;  5DTS A;  1ZKJ A;  3PXP A;  1TF1 A;  5DNN C;  3AFA D;  1YLP A;  2J3T C;  4KZ4 A;  1JFI B;  1OTE A;  2ZY4 A;  3O62 A;  4MLL A;  1BYW A;  4WU8 B;  1KX5 D;  4BL2 A;  4NZ4 A;  3W97 A;  2A24 B;  3CJM A;  3AZK C;  4OPZ A;  1VET A;  3AZG C;  3KSY A;  2F8N D;  3O62 D;  4QY5 A;  2XA7 M;  1YU0 A;  4P85 A;  1MWS A;  5G18 A;  3W97 D;  2LY8 A;  3F1O B;  4Y15 A;  1M19 C;  3AZH C;  4OPR A;  3N6I A;  1LSX A;  4R3A A;  4JF6 A;  4J8W B;  2IO5 C;  2P9V A;  3LIA A;  1QO6 A;  1MWU A;  2OOL A;  3NOU C;  2PR6 A;  2ZM0 A;  5FDH A;  5AY8 B;  5B24 C;  4YNR A;  5CPK D;  4J8V B;  2UV0 E;  4OQG A;  3ITB A;  1FQG A;  4IBE A;  2C6W B;  4HEF A;  1CEG A;  4IUK A;  4LV3 A;  3E4O A;  2NQB D;  3TU4 A;  5DNM B;  2W1R A;  3LIE A;  4JLF A;  1YMS A;  2WGW A;  1A7W A;  2A2L A;  4X23 D;  4OOY A;  1TZY B;  3BEC A;  5A92 A;  3S4X A;  4PM5 A;  3ZGA B;  2VGL S;  4LGW A;  4E44 A;  3EWK A;  4MB3 A;  5FQ9 A;  1ID3 A;  4XZQ C;  5DNN B;  2P74 A;  3IF5 A;  2OWJ A;  3WTP E;  5BPV A;  3WRT A;  3IP4 C;  2L0W A;  5CPK C;  5AV6 D;  1CQA A;  5AVC A;  1IFQ A;  4CAY A;  1ID3 D;  4IBC A;  1IEL A;  5IS1 A;  3AZG B;  1G28 A;  1DRM A;  1ONG A;  5HX9 A;  3WA9 B;  4Z2K A;  1PW8 A;  1GOI A;  3WTP C;  5AVC D;  1NJ4 A;  2VKS A;  3IH9 A;  2NQB C;  4I3A A;  3VH5 W;  1M19 B;  3AZH B;  4DXB A;  3R7W A;  4JGO A;  5B2J B;  4X23 C;  4JXW A;  1W8Y A;  2CWE A;  3CMZ A;  3OZH A;  5AQB A;  3UT9 A;  1HTA A;  4U0T A;  2VX8 A;  3AFA B;  3ITA A;  4YOF A;  2ARO A;  5G49 A;  3WS4 A;  3MQQ A;  4QY6 A;  4QB8 A;  3ZVW A;  4PPR A;  1T3U A;  1KX5 B;  3IQA A;  5GLB A;  5A8B A;  5BO0 A;  2F8N B;  3O62 B;  3N8S A;  3WRZ A;  3W97 B;  1YPR A;  4IBF A;  1VET B;  3DTI A;  3UE3 A;  5M1A A;  2XA7 S;  4P87 A;  3ZFZ A;  4WZS B;  1B67 A;  3TSG A;  4N9L A;  2ZLY A;  2B95 A;  5CPK B;  2MJ6 A;  1P3P D;  5AVF A;  1PFL A;  1E8B A;  5A91 A;  3H0L C;  4DRA A;  5KSH A;  3MXR A;  2NQB B;  3VFF A;  3LZ0 A;  1P3G C;  2EXB A;  2JBF A;  3WS1 A;  4Q8I A;  4X23 B;  1HQ3 D;  2OLV A;  3GRJ A;  3OBF A;  2WGW B;  3WAA C;  1PI5 A;  2J7V A;  2FFY A;  3ULF A;  1GA9 A;  1E6Z A;  4AWL B;  2BTF P;  3HCY A;  4HME A;  1RGY A;  5C3I C;  4OQH A;  3LCE A;  2H10 A;  2BYM A;  4BWI A;  5C5K A;  4Z66 A;  5AV6 B;  3UN7 A;  3MFX A;  1ID3 B;  4JPM A;  1P3P C;  4PHT A;  5GL9 A;  4R38 A;  1KVM A;  2ZC6 B;  2HP6 A;  4JXS A;  4KZ3 A;  3NQU A;  3VP2 A;  4Z66 D;  5AVC B;  3W4Q A;  3IXH A;  3ZNT A;  5EM0 A;  2JE5 A;  4QPR A;  2VGK A;  2HF6 A;  1O07 A;  1AOI D;  4FH4 A;  1HQ3 C;  2KLI A;  4EUV A;  2BAS A;  4WNN B;  1IOU A;  1JWZ A;  1CK7 A;  4HIA A;  2VV7 A;  1QMF A;  3T4Q A;  3IBR A;  3TE8 A;  3KYE A;  5CTN A;  1K0K A;  3QNC A;  4JGQ A;  1BUE A;  5AV5 C;  4XUZ A;  3AGD A;  1F2K A;  3LEZ A;  3AZJ A;  2V9A A;  3LEQ A;  3UDF A;  5EVL A;  2Y2I A;  5CGW A;  4XXR A;  2H28 A;  4OOM A;  3QP1 A;  5G49 B;  3P7N A;  4U0X A;  4UUZ B;  4Q0H A;  1LI9 A;  1KX3 A;  3AYW A;  1EQZ A;  4E04 A;  2PYO D;  4ZDX A;  1AOI C;  3VFH A;  1AXB A;  4IBB A;  1BT5 A;  4ZBJ C;  2YKF A;  1EQZ D;  5GHX A;  1ES3 A;  1P3P B;  5CEC A;  2V1B A;  3MR0 A;  1A0K A;  3WD1 A;  1MWR A;  3LI9 A;  3BFG A;  2DRW A;  2ZBB A;  3PAE A;  3FPW A;  2BLS A;  1TDL A;  3ICY A;  3JVV A;  3C5A A;  1BUL A;  5E2G A;  3G34 A;  3LJA A;  4OP5 A;  5FL3 A;  1HQ3 B;  3M2K A;  1I2W A;  1SDE A;  2ZQ7 A;  3T4O A;  1CEF A;  4KZ7 A;  1Y54 A;  3IXG A;  2QJ7 A;  3AV2 A;  3ZDJ A;  2ZC3 B;  2PYO C;  1ES4 A;  3IBJ A;  5AQ7 A;  4WF0 A;  1K38 A;  3EPK A;  1FIK A;  1BFM A;  3AV2 D;  5KIZ A;  1GPF A;  1C3B A;  4MCW A;  1FSY A;  3KYQ A;  1K54 A;  2R78 A;  1BZA A;  5EVI C;  1OJ5 A;  2Q9N A;  5HWV A;  5BT1 C;  1UWN X;  4Z66 B;  3R45 B;  4J8X C;  4KEN B;  1U35 A;  4NKP A;  5L8M A;  5B40 A;  5B0Y A;  5KDM A;  2Y2Q A;  1P3I A;  5HWW A;  3DAV A;  5E5A A;  1AOI B;  1PZO A;  1BSG A;  5F99 A;  3UME A;  1WWI A;  1U35 D;  3MNN C;  5B0Y D;  4ZBJ B;  3LI8 A;  1P3I D;  4I39 A;  4R3B A;  3AV1 A;  5E5A D;  4QLC A;  3LID A;  5F99 D;  2Z2M B;  3VSL A;  4H9Q A;  2ZC7 A;  3BM6 A;  1STZ A;  3ZQ5 A;  3MGR C;  3AV1 D;  2HJE A;  5HFO A;  2XD5 A;  4QLC D;  3RFB A;  4DJ3 A;  3UDX A;  1MY8 A;  3MZF A;  4JF5 A;  4O0P A;  4WYY A;  3A0S A;  3G31 A;  4CLC C;  4GKU A;  3KXB C;  3IWI A;  3QP8 A;  3KUY C;  3NI9 A;  3QP6 A;  1SKO A;  4R70 A;  1E6P A;  1OTA A;  2I9V A;  3U2A A;  2PYO B;  1E6R A;  5AV9 D;  3LYX A;  3Q81 A;  5GSU A;  5B32 D;  3AZI C;  2HIO D;  1XA7 A;  4IVI A;  2OV5 A;  1X0O A;  1EQZ B;  1N9L A;  3N8R A;  3X1S D;  5EFW A;  2FJ7 A;  1P3F D;  1W1V A;  1L2S A;  4G3V A;  5GSU D;  1V9Z A;  5JYP A;  5FUG B;  2VA0 A;  4R6L A;  1K55 A;  4UEY A;  2RVQ D;  3HLD A;  4HBT A;  3LR5 A;  4J8X B;  3E0Y A;  3DWK A;  2FJ7 D;  1S1Z A;  5CP6 C;  1XFN A;  3MGQ A;  5TFQ A;  4OJP A;  1N1J A;  4NYY A;  1OGB A;  3W2Z A;  2W3H A;  1G68 A;  3AZL A;  3KS4 A;  2F8N H;  1KS0 A;  3MF0 A;  4WBG A;  4D2O A;  3MGQ D;  1XJ3 A;  2XQZ A;  5AV9 C;  3L29 A;  4BL3 A;  5B32 C;  1P3B A;  3DWZ A;  4HI4 A;  4Z2L A;  3AV2 B;  3FKW A;  1P34 A;  3X1S C;  4QHC A;  1P3F C;  1S67 L;  3NOP C;  5GXQ A;  3EPL A;  1M18 A;  4FCF A;  2BYK A;  4K08 A;  4UQI M;  3VP1 A;  5L09 A;  1EWZ A;  1P34 D;  1XGJ A;  2W3D A;  3BWL A;  2I72 A;  4GD6 A;  4Z2H A;  1P3O A;  5GXQ D;  3WX7 A;  2WKQ A;  3E4P A;  3W4P A;  1KVL A;  3SS3 A;  5KZH A;  3E98 A;  4OOL A;  4OP8 A;  2ZM5 A;  2KX6 A;  4L9G A;  1U35 B;  3OLO A;  2G5I C;  5B0Y B;  1E3U A;  2HDQ A;  5F68 A;  1P3O D;  1P3I B;  1BH9 A;  5B33 A;  3ZG5 A;  3LFV A;  3PR6 A;  2F8N G;  5AVB C;  4NZ3 A;  5F99 B;  3LGO A;  3OCN A;  1E3U D;  5BNV A;  1T18 A;  4WMC A;  3UPN A;  4DDS A;  4JXG A;  2JKT I;  4YIN A;  3AV1 B;  5B31 A;  4QLC B;  3NIA A;  5E43 A;  5F1G A;  1KE4 A;  4E3O A;  5JA4 A;  3HRE A;  4EXO A;  4H9Q B;  4GW9 A;  4II7 A;  3UO9 A;  4NZ5 A;  2ZOH A;  4ZUX A;  2XFS A;  2D49 A;  1XJ2 A;  3MS6 A;  4WEL A;  4E3M A;  3HBR A;  3A6N A;  4BMW A;  4B4X A;  3HUM A;  4PKY A;  5AV9 B;  4GS9 A;  4UA7 A;  3H7W A;  5GLC A;  2DF4 C;  4NXB A;  4Y17 A;  3SH9 A;  5HW3 A;  4H9N B;  5B32 B;  2HIO B;  3AN2 A;  2D02 A;  3D9Y A;  4GN2 A;  1CI9 A;  1SKO B;  2IWD A;  1BLC A;  3X1S B;  2EXA A;  1P3F B;  1W79 A;  3NUL A;  4ID4 A;  5GSU B;  3NOT C;  3AN2 D;  4PM8 A;  4KG2 A;  3LR3 A;  2CC1 A;  3V67 A;  1T1A A;  4NXF A;  1VEU A;  1GCE A;  3HLF A;  2FJ7 B;  2QHK A;  2Y8H A;  3UTA A;  1WWS A;  4S2L A;  3REI C;  3NJA A;  2O9A A;  3C7U A;  3A3I A;  4WUJ A;  5GLD A;  3MGQ B;  1Q9C A;  3SS5 A;  3H0M C;  4G91 B;  3UTA D;  4JJN C;  4LD9 C;  3WKJ D;  1OT6 A;  2Y4A A;  5E2F A;  3KSG A;  3IXB A;  4HNB A;  4BBT A;  3AZF A;  1MXO A;  3C1B A;  1YM1 A;  4FD8 A;  4OKP A;  5FSR A;  4G3W A;  1GSX A;  1XP4 A;  3W96 D;  3W99 C;  4HMC A;  3FZC A;  4PM6 A;  3BLM A;  4NE5 A;  4S2K A;  3EEA A;  4JXV A;  2HZ5 A;  3AZF D;  2VJW A;  3RXW A;  3C1B D;  1P34 B;  4WJ3 C;  4HHD A;  3T1R A;  1CK3 A;  3CLO A;  3VOL A;  3GV9 A;  5GXQ B;  1J7M A;  4NEE D;  3D3O A;  5HAR A;  3KS8 A;  3FV7 A;  4Y0T A;  2OAP 1;  3IF6 C;  3X1U A;  1T1B A;  3LZ1 D;  1P3O B;  4NXE A;  1G5U A;  4MBH A;  5B1M A;  1SZV A;  3CZD A;  4KGC A;  3CUE A;  4MBF A;  3N3F A;  3WKJ C;  2V5O A;  2JN7 A;  2F8N K;  4ZJ1 A;  4GH9 A;  5CGS A;  5CEB A;  1BH9 B;  2VGJ A;  1K25 A;  2HDS A;  4WU8 C;  4KGC D;  4NG2 A;  3W96 C;  1K57 C;  4WEK A;  1PI4 A;  2W3E A;  5FAO A;  4MN5 A;  4WZ4 A;  3U4L P;  4WZ5 C;  2ZY5 A;  1WE4 A;  5J8X A;  4EUZ A;  5B1L D;  4EO5 B;  2B5R A;  4JJN B;  4J8W C;  5F6A A;  5TR7 A;  3M6B A;  3C1C A;  5I5L A;  3V5M A;  1P3L C;  3LZ1 C;  5AY8 C;  5HD5 A;  4J8V C;  4GS9 B;  3H7W B;  3UB6 A;  4YM6 A;  3QP2 A;  3AN2 B;  2PD7 A;  4IBG A;  1F66 A;  5DTT A;  4YM6 D;  4H9P A;  3G35 A;  3AZN A;  3EPH A;  1N4O A;  1Z09 A;  3NBL A;  4S2N A;  5J4E A;  1TZY C;  2V0U A;  5FI2 A;  1F66 D;  1ERM A;  2WKP A;  2Z6D A;  5B1L C;  3PAG A;  3UTA B;  3P98 A;  3WKJ B;  4E3I A;  1OJG A;  3K3D A;  1XX2 A;  2YFW A;  1FCO A;  5GT3 A;  1S32 D;  3CPT A;  4LG2 A;  3LY3 A;  4GCZ A;  3W96 B;  2FH5 A;  1ZLA A;  5AJG A;  2M7V A;  1K56 A;  1K6R A;  5GT3 D;  3AZF B;  3WA9 C;  3MZD A;  5G4Y A;  4DF6 A;  3C1B B;  4FUW A;  4EU0 A;  1ZLA D;  2RCX A;  1K56 D;  3UPP A;  2WAF A;  5B2J C;  1OTI A;  1FSW A;  2NZD A;  3S7Q A;  1P3L B;  3LZ1 B;  1NXY A;  1O7E A;  3VSK A;  1KU5 A;  3M2J A;  4LV0 A;  2F2A C;  2VZW A;  2W0N A;  2NZD D;  1M40 A;  1YLY A;  3AFA C;  4HMD A;  2ZOI A;  1VHM A;  2CV5 A;  1S32 C;  4MN6 A;  4KGC B;  1KX5 C;  4DMZ A;  5FEG A;  2L4R A;  4OUI A;  5EUA A;  2PR5 A;  2CV5 D;  3O62 C;  2H0Y A;  5A90 A;  1MZU A;  5BS7 A;  1H0G A;  3WTP A;  3TU4 D;  2XSS A;  2O9C A;  3W97 C;  4LLO B;  5B1L B;  4ARZ A;  4E45 A;  3EOI A;  1GSV A;  1JTG A;  2J80 A;  4Z5T A;  3V3S A;  1EI5 A;  3VV4 A;  2PT7 A;  1TD5 A;  4HES A;  3H82 A;  3BQ8 A;  1LI0 A;  1B6W A;  4Z2G A;  3NHQ A;  1H5X A;  4Z5T D;  2RIQ A;  4R23 A;  3A3D A;  3W4O A;  4UA6 A;  3DTM A;  4E6W A;  3MKE A;  5BNX A;  2PRF A;  1KOU A;  2OLU A;  4QNL A;  1WYB A;  3MXS A;  4YM6 B;  5CHU A;  1TS7 A;  4WU9 A;  3JPU A;  1DP8 A;  1F66 B;  3TU4 C;  4H9P B;  5E2E A;  5M18 A;  4UPK A;  1YUE A;  5K5B A;  2HPB A;  4AWL C;  3G4P A;  3PBQ A;  3UT9 D;  4KZA A;  3V39 A;  4OJ6 A;  3PYP A;  1S32 B;  5HPF A;  1HTZ A;  5AV6 C;  5DFY A;  5CER A;  2OWH A;  1ID3 C;  2ARO D;  2YFW B;  1ERQ A;  4G3K A;  1JNU A;  4X6T A;  4H9R A;  3HLG A;  5GT3 B;  3WS2 A;  2P7J A;  2FN2 A;  3CPT B;  5AVC C;  5HDD A;  4JBF A;  4I3I A;  4QU3 A;  3FWL A;  2JSS A;  1ZLA B;  3EGD C;  3IS2 A;  3P01 A;  4C75 A;  3RJU A;  3EEH A;  4RX2 A;  4U3T A;  3HVF A;  3N4I A;  4OQ0 A;  3TW8 A;  4WLA A;  5CHL B;  1BTL A;  1OPX A;  2G7U A;  2XK1 A;  5HAP A;  2KOI A;  1H3Q A;  2A49 A;  4DJ2 A;  2JKR I;  2XF3 A;  5U47 A;  4Z2M H;  2P9V B;  5AV8 A;  2NZD B;  4GHA A;  1SCW A;  3UT9 C;  3MBZ A;  1YU3 A;  3EQV A;  3UNW A;  4CSR A;  1BLS A;  2O99 A;  1PRQ A;  3AZM A;  5DVA A;  5AV8 D;  5B32 G;  2ZY3 A;  4R1G A;  2ARO C;  1T19 A;  2CV5 B;  1F98 A;  4OLD A;  5CPI A;  3TU4 B;  3AZM D;  3LZ0 D;  5F82 A;  3T1X A;  1RCJ A;  4GD8 A;  1DP6 A;  3K3C A;  1CF0 A;  5HAI A;  5HPI A;  4KZ9 A;  3L26 A;  3Q07 A;  5AQ9 A;  4NK3 A;  3REJ A;  4Z5T B;  1NYY A;  3NDE A;  3LR0 A;  3MZE A;  3JVU A;  1KX4 A;  4EEU A;  5HD3 A;  4BLM A;  1NRJ A;  4Z2M G;  3MSH A;  3UDI A;  4MB5 A;  3VMA A;  3REJ D;  4YWZ A;  4CAY B;  1VM1 A;  1P97 A;  1E88 A;  4DRB A;  3H0R C;  2RTS A;  3IX3 A;  1KX4 D;  4S2P A;  1YSP A;  2K2N A;  2L1M A;  5BNX B;  4Z2J A;  3F1P A;  5GT0 A;  3RH8 B;  4ZTK A;  4B4Z A;  3LZ0 C;  2PBD P;  3S7P A;  4E3J A;  4KZ5 A;  3R7W B;  1P3A A;  2WZZ A;  1N9N A;  2QWS A;  3LIF A;  4ZJ2 A;  5GT0 D;  3UT9 B;  3OPP A;  2HDR A;  3BFD A;  3TG9 A;  1P3A D;  4IED A;  1IYO A;  1DJB A;  1LHY A;  1KGE A;  3QNB A;  2YKH A;  4BEN A;  1GA0 A;  2ARO B;  1E6N A;  4DE0 A;  3AZJ D;  2IOU A;  1ACF A;  1GHM A;  4Z66 C;  4GJ4 A;  1L0E A;  4GHI A;  4YS3 A;  3DW0 A;  2QJ5 A;  5BO0 B;  4IJF A;  3C7V A;  3PBS A;  4H9R B;  1D1J A;  3O86 A;  5MC7 A;  4N9K A;  4YS3 D;  3IS2 B;  1KX3 D;  3AYW D;  1F9I A;  2X01 A;  2XRN A;  5HSQ A;  1OT9 A;  3T12 B;  3QP4 A;  2W1T A;  4BD1 A;  1H8Z A;  3KWQ A;  3BFC A;  5AV8 B;  2HJ9 C;  1F1E A;  2HUE C;  4Y13 A;  4AFI A;  3AZJ C;  4EQI A;  5FI6 A;  4CSR B;  2V8C A;  4ZRR A;  3SH8 A;  3TOI A;  3KWQ D;  3AZM B;  3LZ0 B;  3MGP A;  4X1L A;  1WA9 A;  1YKD A;  2PD8 A;  3LO7 A;  3LJA D;  1S6R A;  2ZMV A;  4DE3 A;  1N9O A;  2Y79 A;  4KZ8 A;  3NEC A;  2D01 A;  3CIT A;  5FDS A;  2JKR M;  2GJ3 A;  2JC7 A;  3CI6 A;  1KX3 C;  3AYW C;  1EQZ C;  3EG5 B;  4PM9 A;  3PBR A;  2HDU A;  1D06 A;  2BYM B;  1UR8 A;  4MDZ A;  3LEL A;  3X1V A;  2XRO A;  1P3M A;  4IBR A;  1G6O A;  2VQR A;  3REJ B;  4RYE A;  4LRY C;  1KGF A;  2E8J A;  5FAT A;  2PYR A;  1KX4 B;  3UY6 A;  3SZT A;  1FR6 A;  3LEL D;  3NQU B;  5B40 D;  3ISG A;  3UB8 A;  2NUT C;  1LSW A;  1ZTU A;  3F1P B;  3NQJ A;  1W7F A;  5GT0 B;  4CLC E;  1K6S A;  1F5M A;  3AV2 C;  3A3J A;  2VV8 A;  4JGR A;  5DF8 A;  2HUE B;  4ME4 A;  1PIO A;  4CQH A;  1HVB A;  3CHW P;  3AZJ B;  3PBT A;  3B6F A;  2XEP A;  4Y0U A;  3C8C A;  2DCF A;  3REK A;  1LL8 A;  1K54 C;  1KGG A;  4OPY A;  1KE3 A;  2QYB A;  3IWQ A;  3B6F D;  3VOZ A;  3DTE A;  5DJT A;  1U35 C;  4GHI B;  3REK D;  1EAK A;  4CJN A;  5B0Y C;  5JYO A;  3I7J A;  1KX3 B;  1P3I C;  3AYW B;  2G5H C;  2RL3 A;  5E5A C;  4OON A;  5F99 C;  1N9B A;  4F94 A;  4XUJ A;  2EA9 A;  3UB7 A;  4LCL A;  4RVA A;  3W98 A;  4H6J A;  3AV1 C;  3HUN A;  3HSH A;  4QLC C;  4L9E A;  3X1T A;  4XUJ D;  5F1F A;  4KG6 A;  2W1T B;  3BW6 A;  5FQI A;  4KG5 A;  1TS6 A;  3KWQ B;  4I3J A;  4FOF A;  3NDG A;  5FQK A;  3D4F A;  3GQZ A;  1IKG A;  3LJA B;  1OME A;  4G92 C;  4KUD A;  2V1Z A;  3UTB A;  2HIO C;  3BYD A;  3AZL D;  4KZB A;  5HAQ A;  5JRG A;  4BBV A;  2PU2 A;  2ZMF A;  3D72 A;  2M7U A;  4LRZ E;  5GSU C;  1P3B D;  1S0W A;  1ERO A;  3B6G A;  1DJA A;  2RVQ C;  5JRG D;  3E4Q A;  5EM1 A;  2FJ7 C;  2PHY A;  4P0M A;  3VE4 A;  2Y55 A;  1NLZ A;  2Y2J A;  4P6Z M;  1M18 D;  3B6G D;  2J9P A;  1K55 C;  3PBO A;  3LEL B;  1SKF A;  3OCL A;  4KUO A;  3UB9 A;  1M1A A;  5B40 B;  1NZU A;  4HP4 A;  4EBL A;  5KDM B;  3P09 A;  3MGQ C;  3MGS A;  2WKI A;  4G91 C;  1W5D A;  5E5A B;  4PAU A;  5B33 D;  3G6O A;  4PM7 A;  3NQJ B;  3E2K A;  1W63 M;  3EGX C;  3MVD A;  1P3B C;  4M6B A;  4TX8 A;  4LPZ A;  3T50 A;  2ZQ9 A;  4WMC D;  1HD8 A;  2Z2L B;  1S1Y A;  1P34 C;  1ZC2 A;  4BQM A;  5B31 D;  5TBM A;  5GXQ C;  3PTE A;  3MVD D;  3REL A;  1CJF A;  1M18 C;  5L10 A;  3B6F B;  4G92 B;  3WD2 A;  2ZJ9 A;  4J8U A;  1UWP X;  4ZUX D;  5EOO A;  1P3O C;  4E6X A;  3A6N D;  2OSU A;  1H3O A;  3REL D;  4QD4 A;  4X1M A;  3OC2 A;  1PWG A;  3ZG7 B;  3VH6 A;  5B0Z A;  5B33 C;  1PYY A;  4FSF A;  1P3K A;  1E4D A;  4XUJ B;  4WEJ A;  3GSG A;  1O6I A;  1W2E A;  3FYZ A;  5B0Z D;  4MEZ A;  4GB7 A;  4H6J B;  5CHJ A;  4DE2 A;  5FAS A;  5B31 C;  2V8F A;  4EO5 C;  3B0C T;  2LB9 A;  3IX8 A;  3DBA A;  3PHY A;  4R8P A;  1N1J B;  1XFQ A;  5DJU A;  2XD1 A;  4ZUX C;  3AZL B;  5B2I A;  2INW A;  4DDY A;  3WS5 A;  4ETX A;  3OPL A;  3A6N C;  3REH A;  3T4K A;  4IJG A;  1YLT A;  1BH8 A;  3B3X A;  1P3B B;  3AN2 C;  1RGZ A;  4NE3 A;  5JRG B;  2PU4 A;  1CI8 A;  3V50 A;  3REH D;  5DF7 A;  4BJP A;  2A24 A;  2JKF A;  3IX4 A;  1M18 B;  3B6G B;  4UQI S;  2BYK B;  3AZE A;  5CPJ A;  5EV0 A;  4S2J A;  1OGG A;  4P6Z S;  4GNU A;  1FCN A;  2B18 A;  1WYC A;  3B0B A;  3UTA C;  3F1N A;  3AZE D;  5CPJ D;  1TAF A;  2ZM2 A;  1BLP A;  3X1U D;  4NYU A;  1Y28 A;  3BQA A;  5B33 B;  3T1S A;  5B1M D;  5AY8 A;  1NWZ A;  1I5Q A;  1ULY A;  3T4T A;  4GOG A;  5BNV B;  3HON A;  3AZF C;  3IT9 A;  3O87 A;  2WGI A;  3C1B C;  3WS0 A;  5B31 B;  1KDW A;  2WAE A;  5EEC A;  5DNM A;  3MVD B;  3B0D C;  5JA4 B;  1ESU A;  2WGV A;  3VP4 A;  4E3N A;  5KSC A;  2HV1 A;  4OVD A;  4ZUX B;  1Z6F A;  5F5Y A;  4QWO A;  5TBM B;  4KHA A;  5AQA A;  3A6N B;  4EBP A;  4H9S A;  3REL B;  5CHM A;  3C2W A;  1R4V A;  4M4X A;  4GDB A;  3C1C D;  5DNN A;  1LLB A;  3X1U C;  3T4J A;  1PZR A;  3A0V A;  1H3O B;  5B1M C;  4HP9 A;  2OAQ 1;  4MMN A;  4KGC C;  2GDN A;  3CUE C;  4S2O A;  2AVX A;  4S2M A;  1OTB A;  4IBX A;  2J9O A;  3AZK A;  3WD4 A;  1KDS A;  3AZG A;  1U60 A;  4OQI A;  5B0Z B;  1VEU B;  4DRT A;  2HP5 A;  2FZ0 A;  3AZN D;  5L2F A;  3G2Y A;  1M19 A;  3AZK D;  3AZH A;  3ZCZ A;  1XXM A;  1V9Y A;  3KFU G;  1W63 Q;  1TS0 A;  2ZM8 A;  4MN7 A;  4Y0O A;  3LR4 A;  3VH6 T;  5B24 A;  3FKV A;  4I38 A;  4GLQ A;  3C1C C;  5B24 D;  1YQS A;  3VH5 A;  5GHY A;  4KUK A;  2IA2 A;  3REH B;  1GHI A;  2EX8 A;  3LIC A;  1KX5 A;  4YM6 C;  1BH8 B;  4NZ1 A;  4OLG A;  2WKH A;  3B0D B;  3LY4 A;  3SH7 A;  4EES A;  2F8N A;  1F66 C;  2WAD A;  1OTD A;  2GNX A;  3MKF A;  3AZN C;  4S2N C;  1FR1 A;  4HGA B;  2YFV A;  1W8Q A;  2ZY2 A;  3AZE B;  5FEF A;  5CPJ B;  2QMI A;  4XZQ A;  3X1U B;  2WYX A;  3BFE A;  3GR2 A;  2JHE A;  5B1M B;  5CPK A;  3F1N B;  2VV6 A;  1TAF B;  2W8S A;  4XZQ D;  3MJQ A;  4HJ4 A;  4X55 A;  4DXC A;  3IHA A;  1TEM A;  5GT3 C;  3S7N A;  2EX6 A;  2W3F A;  4IUH A;  5FA7 A;  1ZLA C;  2NQB A;  2Y2H A;  1NYM A;  3IH8 A;  1CXW A;  4X23 A;  4DKI A;  3WTP D;  1S4S A;  4FH2 A;  2FFF B;  4WN5 A;  3G32 A;  2NZD C;  3FKE A;  3C1C B;  5DFX A;  4KHA B;  1JWV A;  5G4Z A;  4HJ6 A;  3T4S A;  3G30 A;  1HZO A;  1SDN A;  5AV6 A;  4XT2 A;  4O8G A;  2CV5 C;  3AZN B;  1Q2Q A;  5HZH A;  3QHY A;  3AZK B;  2QPN A;  4WU9 D;  3C4P A;  3Q1F A;  3P5J B;  4Q0I A;  2Y2L A;  5BS7 C;  4WNN A;  1MKM A;  1IEM A;  1YMX A;  2GZA A;  5J7E A;  3FC7 A;  4Z5T C;  3BY9 A;  2PBY A;  2IO5 B;  3OPR A;  3L2A A;  4DQY B;  4I5S A;  4EEP A;  3T4L A;  2Y2K A;  5B24 B;  2H0T A;  2ZQD A;  5IHV A;  1MPL A;  4OJO A;  1GSW A;  1LL9 A;  3HLW A;  4H9O A;  1P3G A;  4EW7 A;  1YLW A;  4IVK A;  1L0G A;  2P08 A;  4UHU A;  1KE0 A;  3HUO A;  1H8M A;  4UUZ A;  2V2F F;  3Q7Z A;  3GVB A;  4WM9 A;  1P3G D;  3R4K A;  3WAA A;  3O3V A;  4MB4 A;  4WU9 C;  4RQ9 A;  1ODV A;  3HLB A;  2XLN A;  1G6A A;  3ZG0 A;  2V20 A;  4WL9 A;  3M7P A;  4E3K A;  2EX2 A;  4LV1 A;  3VH5 T;  3WAA D;  2YFV B;  2K7S A;  2WZX A;  5FQM A;  4XUX A;  4K0X A;  5HL1 A;  4XZQ B;  1P3P A;  4WV4 B;  2Y2G A;  1Y4O A;  5FAP A;  4EWF A;  2PDR A;  4ESP A;  3WD3 A;  2E8I A;  3B42 A;  4KZ6 A;  4C6Y A;  3A3E A;  1FIL A;  3IWO A;  1SHV A;  5CPI D;  1AIW A;  1HQ3 A;  4X25 A;  2ZC5 B;  3WTP B;  4ARZ B;  2C5W B;  1H0M A;  3N7W A;  4X53 A;  4IBJ A;  3H82 B;  3KSF A;  4HY8 A;  4LRX C;  5AV5 A;  4M3K A;  5D3O A;  1YT4 A;  3FDD A;  4BD0 A;  4ETZ A;  2BG1 A;  5AV8 C;  5AV5 D;  1NRF A;  2ACG A;  3UE6 A;  5M19 A;  1JTD A;  1ONH A;  1XGI A;  2H5S A;  2R9W A;  1RP5 A;  3TJZ C;  3Q82 A;  3R45 A;  4FTX A;  3AZM C;  4XT2 B;  2V1A A;  2Q9M A;  4WU9 B;  5CPI C;  1AOI A;  4O01 A;  3GTC A;  4R4R A;  1D7E A;  4EV4 A;  2V0W A;  3BEB A;  2J3W A;  2WUQ A;  3VP0 A;  1PW1 A;  3BY8 A;  1ZG4 A;  2Q0O A;  4O7D A;  1J9M A;  5FAQ A;  4KQR A;  5DKL A;  1P0Z A;  4A5R A;  3REJ C;  4Q0J A;  5DKK A;  5F83 A;  1ZG6 A;  3O5Y A;  4PMA A;  5HL6 A;  1KX4 C;  1W1Y A;  3GEC A;  4CPK A;  4L0L A;  1NY0 A;  5GLA A;  3MQ0 A;  1S4R A;  3VE3 A;  1JVJ A;  1VQQ A;  3L25 A;  2M1C A;  2Y2N A;  3K2N A;  4H9O B;  1P3G B;  4HOI A;  1GXD A;  3O88 A;  2JCH A;  2PYO A;  4JGP A;  5GT0 C;  5B31 G;  1P3A C;  3WAA B;  1VB6 A;  2EWW A;  5C3I B;  4IHQ A;  5E2H A;  4HH2 A;  3ZYT A;  5FUG A;  5EVI A;  2XH9 A;  3C30 A;  2J8P A;  4PKY G;  4J8X A;  3A1I A;  3ZG9 B;  3DTK A;  3EPJ A;  2G2W A;  4HQA A;  5EVI D;  5BT1 D;  1LSV A;  5CPI B;  3HLE A;  5TJJ A;  1NZO A;  4J8X D;  2X02 A;  4YS3 C;  1H8P A;  5I94 A;  3MNN A;  3MGP D;  2CMN A;  5AVE A;  3HL9 A;  3S22 A;  4Y7P A;  1PDC A;  3MQL A;  4P6B A;  3AL0 C;  3AGF A;  1MC0 A;  1YLJ A;  2LB5 A;  3MNN D;  2A3U A;  1JWP A;  3V9R A;  3MGR A;  4F3L A;  2ZL1 A;  1ALQ A;  4X69 A;  3LIB A;  5AV5 B;  3BJN A;  4X56 A;  3X1V D;  2PYP A;  1P3M D;  3B33 A;  3RXX A;  3ZG8 B;  4CLC A;  3KXB A;  1ZHH B;  1ES2 A;  3MGR D;  3KUY A;  3KWQ C;  2B02 A;  5FQJ A;  1K4E A;  4D60 A;  5J3W A;  4K0W A;  3MMH A;  3LJA C;  3MFD A;  4KQQ A;  4CLC D;  3KXB D;  3KUY D;  3AZI A;  3HJI A;  1H8Y A;  1YLZ A;  2IWB A;  3MGP C;  1W1P A;  1S66 L;  4N1X A;  3T1Q B;  4MBK A;  1P3A B;  3F6T A;  1BLH A;  5FQQ A;  1TDG A;  5HDS A;  3AZI D;  5CTM A;  2WKE A;  1P9R A;  4OJ5 A;  3IXD A;  4GZB A;  1PZP A;  1XJ4 A;  2ZMA A;  2EX9 A;  4B88 A;  5CP6 A;  2VK3 A;  4EBN A;  4NXG A;  3LEL C;  4EET B;  3X1V C;  1P3M C;  1YSQ A;  1NLY A;  3TRC A;  2Y2M A;  5CED A;  5B40 C;  4YS3 B;  4ZAM A;  1XA1 A;  3BLS A;  5CP6 D;  2DQN C;  2XFT A;  1Q2P A;  3OOV A;  3NCK A;  5HDC A;  5AV9 A;  4H9N A;  5B32 A;  3FG8 A;  2HIO A;  1DY6 A;  2KDK A;  3SW1 A;  1H0I A;  3X1S A;  3M6H A;  1P3F A;  4IBK A;  4ZBE A;  4Z9Q A;  2R9X A;  2JKG A;  4UA9 A;  3W98 D;  1PNE A;  2ZQC A;  4KQD A;  4Z1W A;  3X1T D;  1L6J A;  1XKZ A;  3EQU A;  3FPV A;  5EVI B;  5CGX A;  3B6F C;  3G2Z A;  1AWI A;  4R3J A;  3REK C;  3MGP B;  5CXW A;  1PWC A;  2EFU A;  3A1K A;  5EPH A;  4LFU A;  3A3F A;  5GHZ A;  5AVB A;  4KUD D;  1ES5 A;  3UTB D;  3MNN B;  4DN0 A;  3AGE A;  4EQ1 A;  4GHL A;  1J3W A;  2WK0 A;  1P9W A;  5AVB D;  4E3L A;  2XGN A;  4NFT A;  1W1T A;  4XUJ C;  1YU2 A;  3C4O A;  1EW0 A;  1E15 A;  3X1V B;  1P3M B;  3W98 C;  1DJC A;  1ESI A;  3V9R B;  3MGR B;  1XPB A;  3C38 A;  2X71 A;  4F3L B;  4HJ3 A;  2ZL1 B;  4OJL A;  3X1T C;  2HGV A;  1QME A;  1GHP A;  2Y91 A;  2GX5 A;  2ZQ8 A;  4CLC B;  3CAX A;  4OPQ A;  4K91 A;  3KXB B;  1M1A D;  3UB5 P;  2L5A A;  2EFX A;  3MXQ A;  3KUY B;  3AZL C;  3LUQ A;  5EVE A;  3SS4 A;  2EWV A;  4YFM A;  3MGS D;  4HBU A;  1TS8 A;  4L9F A;  2WKR A;  4IBI A;  4Z2I A;  2Y59 A;  4KUD C;  3UTB C;  3AZI B;  2ZD8 A;  2K31 A;  3Q7V A;  5JRG C;  3KO6 A;  4LCM A;  3B0C W;  1HLU P;  4C3Q A;  4Y3I A;  3B6G C;  3L7H A;  3REI A;  1TVF A;  3REK B;  5LBR A;  3KX0 X;  3BFF A;  5IT5 A;  3WWX A;  5CP6 B;  5EOE A;  3A0R A;  1M6K A;  4JJN A;  4LD9 A;  4N1H A;  2J8Y A;  4J8U D;  3REI D;  1M1A C;  4R4S A;  3MGS C;  3GDI A;  1PWD A;  1UR9 A;  1L0D A;  5EE8 A;  2Y2O A;  2XR0 A;  4JJN D;  4LD9 D;  3SOI A;  3W99 A;  4GDN A;  5HWT A;  3VOY A;  4RA7 A;  3E2L A;  4QJG A;  3VP3 A;  4IJE A;  3W98 B;  3NC8 A;  5IU1 A;  2IWC A;  1P3K D;  3OPH A;  3W99 D;  3X1T B;  4Y5F A;  3S7O A;  3MVD C;  4BBU A;  3H9W A;  3IF6 A;  2XDM A;  1E25 A;  4NET A;  3REL C;  3V3R A;  4R8P D;  3UE0 A;  3UMD A;  5F69 A;  4KUD B;  3WKJ A;  3UTB B;  4J8U C;  3L28 A;  4HH3 A;  4EER A;  5B2I D;  3CG5 A;  1K4F A;  1JFI A;  3N8L A;  2ZQA A;  5L07 A;  5FI7 A;  3HLC A;  5TGF A;  4WU8 A;  4S2I A;  4NY2 A;  1MKI A;  5AVB B;  3NY4 A;  3W96 A;  3KYZ A;  5CRF A;  1K57 A;  1Z2C B;  1FCM A;  4OH0 A;  5A93 A;  3UE1 A;  5B0Z C;  1MWT A;  3BRM A;  4WZ5 A;  4Y2F A;  4B9O A;  4WU8 D;  1P3K C;  1FOF A;  3F1O A;  2O0Y A;  3ZHH A;  5BOH A;  4KQO A;  4J8W A; 
#chains in the Genus database with same CATH homology
 1YU1 A;  1M1A B;  1IYP A;  4JKT A;  1P3L A;  3PBN A;  3W8K A;  4NE6 A;  3LZ1 A;  3MGS B;  2QZ6 A;  4R8P C;  4J8V A;  3UPO A;  2UWX A;  4J8W D;  5DTK A;  5B2I C;  1P3L D;  3S1Y A;  5AY8 D;  2G2U A;  4J8V D;  3REH C;  4N92 A;  1IYS A;  5DF9 A;  5KMW A;  3Q7V B;  1TZY A;  1LL5 A;  2HP9 A;  3VH6 W;  4X68 A;  5DNM D;  4LEN A;  5B1L A;  4ZJ3 A;  4HGA C;  2ZC4 B;  3AZE C;  5CPJ C;  1TZY D;  4J8U B;  3REI B;  1IYQ A;  4JF4 A;  4RX3 A;  1MBL A;  4LD9 B;  1IKI A;  5DNN D;  4IBD A;  2Y2P A;  3WA9 A;  1P3K B;  3W99 B;  4R0Q A;  3ZNY A;  3AZG D;  5B2J A;  1I2S A;  3JYI A;  4LV2 A;  3WA9 D;  3L27 A;  3ZVT A;  3GMW A;  4H8R A;  1YU4 A;  5DNM C;  1M19 D;  3AZH D;  4R8P B;  2DNS A;  5B2J D;  1L0F A;  3IHB A;  3IF6 B;  4MNR A;  5B2I B;  3AFA A;  4UAA A;  4DE1 A;  4H9S C;  1S32 A;  5DTS A;  1ZKJ A;  5DNN C;  3AFA D;  1YLP A;  4KZ4 A;  1JFI B;  2ZY4 A;  3O62 A;  4MLL A;  4WU8 B;  1KX5 D;  4BL2 A;  4NZ4 A;  3W97 A;  3CJM A;  3AZK C;  4OPZ A;  3AZG C;  3KSY A;  2F8N D;  3O62 D;  4QY5 A;  1YU0 A;  4P85 A;  1MWS A;  5G18 A;  3W97 D;  2LY8 A;  1M19 C;  3AZH C;  4OPR A;  3N6I A;  4JF6 A;  4J8W B;  2IO5 C;  2P9V A;  1MWU A;  2ZM0 A;  5FDH A;  5AY8 B;  5B24 C;  5CPK D;  4J8V B;  4OQG A;  3ITB A;  1FQG A;  4IBE A;  2C6W B;  4HEF A;  1CEG A;  4LV3 A;  2NQB D;  3TU4 A;  5DNM B;  4JLF A;  1YMS A;  2WGW A;  1A7W A;  4X23 D;  4OOY A;  1TZY B;  3BEC A;  5A92 A;  3S4X A;  4PM5 A;  3ZGA B;  4E44 A;  5FQ9 A;  1ID3 A;  4XZQ C;  5DNN B;  2P74 A;  3IF5 A;  3WTP E;  5BPV A;  3WRT A;  3IP4 C;  5CPK C;  5AV6 D;  5AVC A;  4CAY A;  1ID3 D;  4IBC A;  1IEL A;  3AZG B;  1ONG A;  5HX9 A;  3WA9 B;  1PW8 A;  3WTP C;  5AVC D;  1NJ4 A;  3IH9 A;  2NQB C;  3VH5 W;  1M19 B;  3AZH B;  4DXB A;  5B2J B;  4X23 C;  4JXW A;  1W8Y A;  2CWE A;  3CMZ A;  3OZH A;  5AQB A;  3UT9 A;  1HTA A;  4U0T A;  3AFA B;  3ITA A;  2ARO A;  5G49 A;  3WS4 A;  4QY6 A;  4QB8 A;  3ZVW A;  4PPR A;  1T3U A;  1KX5 B;  3IQA A;  5GLB A;  5BO0 A;  2F8N B;  3O62 B;  3N8S A;  3WRZ A;  3W97 B;  4IBF A;  3UE3 A;  5M1A A;  4P87 A;  3ZFZ A;  4WZS B;  1B67 A;  3TSG A;  4N9L A;  2ZLY A;  5CPK B;  1P3P D;  5A91 A;  3H0L C;  4DRA A;  5KSH A;  3MXR A;  2NQB B;  3VFF A;  3LZ0 A;  1P3G C;  2EXB A;  2JBF A;  3WS1 A;  4Q8I A;  4X23 B;  1HQ3 D;  2OLV A;  3GRJ A;  2WGW B;  3WAA C;  1PI5 A;  2J7V A;  2FFY A;  1GA9 A;  4AWL B;  1RGY A;  5C3I C;  4OQH A;  3LCE A;  2H10 A;  2BYM A;  4Z66 A;  5AV6 B;  3UN7 A;  1ID3 B;  4JPM A;  1P3P C;  5GL9 A;  1KVM A;  2ZC6 B;  2HP6 A;  4JXS A;  4KZ3 A;  3NQU A;  3VP2 A;  4Z66 D;  5AVC B;  3W4Q A;  3IXH A;  3ZNT A;  2JE5 A;  2VGK A;  1O07 A;  1AOI D;  4FH4 A;  1HQ3 C;  4WNN B;  1JWZ A;  1QMF A;  5CTN A;  3QNC A;  1BUE A;  5AV5 C;  4XUZ A;  3AGD A;  3LEZ A;  3AZJ A;  3UDF A;  5EVL A;  2Y2I A;  5CGW A;  4XXR A;  4OOM A;  5G49 B;  4U0X A;  4UUZ B;  1LI9 A;  1KX3 A;  3AYW A;  1EQZ A;  2PYO D;  4ZDX A;  1AOI C;  3VFH A;  1AXB A;  4IBB A;  1BT5 A;  4ZBJ C;  1EQZ D;  5GHX A;  1ES3 A;  1P3P B;  5CEC A;  1MWR A;  3BFG A;  2DRW A;  3PAE A;  2BLS A;  1TDL A;  3C5A A;  1BUL A;  5E2G A;  3G34 A;  3LJA A;  4OP5 A;  1HQ3 B;  3M2K A;  1I2W A;  1SDE A;  2ZQ7 A;  1CEF A;  4KZ7 A;  1Y54 A;  3IXG A;  3AV2 A;  3ZDJ A;  2ZC3 B;  2PYO C;  1ES4 A;  5AQ7 A;  1K38 A;  3EPK A;  1BFM A;  3AV2 D;  1C3B A;  1FSY A;  1K54 A;  1BZA A;  5EVI C;  2Q9N A;  5BT1 C;  4Z66 B;  3R45 B;  4J8X C;  4KEN B;  1U35 A;  5B40 A;  5B0Y A;  5KDM A;  2Y2Q A;  1P3I A;  5E5A A;  1AOI B;  1PZO A;  1BSG A;  5F99 A;  1WWI A;  1U35 D;  3MNN C;  5B0Y D;  4ZBJ B;  1P3I D;  4R3B A;  3AV1 A;  5E5A D;  4QLC A;  5F99 D;  2Z2M B;  3VSL A;  4H9Q A;  2ZC7 A;  3BM6 A;  3MGR C;  3AV1 D;  5HFO A;  2XD5 A;  4QLC D;  3UDX A;  1MY8 A;  3MZF A;  4JF5 A;  4WYY A;  3G31 A;  4GKU A;  3KXB C;  3IWI A;  3KUY C;  3NI9 A;  2PYO B;  5AV9 D;  3Q81 A;  5GSU A;  5B32 D;  3AZI C;  2HIO D;  1XA7 A;  4IVI A;  2OV5 A;  1EQZ B;  3N8R A;  3X1S D;  2FJ7 A;  1P3F D;  1L2S A;  5GSU D;  5JYP A;  5FUG B;  1K55 A;  3HLD A;  2RVQ D;  4HBT A;  4J8X B;  3DWK A;  2FJ7 D;  5CP6 C;  3MGQ A;  5TFQ A;  4OJP A;  1N1J A;  4NYY A;  1G68 A;  3AZL A;  3KS4 A;  2F8N H;  4D2O A;  4WBG A;  3MGQ D;  2XQZ A;  5AV9 C;  3L29 A;  4BL3 A;  5B32 C;  1P3B A;  3DWZ A;  3AV2 B;  3FKW A;  1P34 A;  3X1S C;  4QHC A;  1P3F C;  5GXQ A;  3EPL A;  1M18 A;  4FCF A;  2BYK A;  3VP1 A;  1EWZ A;  1P34 D;  1XGJ A;  2I72 A;  4GD6 A;  1P3O A;  5GXQ D;  3WX7 A;  3W4P A;  1KVL A;  3SS3 A;  5KZH A;  4OOL A;  4OP8 A;  2ZM5 A;  1U35 B;  2G5I C;  5B0Y B;  1E3U A;  2HDQ A;  1P3O D;  1P3I B;  1BH9 A;  5B33 A;  3ZG5 A;  2F8N G;  5AVB C;  4NZ3 A;  5F99 B;  3OCN A;  1E3U D;  5BNV A;  4WMC A;  3UPN A;  4DDS A;  4JXG A;  4YIN A;  3AV1 B;  5B31 A;  4QLC B;  3NIA A;  5E43 A;  5F1G A;  1KE4 A;  4E3O A;  5JA4 A;  3HRE A;  4H9Q B;  3UO9 A;  4NZ5 A;  4ZUX A;  2XFS A;  4WEL A;  4E3M A;  3HBR A;  3A6N A;  4B4X A;  3HUM A;  5AV9 B;  4UA7 A;  5GLC A;  2DF4 C;  3SH9 A;  5HW3 A;  4H9N B;  5B32 B;  2HIO B;  3AN2 A;  4GN2 A;  1CI9 A;  2IWD A;  1BLC A;  3X1S B;  2EXA A;  1P3F B;  1W79 A;  4ID4 A;  5GSU B;  3AN2 D;  4PM8 A;  4KG2 A;  2CC1 A;  1GCE A;  3HLF A;  2FJ7 B;  3UTA A;  1WWS A;  4S2L A;  3REI C;  3C7U A;  3A3I A;  5GLD A;  3MGQ B;  1Q9C A;  3SS5 A;  3H0M C;  4G91 B;  3UTA D;  4JJN C;  4LD9 C;  3WKJ D;  2Y4A A;  5E2F A;  3IXB A;  3AZF A;  1MXO A;  3C1B A;  1YM1 A;  4FD8 A;  4OKP A;  5FSR A;  1XP4 A;  3W96 D;  3W99 C;  3FZC A;  4PM6 A;  3BLM A;  4NE5 A;  4S2K A;  4JXV A;  3AZF D;  3RXW A;  3C1B D;  1P34 B;  4WJ3 C;  1CK3 A;  3GV9 A;  5GXQ B;  5HAR A;  3KS8 A;  3FV7 A;  4Y0T A;  3IF6 C;  3X1U A;  3LZ1 D;  1P3O B;  4MBH A;  5B1M A;  3CZD A;  4KGC A;  4MBF A;  3N3F A;  3WKJ C;  2F8N K;  4ZJ1 A;  4GH9 A;  5CGS A;  5CEB A;  1BH9 B;  2VGJ A;  1K25 A;  2HDS A;  4WU8 C;  4KGC D;  3W96 C;  1K57 C;  4WEK A;  1PI4 A;  5FAO A;  4WZ4 A;  4WZ5 C;  2ZY5 A;  1WE4 A;  5J8X A;  4EUZ A;  5B1L D;  4EO5 B;  2B5R A;  4JJN B;  4J8W C;  5TR7 A;  3M6B A;  3C1C A;  3V5M A;  1P3L C;  3LZ1 C;  5AY8 C;  4J8V C;  4YM6 A;  3AN2 B;  4IBG A;  1F66 A;  5DTT A;  4YM6 D;  4H9P A;  3G35 A;  3AZN A;  3EPH A;  1N4O A;  4S2N A;  3NBL A;  1TZY C;  5FI2 A;  1F66 D;  1ERM A;  5B1L C;  3PAG A;  3UTA B;  3P98 A;  3WKJ B;  4E3I A;  1XX2 A;  2YFW A;  1FCO A;  5GT3 A;  1S32 D;  4LG2 A;  3LY3 A;  3W96 B;  1ZLA A;  1K56 A;  1K6R A;  5GT3 D;  3AZF B;  3WA9 C;  3MZD A;  4DF6 A;  3C1B B;  1ZLA D;  2RCX A;  1K56 D;  3UPP A;  2WAF A;  5B2J C;  1FSW A;  2NZD A;  1P3L B;  3LZ1 B;  1NXY A;  1O7E A;  3VSK A;  1KU5 A;  3M2J A;  4LV0 A;  2F2A C;  2NZD D;  1M40 A;  1YLY A;  3AFA C;  2CV5 A;  1S32 C;  4KGC B;  1KX5 C;  4OUI A;  5EUA A;  2CV5 D;  3O62 C;  2H0Y A;  5A90 A;  5BS7 A;  3WTP A;  3TU4 D;  3W97 C;  5B1L B;  4E45 A;  1JTG A;  4Z5T A;  3V3S A;  1EI5 A;  4HES A;  1LI0 A;  1B6W A;  1H5X A;  4Z5T D;  2RIQ A;  4R23 A;  3A3D A;  3W4O A;  4UA6 A;  3DTM A;  4E6W A;  3MKE A;  5BNX A;  2OLU A;  4QNL A;  1WYB A;  3MXS A;  4YM6 B;  5CHU A;  4WU9 A;  1F66 B;  3TU4 C;  4H9P B;  5E2E A;  5M18 A;  4UPK A;  1YUE A;  2HPB A;  4AWL C;  3G4P A;  3PBQ A;  3UT9 D;  4KZA A;  3V39 A;  4OJ6 A;  1S32 B;  1HTZ A;  5AV6 C;  5CER A;  1ID3 C;  2ARO D;  2YFW B;  1ERQ A;  4X6T A;  3WS2 A;  4H9R A;  3HLG A;  5GT3 B;  5AVC C;  4JBF A;  4QU3 A;  3FWL A;  2JSS A;  1ZLA B;  4C75 A;  3RJU A;  4RX2 A;  4U3T A;  3HVF A;  3N4I A;  4OQ0 A;  5CHL B;  1BTL A;  2XK1 A;  5HAP A;  2A49 A;  2XF3 A;  5U47 A;  4Z2M H;  2P9V B;  5AV8 A;  2NZD B;  4GHA A;  1SCW A;  3UT9 C;  3MBZ A;  1YU3 A;  3EQV A;  3UNW A;  4CSR A;  1BLS A;  3AZM A;  5DVA A;  5AV8 D;  5B32 G;  2ZY3 A;  4R1G A;  2ARO C;  2CV5 B;  4OLD A;  5CPI A;  3TU4 B;  3AZM D;  3LZ0 D;  5F82 A;  1RCJ A;  4GD8 A;  5HAI A;  4KZ9 A;  3L26 A;  3Q07 A;  5AQ9 A;  4NK3 A;  3REJ A;  4Z5T B;  1NYY A;  3NDE A;  3MZE A;  1KX4 A;  4BLM A;  4Z2M G;  3UDI A;  3VMA A;  3REJ D;  4CAY B;  1VM1 A;  4DRB A;  3H0R C;  1KX4 D;  4S2P A;  5BNX B;  5GT0 A;  4B4Z A;  4ZTK A;  3LZ0 C;  4E3J A;  4KZ5 A;  1P3A A;  2WZZ A;  4ZJ2 A;  5GT0 D;  3UT9 B;  3OPP A;  2HDR A;  3BFD A;  3TG9 A;  1P3A D;  4IED A;  1IYO A;  1DJB A;  1LHY A;  1KGE A;  3QNB A;  4BEN A;  1GA0 A;  2ARO B;  4DE0 A;  3AZJ D;  2IOU A;  1GHM A;  4Z66 C;  1L0E A;  4YS3 A;  3DW0 A;  5BO0 B;  4IJF A;  3C7V A;  3PBS A;  4H9R B;  3O86 A;  4N9K A;  4YS3 D;  1KX3 D;  3AYW D;  2X01 A;  4BD1 A;  1H8Z A;  3KWQ A;  3BFC A;  5AV8 B;  1F1E A;  2HUE C;  3AZJ C;  4EQI A;  5FI6 A;  4CSR B;  3SH8 A;  3TOI A;  3KWQ D;  3AZM B;  3LZ0 B;  3MGP A;  3LO7 A;  3LJA D;  1S6R A;  4DE3 A;  4KZ8 A;  2JC7 A;  1KX3 C;  3AYW C;  1EQZ C;  3EG5 B;  4PM9 A;  3PBR A;  2HDU A;  2BYM B;  3LEL A;  3X1V A;  1P3M A;  4IBR A;  2VQR A;  3REJ B;  4RYE A;  1KGF A;  5FAT A;  1KX4 B;  3UY6 A;  1FR6 A;  3LEL D;  3NQU B;  5B40 D;  3ISG A;  3NQJ A;  1W7F A;  5GT0 B;  1K6S A;  3AV2 C;  3A3J A;  5DF8 A;  2HUE B;  1PIO A;  1HVB A;  3AZJ B;  3PBT A;  3B6F A;  2XEP A;  4Y0U A;  2DCF A;  3REK A;  1K54 C;  1KGG A;  4OPY A;  1KE3 A;  3IWQ A;  3B6F D;  3VOZ A;  1U35 C;  3REK D;  4CJN A;  5B0Y C;  5JYO A;  3I7J A;  1KX3 B;  1P3I C;  3AYW B;  2G5H C;  2RL3 A;  5E5A C;  4OON A;  5F99 C;  1N9B A;  4F94 A;  4XUJ A;  4LCL A;  4RVA A;  3W98 A;  3AV1 C;  3HUN A;  3HSH A;  4QLC C;  3X1T A;  4XUJ D;  5F1F A;  4KG6 A;  5FQI A;  4KG5 A;  3KWQ B;  3NDG A;  5FQK A;  3D4F A;  3GQZ A;  1IKG A;  3LJA B;  1OME A;  4G92 C;  4KUD A;  2V1Z A;  3UTB A;  2HIO C;  3BYD A;  3AZL D;  4KZB A;  5HAQ A;  5JRG A;  2PU2 A;  5GSU C;  1P3B D;  1S0W A;  1ERO A;  3B6G A;  1DJA A;  2RVQ C;  5JRG D;  2FJ7 C;  4P0M A;  2Y55 A;  2Y2J A;  1M18 D;  3B6G D;  2J9P A;  1K55 C;  3PBO A;  3LEL B;  1SKF A;  3OCL A;  1M1A A;  5B40 B;  1NZU A;  4EBL A;  5KDM B;  3P09 A;  3MGQ C;  3MGS A;  2WKI A;  4G91 C;  1W5D A;  5E5A B;  5B33 D;  4PM7 A;  3NQJ B;  3E2K A;  3MVD A;  1P3B C;  4M6B A;  2ZQ9 A;  4WMC D;  1HD8 A;  2Z2L B;  1P34 C;  1ZC2 A;  4BQM A;  5B31 D;  5GXQ C;  3PTE A;  3MVD D;  3REL A;  1M18 C;  3B6F B;  4G92 B;  2ZJ9 A;  4J8U A;  4ZUX D;  5EOO A;  1P3O C;  4E6X A;  3A6N D;  2OSU A;  1H3O A;  3REL D;  4QD4 A;  3OC2 A;  1PWG A;  3ZG7 B;  3VH6 A;  5B0Z A;  5B33 C;  1PYY A;  4FSF A;  1P3K A;  1E4D A;  4XUJ B;  4WEJ A;  3GSG A;  1W2E A;  3FYZ A;  5B0Z D;  4MEZ A;  4GB7 A;  5CHJ A;  4DE2 A;  5FAS A;  5B31 C;  4EO5 C;  3B0C T;  4R8P A;  1N1J B;  2XD1 A;  4ZUX C;  3AZL B;  5B2I A;  4DDY A;  3WS5 A;  3OPL A;  3A6N C;  3REH A;  1YLT A;  1BH8 A;  3B3X A;  1P3B B;  3AN2 C;  1RGZ A;  4NE3 A;  5JRG B;  2PU4 A;  1CI8 A;  3V50 A;  3REH D;  5DF7 A;  4BJP A;  1M18 B;  3B6G B;  2BYK B;  3AZE A;  5CPJ A;  4S2J A;  4GNU A;  1FCN A;  1WYC A;  3B0B A;  3UTA C;  3AZE D;  5CPJ D;  1TAF A;  2ZM2 A;  1BLP A;  3X1U D;  4NYU A;  5B33 B;  5B1M D;  5AY8 A;  1I5Q A;  1ULY A;  4GOG A;  5BNV B;  3HON A;  3AZF C;  3IT9 A;  3O87 A;  2WGI A;  3C1B C;  3WS0 A;  5B31 B;  1KDW A;  2WAE A;  5EEC A;  5DNM A;  3MVD B;  3B0D C;  5JA4 B;  1ESU A;  2WGV A;  3VP4 A;  4E3N A;  5KSC A;  4OVD A;  4ZUX B;  1Z6F A;  4KHA A;  5AQA A;  3A6N B;  4EBP A;  4H9S A;  3REL B;  5CHM A;  1R4V A;  4GDB A;  3C1C D;  5DNN A;  1LLB A;  3X1U C;  1PZR A;  1H3O B;  5B1M C;  4KGC C;  2GDN A;  4S2O A;  4S2M A;  4IBX A;  2J9O A;  3AZK A;  1KDS A;  3AZG A;  1U60 A;  4OQI A;  5B0Z B;  4DRT A;  2HP5 A;  3AZN D;  5L2F A;  3G2Y A;  1M19 A;  3AZK D;  3AZH A;  3ZCZ A;  1XXM A;  3KFU G;  2ZM8 A;  4Y0O A;  3VH6 T;  5B24 A;  3FKV A;  3C1C C;  5B24 D;  1YQS A;  3VH5 A;  5GHY A;  3REH B;  1GHI A;  2EX8 A;  1KX5 A;  4YM6 C;  1BH8 B;  4NZ1 A;  4OLG A;  2WKH A;  3B0D B;  3LY4 A;  3SH7 A;  2F8N A;  1F66 C;  2WAD A;  3MKF A;  3AZN C;  4S2N C;  1FR1 A;  4HGA B;  2YFV A;  1W8Q A;  2ZY2 A;  3AZE B;  5CPJ B;  2QMI A;  4XZQ A;  3X1U B;  2WYX A;  3BFE A;  3GR2 A;  5B1M B;  5CPK A;  1TAF B;  2W8S A;  4XZQ D;  4X55 A;  4DXC A;  3IHA A;  1TEM A;  5GT3 C;  2EX6 A;  5FA7 A;  1ZLA C;  2NQB A;  2Y2H A;  1NYM A;  3IH8 A;  4X23 A;  4DKI A;  3WTP D;  4FH2 A;  2FFF B;  3G32 A;  2NZD C;  3FKE A;  3C1C B;  4KHA B;  1JWV A;  3G30 A;  1HZO A;  1SDN A;  5AV6 A;  2CV5 C;  3AZN B;  1Q2Q A;  3QHY A;  3AZK B;  2QPN A;  4WU9 D;  3C4P A;  3Q1F A;  3P5J B;  2Y2L A;  5BS7 C;  4WNN A;  1YMX A;  1IEM A;  4Z5T C;  2PBY A;  2IO5 B;  3OPR A;  3L2A A;  4DQY B;  2Y2K A;  5B24 B;  2H0T A;  2ZQD A;  5IHV A;  1MPL A;  4OJO A;  1LL9 A;  3HLW A;  4H9O A;  1P3G A;  1YLW A;  4IVK A;  1L0G A;  4UHU A;  1KE0 A;  3HUO A;  2V2F F;  4UUZ A;  3Q7Z A;  3GVB A;  4WM9 A;  1P3G D;  3WAA A;  3O3V A;  4WU9 C;  3HLB A;  2XLN A;  1G6A A;  3ZG0 A;  2V20 A;  4E3K A;  2EX2 A;  4LV1 A;  3VH5 T;  3WAA D;  2YFV B;  2WZX A;  5FQM A;  4XUX A;  4K0X A;  5HL1 A;  4XZQ B;  1P3P A;  4WV4 B;  2Y2G A;  5FAP A;  4EWF A;  2E8I A;  4KZ6 A;  4C6Y A;  3A3E A;  3IWO A;  1SHV A;  5CPI D;  1HQ3 A;  2ZC5 B;  3WTP B;  2C5W B;  3N7W A;  4X53 A;  4IBJ A;  5AV5 A;  4M3K A;  5D3O A;  1YT4 A;  3FDD A;  4BD0 A;  2BG1 A;  5AV8 C;  5AV5 D;  1NRF A;  5M19 A;  1JTD A;  1ONH A;  1XGI A;  2H5S A;  2R9W A;  1RP5 A;  3Q82 A;  3R45 A;  3AZM C;  2Q9M A;  4WU9 B;  5CPI C;  1AOI A;  4R4R A;  3GTC A;  4EV4 A;  3BEB A;  2WUQ A;  3VP0 A;  1PW1 A;  1ZG4 A;  4O7D A;  1J9M A;  5FAQ A;  4KQR A;  4A5R A;  3REJ C;  5F83 A;  1ZG6 A;  4PMA A;  1KX4 C;  4CPK A;  4L0L A;  1NY0 A;  5GLA A;  1JVJ A;  1VQQ A;  3L25 A;  2Y2N A;  4H9O B;  1P3G B;  3O88 A;  2JCH A;  2PYO A;  5GT0 C;  5B31 G;  1P3A C;  3WAA B;  5C3I B;  5E2H A;  5FUG A;  5EVI A;  2XH9 A;  2J8P A;  4J8X A;  3A1I A;  3ZG9 B;  3EPJ A;  2G2W A;  5EVI D;  5BT1 D;  5CPI B;  3HLE A;  1NZO A;  4J8X D;  2X02 A;  4YS3 C;  5I94 A;  3MNN A;  3MGP D;  3HL9 A;  3S22 A;  4Y7P A;  4P6B A;  3AL0 C;  3AGF A;  1YLJ A;  3MNN D;  2A3U A;  1JWP A;  3V9R A;  3MGR A;  1ALQ A;  4X69 A;  5AV5 B;  4X56 A;  3X1V D;  1P3M D;  3RXX A;  3ZG8 B;  3KXB A;  1ES2 A;  3MGR D;  3KUY A;  3KWQ C;  5FQJ A;  1K4E A;  4K0W A;  3LJA C;  3MFD A;  4KQQ A;  3KXB D;  3KUY D;  3AZI A;  2IWB A;  1H8Y A;  1YLZ A;  3MGP C;  4N1X A;  4MBK A;  1P3A B;  3F6T A;  1BLH A;  5FQQ A;  1TDG A;  3AZI D;  5CTM A;  2WKE A;  4OJ5 A;  3IXD A;  4GZB A;  1PZP A;  2ZMA A;  2EX9 A;  4B88 A;  5CP6 A;  4EBN A;  3LEL C;  3X1V C;  1P3M C;  2Y2M A;  5CED A;  5B40 C;  4YS3 B;  4ZAM A;  1XA1 A;  3BLS A;  5CP6 D;  2DQN C;  2XFT A;  1Q2P A;  3NCK A;  5AV9 A;  4H9N A;  5B32 A;  2HIO A;  1DY6 A;  3X1S A;  3M6H A;  1P3F A;  4IBK A;  4ZBE A;  4Z9Q A;  2R9X A;  4UA9 A;  3W98 D;  2ZQC A;  3X1T D;  1XKZ A;  3EQU A;  5EVI B;  5CGX A;  3B6F C;  3G2Z A;  4R3J A;  3REK C;  3MGP B;  5CXW A;  1PWC A;  2EFU A;  3A1K A;  5EPH A;  3A3F A;  5GHZ A;  5AVB A;  4KUD D;  1ES5 A;  3UTB D;  3MNN B;  3AGE A;  4GHL A;  2WK0 A;  5AVB D;  4E3L A;  2XGN A;  4NFT A;  4XUJ C;  1YU2 A;  3C4O A;  3X1V B;  1P3M B;  3W98 C;  1DJC A;  1ESI A;  3V9R B;  3MGR B;  1XPB A;  2X71 A;  4OJL A;  3X1T C;  1QME A;  1GHP A;  2Y91 A;  2ZQ8 A;  4OPQ A;  4K91 A;  3KXB B;  1M1A D;  2L5A A;  2EFX A;  3KUY B;  3AZL C;  3SS4 A;  4YFM A;  3MGS D;  4HBU A;  4IBI A;  2Y59 A;  4KUD C;  3UTB C;  3AZI B;  2ZD8 A;  3Q7V A;  5JRG C;  4LCM A;  3B0C W;  4C3Q A;  3B6G C;  3REI A;  1TVF A;  3REK B;  3BFF A;  3WWX A;  5CP6 B;  5EOE A;  1M6K A;  4JJN A;  4LD9 A;  4N1H A;  2J8Y A;  4J8U D;  3REI D;  1M1A C;  4R4S A;  3MGS C;  1PWD A;  1L0D A;  5EE8 A;  2Y2O A;  2XR0 A;  4JJN D;  4LD9 D;  3SOI A;  3W99 A;  4GDN A;  3VOY A;  4RA7 A;  3E2L A;  4QJG A;  3VP3 A;  4IJE A;  3W98 B;  3NC8 A;  2IWC A;  1P3K D;  3OPH A;  3W99 D;  3X1T B;  3MVD C;  3IF6 A;  2XDM A;  1E25 A;  4NET A;  3REL C;  3V3R A;  4R8P D;  3UE0 A;  4KUD B;  3WKJ A;  3UTB B;  4J8U C;  3L28 A;  5B2I D;  3CG5 A;  1K4F A;  1JFI A;  3N8L A;  2ZQA A;  5FI7 A;  3HLC A;  5TGF A;  4WU8 A;  4S2I A;  4NY2 A;  1MKI A;  5AVB B;  3NY4 A;  3W96 A;  5CRF A;  1K57 A;  1Z2C B;  1FCM A;  4OH0 A;  5A93 A;  3UE1 A;  5B0Z C;  1MWT A;  3BRM A;  4WZ5 A;  4WU8 D;  1P3K C;  1FOF A;  3ZHH A;  5BOH A;  4KQO A;  4J8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...