2FFFB

Open form of a class a transpeptidase domain
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
453
structure length
453
Chain Sequence
b'DYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSRRAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords penicillin-binding protein 1B
molecule tags Membrane protein, transferase
source organism Streptococcus pneumoniae
publication title Structural analysis of an "open" form of PBP1B from Streptococcus pneumoniae.
pubmed doi rcsb
total genus 147
structure length 453
sequence length 453
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2fffB01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2fffB03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2fffB02
3MKFA 3PAEA 3C7UA 4DDSA 2PU4A 3PBQA 1BLPA 2Y2MA 3G35A 1TDGA 3JYIA 2WKHA 1IELA 3BECA 4WM9A 1CI8A 4FH4A 3A3DA 4LCLA 2Y2NA 2FFFB 1DJCA 1BUEA 2HPBA 2Y4AA 3BLMA 4E3NA 4GZBA 1VM1A 2JE5A 1KE0A 1G68A 2WK0A 3LEZA 4OOYA 4R3JA 5CHMA 4UA9A 1XGIA 1OMEA 3BYDA 1SCWA 4DRTA 4E3JA 2GDNA 3MFDA 4OLGA 5HAIA 1RP5A 5AQ9A 4BD1A 2Y59A 4R23A 5DTTA 3MXSA 5FQJA 3CG5A 4RVAA 4S2OA 3WWXA 3B3XA 2RCXA 5F82A 3ZG5A 1WE4A 4QU3A 3HBRA 5EOOA 5TGFA 3GTCA 3W8KA 3NDEA 3D4FA 3FZCA 3IXHA 4EWFA 4R0QA 4BLMA 2XK1A 3TG9A 3TSGA 1E3UD 3Q1FA 4BL3A 4YFMA 1CEFA 1N9BA 1XP4A 2WGIA 1NJ4A 2B5RA 4XXRA 5E2HA 4ZTKA 4H8RA 3NBLA 1CK3A 1YLJA 3CZDA 4RA7A 4X68A 2Y91A 4MBHA 3GR2A 2XFTA 1LHYA 4ZJ1A 1BSGA 2H10A 3S4XA 5KSHA 2Q9NA 3HREA 1FQGA 5JYPA 1ESIA 3QHYA 5AQAA 1ERQA 2EFUA 3RXWA 4HBTA 1L0DA 4CPKA 1RCJA 3ZHHA 3ZG7B 4DE1A 4NETA 3GVBA 3ZVWA 3S22A 3EQUA 3O86A 3P09A 4DXCA 2ZC5B 3OPRA 4U0TA 2H5SA 4LV0A 2Y2OA 2WZZA 3Q07A 5EOEA 4GN2A 3W4QA 2WADA 2J8YA 1YM1A 3AGDA 4KENB 1JWZA 3VP4A 1YMSA 2DNSA 5EVLA 4OPQA 5FA7A 4MLLA 4OP8A 4WZ4A 4ZBEA 5CERA 4OQIA 2Y55A 3UE3A 3Q81A 5CRFA 3BFCA 4OOLA 3DTMA 4P6BA 3P98A 4HBUA 3LY3A 4PM7A 1KE3A 1HVBA 4QD4A 3SS5A 4P0MA 2OLUA 3HLGA 1S0WA 1K57C 4OKPA 2J7VA 1W5DA 4L0LA 3UO9A 3RXXA 4BQMA 1Y54A 1YLYA 3HLDA 1PI5A 1K4EA 3G32A 2ZC3B 2HDSA 3M6BA 4YINA 1SHVA 1K56A 2A49A 3UPNA 1WYBA 2P9VB 3ZG9B 1DJAA 4QHCA 5U47A 1BLCA 3ZFZA 2OSUA 1FSWA 5CXWA 2X71A 2HDQA 4XUXA 2ZQ7A 1YQSA 3IWIA 5AQ7A 3OZHA 1ES3A 5FQIA 3UY6A 4DE0A 5JYOA 2Y2KA 3MZFA 4R4RA 1YT4A 3N6IA 2Y2JA 2XD5A 4GKUA 1KGGA 3WRTA 3ZCZA 3ISGA 1I5QA 2Y2QA 2QPNA 4FSFA 4HESA 2Z2MB 4JXSA 2JBFA 3NIAA 1BLSA 5FATA 4JXGA 4P87A 1K6SA 2P74A 3VOZA 3ZNYA 2V20A 5A90A 3G34A 3Q7VB 2I72A 4Q8IA 3G4PA 3E2LA 4JXVA 5E2FA 4UHUA 3WS0A 2A3UA 4DXBA 1FOFA 3W4PA 1JVJA 2X02A 3VP2A 1XPBA 3ZVTA 4R1GA 4S2LA 4NK3A 2Y2IA 4OP5A 4ZAMA 4B4XA 1MWSA 4WEJA 3QNCA 5EPHA 1Q2QA 5CTNA 1LLBA 3M6HA 1XGJA 1JWPA 3OPPA 4RX2A 3BFGA 3NDGA 4WZ5C 5G18A 1TDLA 5EVIC 4F94A 1BT5A 5CGWA 2VGKA 4KG5A 3VFHA 3PBNA 3GV9A 2ZC6B 4MBFA 4IEDA 2EX8A 1W8YA 2PBYA 3SOIA 4KQOA 4C75A 1XXMA 4DE3A 2CC1A 4OONA 5GHYA 4BJPA 1TEMA 4OQHA 4KG6A 1FCMA 5CEDA 3C4PA 5IHVA 1YLZA 4DDYA 1DJBA 4EQIA 3MZDA 4K0WA 3LY4A 2R9WA 4ZJ2A 5HAQA 1FCNA 3QNBA 5EECA 3M2JA 4KZ5A 3IWOA 3IH8A 1XA7A 1H8ZA 2ZD8A 4KQRA 1IEMA 1HTZA 1K55C 3VFFA 1NZOA 3GRJA 1NY0A 3HL9A 3LCEA 1GA0A 3FV7A 1PI4A 2WKIA 3G31A 2J9OA 5M19A 2EX6A 1KGFA 3MBZA 1IKGA 1NYYA 3ITBA 5FASA 4E3OA 1TVFA 1WYCA 4KZ6A 3PBRA 4UA7A 1NRFA 2P9VA 2C6WB 4QJGA 1FR1A 1RGYA 3PAGA 4EV4A 2Y2PA 1FSYA 3VOYA 3UN7A 1ES4A 3O87A 4KQQA 3NY4A 3WS2A 1ZG4A 2E8IA 1JTDA 1VQQA 4PPRA 1YLPA 1MWRA 1BULA 4GDNA 1SKFA 3OPHA 2HDRA 4JLFA 1MBLA 4X6TA 5TR7A 3SS4A 4Y0OA 3A3FA 4Y0TA 2RL3A 4PMAA 1GCEA 3IF6C 4JBFA 5F83A 1ZC2A 3WS1A 4S2NA 4S2KA 5HFOA 3VSKA 4N1HA 1IYPA 1LI0A 4M3KA 5FI6A 4ZJ3A 4KZ4A 4PM9A 2XH9A 3G2ZA 1YMXA 3VP0A 1PW1A 4B88A 5AQBA 5HL1A 3HUNA 4QB8A 3UDXA 3OPLA 1PWCA 3IT9A 2ZC4B 5A93A 4WELA 5CECA 5CHUA 1EROA 3NC8A 3A3JA 4QY6A 1I2SA 2BLSA 3ZGAB 1FCOA 2ZM2A 3IXGA 4R4SA 4S2PA 3UNWA 3HLEA 4O7DA 1M6KA 2JC7A 4D2OA 2ZJ9A 3Q7VA 4LCMA 1K38A 3HLWA 5KSCA 3HUOA 4PM5A 2R9XA 1XA1A 3I7JA 4JF4A 4OOMA 4BL2A 5CHJA 2DRWA 2V2FF 5A92A 3SH9A 3TOIA 5FAQA 1G6AA 2ZC7A 3PBOA 3SH7A 1LL5A 5DF9A 1L0EA 2ZQ9A 4E6XA 3S1YA 1JWVA 1SDEA 2ZM8A 3AGEA 5GLDA 1KGEA 4MBKA 3ZG0A 3IF6B 4FCFA 4S2JA 1K54C 4E3IA 3NI9A 2XDMA 5GLCA 2EXBA 2Y2LA 1E3UA 3ZNTA 5FQQA 4IVIA 3LO7A 4DE2A 5HW3A 4JPMA 4EBNA 1MY8A 4IVKA 5FDHA 3O3VA 3W4OA 1GHPA 1K54A 5DVAA 4Y0UA 4KZBA 3IQAA 5F1FA 3BEBA 3N8SA 2X01A 4QY5A 4JKTA 3IHAA 3IF5A 1YLTA 3PBSA 4OQGA 4B4ZA 1S6RA 4KG2A 4WYYA 5FQ9A 1GHMA 4OPYA 3O88A 1BTLA 4WBGA 1XKZA 4X56A 3V3RA 2HP6A 4JF6A 1IYQA 1ONHA 5FI2A 2XF3A 3UE0A 3MXRA 4BENA 5DF7A 1IYOA 1Z6FA 2XLNA 4PM8A 1M40A 1J9MA 5KZHA 3A3EA 1EI5A 3UPPA 2G2UA 3C4OA 3IHBA 4KZ3A 2HP9A 1QMFA 1KDWA 2ZQDA 5A91A 4E3MA 4DKIA 4IBXA 3ZG8B 3IF6A 5I94A 2EX2A 4GDBA 3FKVA 3GSGA 3SH8A 3ITAA 4X55A 3E2KA 3A3IA 1MXOA 4WEKA 5FI7A 1O07A 4ZDXA 5FQKA 3RJUA 3FWLA 2FFYA 4X69A 5CGXA 2C5WB 4S2IA 1O7EA 1K25A 1PWDA 2OV5A 3V5MA 3CJMA 4DF6A 5DTKA 4GOGA 1RGZA 2WGVA 1IKIA 4Z9QA 3M2KA 1MWTA 3IWQA 5E43A 5M1AA 4WMCD 2XQZA 5M18A 4X53A 5EUAA 2JCHA 1DY6A 1ESUA 5CEBA 2BG1A 1K55A 1H5XA 1K6RA 4KZ8A 3MKEA 4LV2A 1K56D 2Y2HA 4OH0A 2ZMAA 5EVIB 2WZXA 4E6WA 4C6YA 2Z2LB 5GLAA 3HLFA 2WKEA 1EWZA 3G2YA 4EBLA 2ZQAA 3IXBA 1HD8A 3N7WA 1L0FA 2WAFA 5F1GA 5HARA 3N8LA 3OCNA 4EUZA 1W79A 1U60A 5FQMA 4KZAA 4N9LA 1MWUA 3Q82A 2EX9A 1KE4A 4MEZA 5GHZA 3VSLA 5HX9A 1HZOA 4OVDA 4HEFA 2WUQA 4UAAA 3BLSA 3IH9A 3VMAA 4LV1A 3ZDJA 2IWCA 3UPOA 2XFSA 1CEGA 1QMEA 1PIOA 4XUZA 4E3LA 1ALQA 1L0GA 4CJNA 2EFXA 1C3BA 1XX2A 3EQVA 3C5AA 1GHIA 5HAPA 2ZM0A 4N1XA 1I2WA 4LV3A 4FH2A 3C7VA 3OC2A 3PTEA 1KVMA 4S2NC 3MZEA 5TFQA 2WGWA 2J9PA 4GNUA 3UE1A 4OLDA 5EE8A 1LI9A 2HDUA 1ES5A 5DTSA 2Q9MA 3VP3A 4N9KA 4FD8A 2XD1A 4LENA 4BD0A 3GQZA 4KZ9A 5CTMA 1E25A 3HLCA 4OQ0A 1FR6A 5E2GA 1NYMA 2G2WA 2H0TA 3DWZA 1SDNA 3FKWA 3PBTA 4U0XA 5BOHA 1W8QA 4N92A 5FAOA 1W7FA 4UA6A 4Y7PA 1K4FA 5EVIA 3UDIA 4OPRA 4WZ5A 4PM6A 1AXBA 5GHXA 3SS3A 5J8XA 2EXAA 3N8RA 3BFEA 1ZG6A 1BLHA 2Y2GA 2ZLYA 3UDFA 3HUMA 1KDSA 1H8YA 2ZQCA 2VGJA 5GLBA 3AGFA 2XEPA 3BFFA 5EVID 1E4DA 2WYXA 4C3QA 1PWGA 4ID4A 3VP1A 4GB7A 4K0XA 1LL9A 3CMZA 4JXWA 4WMCA 4RYEA 2WGWB 3BFDA 3DWKA 2XR0A 4R3BA 1ERMA 3BRMA 1YLWA 1ES2A 3BM6A 4U3TA 2PU2A 3N4IA 4GD8A 5E2EA 1KVLA 5KMWA 5D3OA 4K91A 5FSRA 2XGNA 1PW8A 4JF5A 2ZQ8A 3HVFA 4RX3A 2QMIA 3Q7ZA 4KZ7A 3V50A 3V39A 5L2FA 4S2MA 2IWDA 3GMWA 1Q2PA 4GD6A 2DCFA 4IBRA 2H0YA 4MNRA 1ONGA 3V3SA 5CGSA 2UWXA 3FYZA 1ZKJA 1L2SA 3WS5A 1BZAA 5DF8A 3G30A 1JTGA 2HP5A 1NXYA 1CI9A 1NZUA 1IYSA 5FAPA 3DW0A 1PYYA 3WS4A 3NCKA 4E3KA 5GL9A 3OCLA 2V1ZA 4P85A 2IWBA 2QZ6A 1MPLA 3IXDA 3WRZA 1GA9A 1PZOA 3HLBA 4OPZA 4EBPA 4A5RA 1MKIA 1PZPA 2OLVA 2WAEA 1N4OA 1K57A
chains in the Genus database with same CATH superfamily
1DP6A 4R6LA 3C7UA 3MVDA 4GS9A 3WA9A 4IJEA 1CI8A 2ZY3A 2FFFB 3AZIA 3LR0A 4QNLA 3LELC 3B33A 1G68A 1KE0A 4OOYA 4E3JA 1VETB 2GDNA 3MFDA 2BYKA 5B31C 1F1EA 5BT1D 4NYUA 1KX5D 2NQBD 3MXSA 3S7QA 3AN2A 3X1TA 3BY9A 2VV6A 5DJUA 3AZFD 3ZG5A 4DN0A 2F8NG 5EOOA 3D4FA 3FZCA 3IXHA 2XK1A 1E3UD 3HJKA 5TBMA 4XXRA 1P3MC 4IBGA 1P3GC 1CK3A 4YM6C 4AWLC 3CZDA 4X68A 2F8NA 4NE3A 1P3AA 1T1BA 1F66C 3NQUA 3HREA 3AZIC 1FQGA 3NHQA 3UMEA 3C1CA 3AZJB 4NFTA 1RCJA 4BBUA 1S32A 3GVBA 5AVBB 3P09A 4GJ4A 1KX5B 3OPRA 4MN6A 5JRGB 3X1UD 3AZMD 1K0KA 3Q07A 3X1TD 3AZIB 5LBRA 4GN2A 3W4QA 1YM1A 1JWZA 1TS8A 3H9WA 5EVLA 4E44A 5DNMD 3C1CC 4WZ4A 3EPKA 4OQIA 3H7WA 2LB5A 1F66A 2W3FA 3L26A 3C2WA 1P3FD 1M19B 5AVCC 3MQ0A 5KIZA 3VH5W 4HP4A 4QD4A 1P3GA 1P3PB 2FJ7A 5DNNB 4UUZA 1K57C 3UO9A 2O9BA 4BQMA 2G5IC 1ZLAD 3HLDA 3AV1C 5AVBA 3M6BA 4YINA 1TZYB 5DKLA 4YNRA 5CHLB 2FJ7B 5EM1A 1TAFB 1K56A 1EQZA 2P9VB 2B18A 3AN2C 4QHCA 1ZLAA 3AZHB 1V9YA 1P3BA 5CXWA 4WNNB 4PHTA 2HDQA 5AV9D 2JHEA 5AV6A 3W97A 2HGVA 3MGQB 5BPVA 3MZFA 2XD5A 4WNNA 3ZCZA 1I5QA 5JRGA 3LELA 1E8BA 4HESA 3KYQA 2Y79A 2JBFA 5BS7C 5B33D 1BLSA 3H0MC 3FC7A 1M1AD 2PD8A 1K6SA 3UTAC 5A90A 3MVDC 2I72A 4Y2FA 4F3LA 5BNVB 5B24D 3ZYTA 4DXBA 4FTXA 4B9OA 3P01A 3LEQA 3LZ0D 1P3PC 4D60A 4H9NA 1O6IA 4B4XA 4WEJA 2F8NB 3QNCA 3ULFA 4HHDA 3BFGA 4WZ5C 5G18A 1TDLA 4X23A 4PKYA 4F94A 3CPTB 5DJTA 3VFHA 1KX5C 4QLCA 1UR9A 3SOIA 4DE3A 4C75A 4BJPA 4OQHA 4X1LA 1FCMA 2EA9A 3C4PA 3AZJC 4HMEA 5IHVA 4J8UD 4DDYA 3B0CW 4QLCD 2L5AA 2NQBA 3NOTC 3WAAB 3QNBA 4I39A 1SKOB 3IH8A 1H8ZA 2ZD8A 4KQRA 3VFFA 3BW6A 2XA7M 3HL9A 1NY0A 2P7JA 3X1VB 1GA0A 2WKIA 3G31A 5M19A 1BFMA 1ID3A 1J3WA 4E3OA 5FASA 3PBRA 5AY8A 2RVQC 1P3LB 4LRZE 4EV4A 3REHD 1JNUA 2LB9A 1GOIA 3WAAC 1ZG4A 1Y4OA 4J8UC 2E8IA 1JTDA 3EG5B 1MWRA 5B1MD 2HDRA 3X1VA 5TR7A 1S32D 3A3FA 5B0YC 1GCEA 3DTEA 1ZC2A 5BO0B 3B0CT 3UT9C 1PNEA 3TE8A 2IA2A 2G5HC 4M3KA 3TRCA 2HIOA 4MN5A 1P3LA 3KSIA 1YMXA 4EO5B 3KX0X 3K3DA 4Q0JA 3VP0A 4B88A 2Z6DA 4G3WA 3UDXA 3OPLA 1PWCA 3IT9A 2ZC4B 1ID3B 3R7WB 1EROA 3F1OA 5AV8A 2BLSA 1P3OB 3UNWA 1ULYA 3UB9A 4BBVA 5KSCA 3IS2B 3V67A 4WU9B 2R9XA 5HDDA 3NQJB 4BL2A 1Y28A 5CHJA 4Z2IA 3A1KA 2JKTM 5HWTA 1G6AA 3SH7A 5DF9A 2ZM8A 5IU1A 2CV5B 4IBFA 2W1RA 3QP8A 4IBKA 3NI9A 2XDMA 4OJ6A 3A6NB 4NZ3A 3D3OA 3W99B 3LO7A 4IVIA 3MGRD 3O62D 3UT9A 1H3QA 5AV9A 3W4OA 4Y0UA 4HP9A 2BTFP 4XUJD 2YKHA 4J8UA 2X01A 3WAAA 3H82A 2ZY5A 1BTLA 3BY8A 4WBGA 2W3DA 5GT0B 4EEUA 5GXQA 1IYQA 3VE4A 1ONHA 4BENA 5CPID 4Z2LA 3UB7A 5F99A 1IYOA 1EAKA 2XLNA 1MKMA 5HDSA 4XZQD 2G2UA 1KX3B 5CP6C 3IHBA 4KZ3A 3QP5A 3MGPB 1UR8A 3VH5T 1IFQA 3RELB 2ZQDA 4E3MA 4DKIA 4HGAC 4HH3A 3IF6A 5GXQC 2EX2A 4GDBA 4CQHA 3SH8A 4H9SA 3ITAA 3MGPA 2V8CA 3REJD 3NOPC 3REKD 2HUEC 4WEKA 5GT0A 5CPKD 5FQKA 2V8FA 3CUEC 4MDZA 2HF6A 4S2IA 5HSQA 1K25A 3X1SD 3WX7A 3V5MA 2O9AA 2FZ0A 4ZBJC 4GS9B 4GOGA 2GJ3A 2WGVA 2HZ5A 1B6WA 3W97D 2XQZA 4X53A 2JCHA 3NJAA 1NWZA 2RVQD 5CEBA 3T4QA 1K6RA 4FUWA 5F68A 3AZFC 2BYKB 2NUTC 4R70A 4CSRA 3L25A 3WKJC 3PXPA 2ZQAA 3MFXA 5F1GA 2A24A 3S7NA 3N8LA 3OCNA 4EUZA 4YM6D 4N9LA 1ID3C 1E88A 2EX9A 2FH5A 1KE4A 3VSLA 3UTAB 4GLQA 3E4QA 5HPFA 4HEFA 1WA9A 3SW1A 4LV1A 2D01A 2IWCA 3UPOA 1PIOA 5FUGB 5AVFA 2RIQA 5J3WA 1C3BA 4CLCA 4N1XA 1I2WA 4LV3A 4KQDA 3PTEA 2UV0E 5EE8A 2V1AA 2ACGA 3B6FB 5FL3A 3TJZC 3K2NA 1KX4A 4GW9A 4IUKA 5HZHA 3GQZA 5BNXA 3T1XA 4OQ0A 2G2WA 4X23D 1SDNA 4KGCD 5AVCA 3AN2B 4U0XA 3AZLB 1P3FC 3UDIA 4WZ5A 5J8XA 4XZQB 1X0OA 4X25A 1P3AB 3KYZA 2W27A 4IUHA 4R3AA 4R8PD 4C3QA 4ID4A 5AV5A 1DP8A 4WMCA 3DWKA 1YLWA 1ES2A 3BM6A 4J8XA 4UQIS 5KMWA 4K91A 5B0YD 2FJ7D 2XGNA 1P3KB 4JF5A 5BS7A 5L2FA 4YM6B 3V39A 1H0GA 4S2MA 4JGPA 2H28A 3V3SA 2UWXA 3WS5A 5DF8A 5B0ZB 4YM6A 1P3MA 5AV6C 4Q0HA 1H8PA 4O8GA 1M18B 4I3AA 2V1ZA 4P85A 3B6GA 1GA9A 3AFAB 3X1TC 4WU9D 4UQIM 2QJ5A 4GHIB 4EBPA 1PZPA 1K57A 4NY2A 4XZQA 5CPKB 2Y2MA 1BLPA 1L6JA 2PYRA 2F8ND 1P3IB 3FPWA 4EQ1A 4FH4A 4LCLA 5CPJB 4H9QA 1P3GD 5GT0D 2VKSA 4HIAA 4NXBA 4K08A 1VM1A 2JE5A 3L27A 4EETB 1WWIA 3LEZA 1SZVA 2V9AA 4EU0A 1XGIA 3LELB 1OMEA 4NZ1A 3MGPD 2VGLS 5AQ9A 1UWPX 2W1TA 1P3BC 2OAQ1 5J7EA 1M18C 4RVAA 4S2OA 5AY8B 5MC7A 5DNMA 3NDEA 4WU8D 3UTBC 4R0QA 3AZHC 1U35C 2CV5D 3TG9A 3TSGA 3UE6A 3AZGA 1XP4A 1Q9CA 3MNNC 3NBLA 2FJ7C 3C1CD 3LZ1C 5B33C 3KUYA 5B33A 3X1VD 4IBCA 2XFTA 2PAVP 3S4XA 1ZLAB 1N1JA 3QHYA 5IT5A 4G91C 4R8PB 1T1AA 4QLCB 5F5YA 3MGRB 4Z2HA 2M7UA 4NETA 3ZVWA 3REKB 4DMZA 3EQUA 5KDMB 3O86A 4DXCA 2ZC5B 4U0TA 2H5SA 3UTBD 4LV0A 3AN2D 3F1PB 4O0PA 5EOEA 3IS2A 1F66B 2J8YA 1YMSA 2DNSA 3MNND 4HGAB 2A2LA 4MLLA 4ZBEA 4ZRRA 1S32B 2Y55A 3Q81A 3BFCA 4OOLA 3WA9C 1P3AC 4P6BA 1B67A 4R8PC 1VB6A 4YWZA 4XZQC 3C8CA 4UPKA 2J7VA 2OAP1 3G32A 4WZSB 4TX8A 3LI9A 2HDSA 1SHVA 5L8MA 3MJQA 4G3KA 3DTIA 3TU4D 2JKRI 1DJAA 5U47A 3ZFZA 2J3TD 1H3OB 2Y2KA 4R4RA 3N6IA 2EWWA 3VH6T 4KUKA 1KGGA 3WRTA 3ISGA 1EQZB 2PYPA 2Y2QA 2QPNA 4Y17A 3W98C 1OPXA 5FATA 3VOZA 1P3IA 2P74A 3KXBC 3W97B 1IOUA 4Q8IA 4Q0IA 1H0IA 3E2LA 4UHUA 2AVXA 5FEFA 1Z2CB 1JVJA 1M19A 1XPBA 2Y2IA 4OP5A 4ZAMA 5E5AB 3M7PA 2W3EA 3V9RA 3PYPA 2QKPA 1LT0A 3CLOA 3D72A 1YU4A 1S66L 5DNMB 3LIEA 4KG5A 2QWSA 3GV9A 1W8YA 2V0UA 4KQOA 1YU3A 2CC1A 4OONA 1TEMA 4KG6A 5K5BA 3L29A 1YLZA 2O99A 4EQIA 4EERA 3LIAA 5C3IB 2R9WA 4YOFA 3T4OA 5EECA 3M2JA 5B32G 1XA7A 4Z5TB 1IEMA 3MR0A 1K55C 3LZ1B 2DQNC 1AOIB 3GRJA 3AV2A 1OJGA 2EX6A 3OOVA 1BH8A 1TVFA 4IHQA 4RQ9A 3AV2B 2C6WB 3EGDC 3L7HA 1FR1A 4BMWA 1P34D 3PAGA 3WKJA 2Y2PA 1FSYA 3VOYA 3T4KA 1ES4A 3O87A 1ZHHB 5F69A 1BH9B 1VQQA 4PPRA 4QWOA 4GDNA 5B1LB 1SKFA 3F1OB 4X6TA 1GSVA 4Y0OA 3ZQ5A 4S2KA 4N1HA 1LSXA 5FI6A 4AFIA 4KZ4A 3KS8A 3REIA 3A0VA 3HUNA 4L9EA 3KYEA 4ZUXD 4J8WB 3B6GD 1BH8B 3UB5P 4XUJA 5TJJA 5CHUA 1P3PD 3NC8A 2AROB 4FOFA 2ZM2A 5HWVA 1M6KA 2ZJ9A 3Q7VA 1K38A 5JA4A 4LFUA 1CF0A 2J8PA 3I7JA 4YS3C 4OOMA 2DRWA 4EO5C 4OUIA 3LR4A 3DTKA 3SZTA 3PBOA 3AZID 4Y3IA 4E6XA 3A6NA 3AGEA 1KGEA 5B1MB 4MBKA 1YKDA 2Y8HA 1K54C 4JJND 4E3IA 2XROA 2HUEB 1E3UA 2Y2LA 4NXGA 4EBNA 2PRFA 5FDHA 5HWWA 3AZJD 1P9WA 5CP6D 1K54A 1OTAA 4MMNA 3RELC 4KZBA 3IQAA 5F1FA 4QPRA 4HMDA 3IF5A 4OQGA 4J8VB 4KG2A 4JGQA 4WYYA 1GHMA 4YS3D 2NZDA 3O88A 4OPYA 1XKZA 4BWIA 4Z2MH 2EWVA 3V3RA 3MGSB 2HP6A 1TZYC 4NZ4A 2E8JA 3UE0A 4J8VA 3LJAB 1T18A 1HLUP 1Z6FA 1U35D 3AYWA 3W99D 1H8MA 2NZDD 2B95A 1J9MA 2K31A 5TBMB 5KZHA 1E6PA 1VHMA 4XUJC 1EI5A 4IBIA 3NECA 2A24B 3MGSC 1KX3C 5A91A 1P3MD 3ZG8B 4ZUXC 5I94A 3RTYA 1XFNA 4Z2KA 2O9CA 1G6OA 4ZDXA 3FWLA 2M7VA 4LD9C 2BYMA 1ID3D 3CPTA 1TS0A 4DF6A 2HIOC 2F8NH 1RGZA 5CPIA 1IKIA 4Z9QA 5AJGA 3M2KA 1MWTA 5EUAA 2D02A 3WA9D 3IX8A 3KUYD 4LV2A 5EVIB 2WZXA 4C6YA 3AZFB 5B1MC 3NQJA 3IXBA 5AVCD 4KGCA 5EVEA 4CAYB 5AY8C 2XRNA 1P34A 2PR6A 4KZAA 1MWUA 3REKA 4MEZA 5GHZA 3KXBB 1HZOA 4OVDA 3WTPE 2WUQA 2ZL1A 4UAAA 3R4KA 2F8NK 3W2ZA 5FEGA 4XUZA 3KWQB 3T50A 1ALQA 4CJNA 2EFXA 3EQVA 1GHIA 2ZM0A 2AROD 4S2NC 2NUPC 3OC2A 3LZ0A 3NULA 5DNNC 3WD3A 3A0RA 2HDUA 1VETA 2Q9MA 5B40C 4N9KA 2XD1A 4LENA 1M19C 3IX3A 5G49B 3B6FA 5FUGA 5E2GA 2H0TA 3KWQA 3X1TB 3AFAC 2LY8A 3FKWA 5BOHA 4N92A 1D1JA 4H9PA 1W7FA 5EVIA 1K4FA 4WU8A 4OPRA 4LLOB 3SS3A 1T1CA 2EXAA 3BFEA 2JKRM 3T4LA 3F1NB 1KDSA 2ZQCA 3VOLA 3PHYA 3REJC 3AZND 1P34B 5GLBA 2XEPA 1FIKA 1E4DA 4WU9A 4MN7A 4MCWA 5EM0A 2WGWB 3MGRA 3UT9D 3WA9B 1ERMA 5B0ZA 3D9YA 1AOIC 1YUEA 5B24B 1PZRA 2PU2A 3N4IA 5AV5B 1KVLA 2IO5B 2ZM5A 1AIWA 3LZ1D 1PW8A 2W0NA 3HVFA 4RX3A 4AWLB 3Q7ZA 3V50A 3OLOA 3O62A 5JRGC 1ODVA 1ONGA 3UB8A 3FG8A 4Z2MG 3HJIA 3FYZA 3X1UA 3AZMA 1E15A 1GXDA 1BZAA 3G30A 5G49A 5FAPA 3DW0A 3VE3A 5E5AC 1W63M 2L1MA 1CXWA 1P3MB 1MPLA 4XT2A 5CPJA 3WRZA 1GSXA 2O0YA 4BBTA 3AV1A 1F9IA 3AYWD 4A5RA 1MKIA 2OLVA 2WAEA 4NKPA 4IJFA 1ED7A 1P9RA 3MKFA 4DDSA 2PU4A 4H9RA 3G35A 1TDGA 3JYIA 2WKHA 3QP6A 3AZEA 1D06A 1IELA 3LJAD 3BECA 4WM9A 3A3DA 1DJCA 2Y4AA 5CPKA 4E3NA 4H9RB 2VV7A 2WK0A 5CHMA 4GH9A 4CAYA 3KUYC 1NLZA 1YU2A 3AZGC 4R23A 5DTTA 3UTBA 5AVCB 2YFWA 1M1AA 5CPJC 4HY8A 2J3TC 2RCXA 5AY8D 5F82A 5GSUA 1WE4A 4QU3A 3G6OA 3HBRA 5TGFA 1M18A 3GTCA 3W8KA 4JJNB 4BLMA 1E6RA 5B2JC 4HJ3A 4BL3A 4YFMA 1CEFA 1N9BA 1VEUA 2WGIA 2B5RA 5E2HA 4ZTKA 3MS6A 1YLJA 5GXQD 4RA7A 2Y91A 3WD2A 3X1UC 3AZMC 4LGWA 1AOID 3GR2A 1LHYA 1GSWA 1BSGA 2H10A 3W99A 2Q9NA 3LUQA 4MB5A 2YFWB 2L0WA 5JYPA 1ESIA 3MSHA 2JN7A 4HI4A 5AQAA 2PHYA 4DJ2A 2EFUA 3RXWA 1XJ2A 4H9PB 4HBTA 1L0DA 3ZHHA 4DE1A 3REID 1OTBA 5B0ZC 4Z66A 3WTPA 4KHAB 3MGRC 5C5KA 2F2AC 1YSPA 2IO5C 5AV6D 3RH8B 2Y2OA 2WZZA 3TU4C 3AFAD 3MNNB 2WADA 3LGOA 5G4ZA 3AGDA 1F2KA 4OPQA 4CLCE 4OP8A 1YU1A 3UE3A 1TS7A 5CRFA 3DTMA 2OWHA 2ZBBA 3P98A 4HBUA 3LY3A 4G91B 3NQUB 3B0BA 1T19A 4JGOA 2VZWA 1KE3A 1HVBA 1U35B 4PM7A 4P0MA 2OLUA 3HLGA 3AV2D 1W1YA 4L0LA 3B6GB 1Y54A 1YLYA 2HJ9C 3MGSD 1PFLA 3BQ8A 2ZC3B 4IBDA 5DNNA 3MQOA 1WYBA 1M1AC 3VH6A 4Z5TD 1YQSA 1HQ3C 3IWIA 2ZL1B 5AQ7A 1EQZD 1ES3A 3C1BB 4DE0A 1YT4A 2Y2JA 2INWA 3T12B 4FSFA 5CPKC 2D49A 2Z2MB 3R45B 3KUYB 3LI8A 4WU8C 1W63Q 1P3FA 3U2AA 4KGCC 1ZTUA 3KWQC 2V20A 3Q7VB 1BYWA 3G4PA 4JXVA 5E2FA 3WS0A 1FOFA 3W4PA 3AZKC 2AROA 4S2LA 4NK3A 2YFVB 1OGGA 5EPHA 1YU0A 4WN5A 1Q2QA 3M6HA 1XGJA 3EOIA 1TF1A 1P3KC 1XFQA 5GT3D 4L9GA 3MVDD 3LIFA 1BH9A 4J8WC 1W1TA 2VGKA 5HPIA 5B1LA 3PBNA 4IBEA 2VV8A 4MBFA 4IEDA 2EX8A 5B32A 2PBYA 3REKC 3C1BA 1EW0A 1P34C 5BNVA 4R38A 2IOUA 4LD9D 5CEDA 2NZDB 2PT7A 1KX3A 5B2JD 5HAQA 1FCNA 3F6TA 3IWOA 4KUDB 4HJ6A 4B93A 1NZOA 4UEYA 5HDCA 3LCEA 3S7PA 2W1TB 1PI4A 2J9OA 1KGFA 1IKGA 1OTDA 3R7WA 4J8VC 2VEAA 3K3CA 3LR3A 4P6ZS 3KFUG 2MJ6A 2P9VA 5CP6B 3AZNC 1RGYA 1HQ3D 3CUEA 1P3BB 2VK3A 5GT0C 5C3IC 3C38A 1YLPA 2W8SA 4DRAA 3BJNA 4H9SC 3MMHA 3OPHA 4JLFA 1MBLA 3SS4A 4PMAA 4ZUXA 4JBFA 4NE5A 4X23B 3WS1A 3LR5A 4S2NA 2P08A 5HFOA 5B31D 3VSKA 5EFWA 1CJFA 4PM9A 5CP6A 3G2ZA 3TW8A 5AQBA 2XA7S 5A93A 4WELA 1I2SA 1FCOA 3IXGA 5F99C 3HLEA 4YS3A 2JC7A 5E5AD 4D2OA 1YPRA 5BO0A 2BYMB 3HUOA 4DJ3A 1XA1A 4H6JA 4JJNA 5A92A 3SH9A 3KSYA 3TOIA 1F66D 5FAQA 1YSQA 2ZC7A 1LL5A 1A7WA 1CQAA 1L0EA 2ZQ9A 3VV4A 3EPHA 3S1YA 1JWVA 2PDRA 3CAXA 1SDEA 5F99B 5GLDA 1Z09A 5B2IC 3ZG0A 3WKJB 4LRYC 4S2JA 2HIOB 2YKFA 5GLCA 2EXBA 1W1VA 3W98B 5FQQA 3O62B 3KO6A 4DE2A 3HONA 5HW3A 1MY8A 3A6ND 1GHPA 1DP9A 3JVUA 3N8SA 4QY5A 5B0YB 4JKTA 4J8VD 3IHAA 1H0MA 3LELD 4B4ZA 4Z5TA 1SKOA 3UMDA 4DRBA 4NYYA 3GECA 4H9OA 5CPJD 3IBJA 4JF6A 1STZA 5FI2A 3MXRA 3AV1B 5DF7A 4EW7A 1KX4B 4KUDC 4I38A 1OT9A 4PM8A 1M40A 2ZMFA 2QYBA 3BWLA 3A3EA 5B32D 3UPPA 5B2IA 1S4RA 4WL9A 3C4OA 1P3LC 1QMFA 1KDWA 5I5LA 1S1YA 1UGUA 3WD1A 3X1VC 3E2KA 2Q0OA 2NZDC 1MXOA 3EWKA 4Z5TC 5B0ZD 1O07A 3CHWP 3RJUA 3REHB 1S4SA 2FFYA 5B2IB 5CPIB 2C5WB 1O7EA 2W3GA 1YAXA 4JGRA 3CJMA 5DTKA 3S7OA 4WV4B 3DBAA 3IWQA 5HD5A 2WKRA 5M1AA 4WMCD 4M6BA 5M18A 3W96D 3AZED 2BG1A 3L28A 1K55A 1H5XA 1M18D 2Y2HA 1KOUA 2AROC 2ZMAA 4WU8B 4XT2B 5GLAA 5B2JB 3HLFA 4PKYG 2CV5C 1EWZA 4JJNC 3G2YA 1NRJA 3KXBA 3N7WA 2HIOD 1L0FA 2WAFA 5BNXB 4HJ4A 3W98A 4G3VA 1P3KD 3AZLD 3WTPB 4Z66B 4KGCB 3AZEB 3FKEA 5HX9A 1H3OA 3IH9A 3ZDJA 3MVDB 1CEGA 1QMEA 1HQ3A 3W96C 4E3LA 4X23C 3REHA 1UWNX 3X1SB 1L0GA 3PR6A 5HAPA 3C7VA 3MZEA 2VQRA 4GNUA 3KSHA 1ES5A 1MZUA 3VP3A 1P3PA 1FILA 4BD0A 4KZ9A 3H0RC 3HLCA 4ETXA 4HQAA 3PBTA 3UTAD 4J8WA 3AZNA 4R8PA 4CSRB 1KX3D 2M1CA 4Y7PA 5AV8D 2VLGA 1KU5A 3N8RA 1P3KA 2L4RA 2Y2GA 3AV2C 2ZLYA 3UDFA 1H8YA 2VGJA 5GT3C 1PWGA 1QO6A 3VP1A 4GB7A 4K0XA 3B0DB 3BFDA 4R3BA 1WWSA 3A1IA 3A0SA 4U3TA 5E2EA 4GD8A 3WD4A 5FSRA 3X1SA 2DMWA 5AVBC 2PBDP 2QMIA 4KZ7A 2IWDA 4KUDD 4NE6A 4J8XB 1Q2PA 3GMWA 4GD6A 2DCFA 3W99C 4IBRA 4MNRA 5CGSA 2JKGA 4DQYB 1ZKJA 4OJOA 3W98D 1JTGA 3LZ1A 1NXYA 2G7UA 1CI9A 3JPUA 3MNNA 1PYYA 3WS4A 5AV8B 5F99D 3EGXC 3NCKA 5DKKA 1U35A 2JKFA 4KHAA 3MXQA 5DNMC 3LIDA 5DFYA 2RTSA 5FDSA 2IWBA 4ARZB 3IXDA 5HD3A 1PZOA 5JRGD 1JFIB 3HLBA 3LJAA 2BASA 4OPZA 4L9FA 2PYOC 1N4OA 4I5SA 1OJ5A 5AVBD 3PAEA 5B2ID 2CMNA 3PBQA 1KX4D 2K2NA 1P3IC 3T1SA 3AV1D 2JKTI 2Y2NA 3F1PA 3FDDA 1BUEA 2HPBA 4CLCB 3BLMA 4UUZB 4GZBA 4R3JA 4UA9A 5B31B 3BYDA 4DRTA 1SCWA 3KS4A 5L09A 4OLGA 1M1AB 1RP5A 5HAIA 4BD1A 2Y59A 4NXFA 4Z66C 3WTPC 3AZHA 1JFIA 5FQJA 3CG5A 3UB6A 3R45A 3WWXA 1W2EA 3B3XA 4MB3A 3B6GC 1HQ3B 1VEUB 4II7A 4EWFA 3WKJD 5CX7A 4J8XD 4F3LB 3Q1FA 1F5MA 3T4TA 1NJ4A 1N9LA 4H8RA 2VA0A 3H0LC 4MBHA 3C1CB 1DRMA 4ZJ1A 5KSHA 1OTEA 1TD5A 5F6AA 1ERQA 2ZOHA 4ZBJB 1A0KA 1S1ZA 2WKQA 4CPKA 3ZG7B 1P3AD 4NXEA 3TU4A 4HOIA 4LD9B 4X1MA 3S22A 3REJB 1OTIA 1NLYA 1G5UA 5AV5C 3DAVA 2ZOIA 5G4YA 3KSGA 1XJ4A 3E98A 1R4VA 3REJA 4KENB 3VP4A 5FA7A 3X1UB 3AZMB 2K7SA 5CERA 5GT3B 4CLCD 1P3GB 4ARZA 5B32B 1P3ID 3OBFA 4MB4A 3SS5A 1PRQA 1S0WA 4OKPA 1W5DA 2PYOA 3MQLA 4LPZA 3RXXA 1KX4C 1PI5A 1K4EA 5B2JA 3LJAC 3V9RB 2A49A 5GSUC 4I3JA 3UPNA 3ZG9B 5AV5D 2PR5A 4HMCA 1MC0A 1BLCA 4Z66D 3WTPD 5E5AA 2OSUA 1FSWA 2X71A 4HH2A 4XUXA 2ZQ7A 3E0YA 3OZHA 5FQIA 3UY6A 5JYOA 1N1JB 4H9OB 4OJ5A 4HNBA 4GKUA 4IJGA 4G92C 1E6NA 3O62C 2B02A 4JXSA 2NQBB 3NIAA 2GX5A 3X1SC 4JXGA 4P87A 2ZY2A 3AZEC 5L07A 3ZNYA 3W96B 5B1MA 3G34A 3H7WB 2A3UA 2PYOD 1TZYD 2X02A 3VP2A 3ZVTA 4R1GA 4WU9C 3LICA 5GT3A 2I9VA 1MWSA 2V1BA 5JA4B 3LYXA 2OOLA 3EEAA 5CTNA 4M4XA 1LLBA 4E45A 3VH6W 1JWPA 3OPPA 4RX2A 4WUJA 1P3OA 3NDGA 3KWQD 4LRXC 5EVIC 3CITA 1BT5A 3T4JA 5CGWA 2Z6CA 5DFXA 2QJ7A 4LD9A 2DF4C 3B0DC 2ZC6B 2HV1A 1XXMA 3MGQA 3P5JB 4Z1WA 5B40A 3MGPC 3T1RA 5GHYA 5B24C 3L2AA 3QP1A 3B6FD 2ZY4A 4I3IA 2KLIA 3LZ0C 1DJBA 3REIB 3MZDA 1P0ZA 3KSFA 5J4EA 4J8XC 4K0WA 3LY4A 4ME4A 1AOIA 4ZJ2A 3C1BD 4KZ5A 3REHC 3W96A 1L3LA 1HTZA 3CWFA 3MF0A 3EPJA 3BQAA 5GXQB 3FV7A 3LFVA 5B31G 3MBZA 1NYYA 2YFVA 1S67L 3ITBA 4XUJB 2KOIA 1WYCA 4KZ6A 4UA7A 1NRFA 3E4PA 3AFAA 3IP4C 4QJGA 3VH5A 5B40B 2CV5A 3B6FC 3UN7A 4KQQA 3NY4A 3WS2A 3AZLC 5AV9B 1BULA 4Y0TA 1G28A 1HTAA 4IBBA 4P6ZM 2RL3A 3IF6C 5F83A 2JSSA 4H9QB 4CLCC 4E04A 1IYPA 1LI0A 4ZJ3A 3QP4A 2XH9A 1N9NA 1PW1A 5HL1A 4QB8A 1GPFA 2J80A 3A6NC 5DNND 3B42A 5CECA 1LSVA 3WD0A 3A3JA 4QY6A 1P3OD 2V5OA 3ZGAB 4R4SA 4S2PA 4O7DA 4H6JB 1M19D 4LCMA 3HLWA 3C30A 4PM5A 5L10A 3AL0C 4YS3B 4JF4A 4H9NB 3RELD 2V2FF 1LSWA 2ZMVA 4PAUA 3FPVA 4EUVA 5AV8C 3MGSA 3T4SA 4Y5FA 1KS0A 5AV6B 3AZFA 1XJ6A 2GZAA 4LG2A 2VGLM 3IF6B 4FCFA 1ACFA 1J7MA 3ZNTA 5AV9C 3AYWC 4KUDA 4GHLA 4JPMA 4IVKA 3HSHA 5CPIC 4WJ3C 3O3VA 3MGQD 1TZYA 1E6ZA 1P3LD 3RFBA 3P7NA 5DVAA 1TAFA 1XJ3A 4EESA 4ESPA 3BEBA 4NEED 1YLTA 3PBSA 1S6RA 5FQ9A 3UT9B 4X56A 3EEHA 4Z2GA 2KX6A 2XF3A 3WAAD 4OJLA 4GHIA 2HJEA 3AZNB 2J3WA 4J8UB 1P3FB 3NOUC 4ZUXB 4J8WD 4KUOA 2HP9A 5HL6A 2VJWA 2KDKA 2P04A 3AZJA 4IBXA 1LL8A 3FKVA 5B1LD 3GSGA 4X55A 3AZLA 1PDCA 3A3IA 3IX4A 5FI7A 1KX5A 4X69A 5CGXA 3GDIA 3ICYA 1PWDA 2OV5A 4NZ5A 4EEPA 3REIC 2QHKA 3RELA 3AYWB 1W1PA 1OT6A 1P97A 3LZ0B 1D7EA 2VX8A 5E43A 3AZGD 1T3UA 1DY6A 1ESUA 1F98A 5B33B 4KZ8A 3MKEA 1K56D 4ETZA 4OH0A 4E6WA 2NQBC 2Z2LB 3N3FA 1P3BD 2WKEA 4EBLA 4G92B 1HD8A 3UTAA 3E4OA 5HARA 4WLAA 1W79A 5B24A 1U60A 5FQMA 3H82B 3MGQC 3Q82A 3AZHD 5A8BA 3MQQA 3AZGB 3BLSA 3EPLA 3VMAA 2XFSA 3W97C 3F1NA 5GSUB 4WF0A 1P3OC 3HCYA 1XX2A 4Y13A 3C5AA 4GHAA 5EV0A 3L9KA 3O5YA 4FH2A 1EQZC 1KVMA 5B0YA 5TFQA 2WGWA 2J9PA 3UE1A 4OLDA 1LI9A 5DTSA 3LIBA 3C1BC 4FD8A 5B32C 2PYOB 5CTMA 2OWJA 1E25A 1FR6A 2FN2A 1NYMA 1V9ZA 3JVVA 5B1LC 3DWZA 3KXBD 1W8QA 5AVEA 5IS1A 5FAOA 4UA6A 1AWIA 4PM6A 1AXBA 5GHXA 3IBRA 1ZG6A 1BLHA 3AZKD 5BT1C 3HUMA 2PD7A 1CK7A 2GNXA 5B40D 3AGFA 3BFFA 4NG2A 4OJPA 5EVID 2WYXA 2CWEA 5GSUD 1LL9A 3CMZA 4JXWA 3AZKA 4RYEA 2XR0A 3CI6A 3BRMA 1ZLAC 4GCZA 3TU4B 1S32C 5D3OA 2V0WA 2ZQ8A 2H0YA 4QLCC 4Y15A 4Z2JA 4EXOA 1OGBA 1L2SA 1TS6A 2HP5A 3B47A 1NZUA 1IYSA 3AZKB 3QP2A 2W3HA 1N9OA 4E3KA 5KDMA 3OCLA 5GL9A 2QZ6A 3U4LP 3T1QB 2R78A 3UTBB 4O01A 4IBJA 2XSSA 5B31A 2WKPA
chains in the Genus database with same CATH topology
3C7UA 3MVDA 3WA9A 4IJEA 1CI8A 2ZY3A 2FFFB 3AZIA 4QNLA 3LELC 1G68A 1KE0A 4OOYA 4E3JA 2GDNA 3MFDA 2BYKA 5B31C 1F1EA 5BT1D 4NYUA 1KX5D 2NQBD 3MXSA 3AN2A 3X1TA 3ZG5A 3AZFD 2F8NG 5EOOA 3D4FA 3FZCA 3IXHA 2XK1A 1E3UD 4XXRA 1P3MC 4IBGA 1P3GC 1CK3A 4YM6C 4AWLC 3CZDA 4X68A 2F8NA 4NE3A 1P3AA 1F66C 3NQUA 3HREA 3AZIC 1FQGA 3C1CA 3AZJB 4NFTA 1RCJA 1S32A 3GVBA 5AVBB 3P09A 1KX5B 3OPRA 5JRGB 3X1UD 3AZMD 3Q07A 3X1TD 3AZIB 4GN2A 3W4QA 1YM1A 1JWZA 5EVLA 4E44A 5DNMD 3C1CC 4WZ4A 3EPKA 4OQIA 1F66A 3L26A 1P3FD 1M19B 5AVCC 3VH5W 4QD4A 1P3GA 1P3PB 2FJ7A 5DNNB 4UUZA 1K57C 3UO9A 4BQMA 2G5IC 1ZLAD 3HLDA 3AV1C 5AVBA 3M6BA 4YINA 1TZYB 5CHLB 2FJ7B 1TAFB 1K56A 1EQZA 2P9VB 3AN2C 4QHCA 1ZLAA 3AZHB 1P3BA 5CXWA 4WNNB 2HDQA 5AV9D 5AV6A 3W97A 3MGQB 5BPVA 3MZFA 2XD5A 4WNNA 3ZCZA 1I5QA 5JRGA 3LELA 4HESA 2JBFA 5BS7C 5B33D 1BLSA 3H0MC 1M1AD 1K6SA 3UTAC 5A90A 3MVDC 2I72A 5BNVB 5B24D 4DXBA 3LZ0D 1P3PC 4H9NA 4B4XA 4WEJA 2F8NB 3QNCA 3BFGA 4WZ5C 5G18A 1TDLA 4X23A 4F94A 3VFHA 1KX5C 4QLCA 3SOIA 4DE3A 4C75A 4BJPA 4OQHA 1FCMA 3C4PA 3AZJC 5IHVA 4J8UD 4DDYA 3B0CW 4QLCD 2L5AA 2NQBA 3WAAB 3QNBA 3IH8A 1H8ZA 2ZD8A 4KQRA 3VFFA 3HL9A 1NY0A 3X1VB 1GA0A 2WKIA 3G31A 5M19A 1BFMA 1ID3A 4E3OA 5FASA 3PBRA 5AY8A 2RVQC 1P3LB 4EV4A 3REHD 3WAAC 1ZG4A 2E8IA 4J8UC 1JTDA 3EG5B 1MWRA 5B1MD 2HDRA 3X1VA 5TR7A 1S32D 3A3FA 5B0YC 1GCEA 1ZC2A 5BO0B 3B0CT 3UT9C 2G5HC 4M3KA 2HIOA 1P3LA 1YMXA 4EO5B 3VP0A 4B88A 3UDXA 3OPLA 1PWCA 3IT9A 2ZC4B 1ID3B 1EROA 5AV8A 2BLSA 1P3OB 3UNWA 1ULYA 5KSCA 4WU9B 2R9XA 3NQJB 4BL2A 5CHJA 3A1KA 1G6AA 3SH7A 5DF9A 2ZM8A 2CV5B 4IBFA 4IBKA 3NI9A 2XDMA 4OJ6A 3A6NB 4NZ3A 4IVIA 3W99B 3LO7A 3MGRD 3O62D 3UT9A 5AV9A 3W4OA 4Y0UA 4XUJD 4J8UA 2X01A 3WAAA 2ZY5A 1BTLA 4WBGA 5GT0B 5GXQA 1IYQA 1ONHA 4BENA 5CPID 5F99A 1IYOA 2XLNA 4XZQD 2G2UA 1KX3B 5CP6C 3IHBA 4KZ3A 3MGPB 3VH5T 3RELB 2ZQDA 4E3MA 4DKIA 4HGAC 3IF6A 5GXQC 2EX2A 4GDBA 3SH8A 4H9SA 3ITAA 3MGPA 3REJD 3REKD 2HUEC 4WEKA 5GT0A 5CPKD 5FQKA 4S2IA 1K25A 3X1SD 3WX7A 3V5MA 4ZBJC 4GOGA 2WGVA 1B6WA 3W97D 2XQZA 4X53A 2JCHA 2RVQD 5CEBA 1K6RA 3AZFC 2BYKB 4CSRA 3L25A 3WKJC 2ZQAA 5F1GA 4EUZA 3N8LA 3OCNA 4YM6D 4N9LA 1ID3C 2EX9A 1KE4A 3VSLA 3UTAB 4HEFA 4LV1A 2IWCA 3UPOA 1PIOA 5FUGB 2RIQA 1C3BA 4N1XA 1I2WA 4LV3A 3PTEA 5EE8A 3B6FB 1KX4A 3GQZA 5BNXA 4OQ0A 2G2WA 4X23D 1SDNA 4KGCD 5AVCA 3AN2B 4U0XA 3AZLB 1P3FC 3UDIA 4WZ5A 5J8XA 4XZQB 1P3AB 4R8PD 4C3QA 4ID4A 5AV5A 4WMCA 3DWKA 1YLWA 1ES2A 3BM6A 4J8XA 5KMWA 4K91A 5B0YD 2FJ7D 2XGNA 1P3KB 4JF5A 5BS7A 5L2FA 4YM6B 3V39A 4S2MA 3V3SA 2UWXA 3WS5A 5DF8A 5B0ZB 4YM6A 1P3MA 5AV6C 1M18B 2V1ZA 4P85A 3B6GA 1GA9A 3AFAB 3X1TC 4WU9D 4EBPA 1PZPA 1K57A 4NY2A 4XZQA 5CPKB 2Y2MA 1BLPA 2F8ND 1P3IB 4FH4A 4LCLA 5CPJB 4H9QA 1P3GD 5GT0D 1VM1A 2JE5A 3L27A 1WWIA 3LEZA 1XGIA 3LELB 1OMEA 4NZ1A 3MGPD 5AQ9A 1P3BC 1M18C 4RVAA 4S2OA 5AY8B 5DNMA 3NDEA 4WU8D 3UTBC 4R0QA 3AZHC 1U35C 2CV5D 3TG9A 3TSGA 3AZGA 1XP4A 1Q9CA 3MNNC 3NBLA 2FJ7C 3C1CD 3LZ1C 5B33C 3KUYA 5B33A 3X1VD 4IBCA 2XFTA 3S4XA 1ZLAB 1N1JA 3QHYA 4G91C 4R8PB 4QLCB 3MGRB 4NETA 3ZVWA 3REKB 3EQUA 5KDMB 3O86A 4DXCA 2ZC5B 4U0TA 2H5SA 3UTBD 4LV0A 3AN2D 5EOEA 1F66B 2J8YA 1YMSA 2DNSA 3MNND 4HGAB 4MLLA 4ZBEA 1S32B 2Y55A 3Q81A 3BFCA 4OOLA 3WA9C 1P3AC 4P6BA 1B67A 4R8PC 4XZQC 4UPKA 2J7VA 3G32A 4WZSB 2HDSA 1SHVA 3TU4D 1DJAA 5U47A 3ZFZA 1H3OB 2Y2KA 4R4RA 3N6IA 3VH6T 1KGGA 3WRTA 3ISGA 1EQZB 2Y2QA 2QPNA 3W98C 5FATA 3VOZA 1P3IA 2P74A 3KXBC 3W97B 4Q8IA 3E2LA 4UHUA 1Z2CB 1JVJA 1M19A 1XPBA 2Y2IA 4OP5A 4ZAMA 5E5AB 3V9RA 1YU4A 5DNMB 4KG5A 3GV9A 1W8YA 4KQOA 1YU3A 2CC1A 4OONA 1TEMA 4KG6A 3L29A 1YLZA 4EQIA 5C3IB 2R9WA 5EECA 3M2JA 5B32G 1XA7A 4Z5TB 1IEMA 1K55C 3LZ1B 2DQNC 1AOIB 3GRJA 3AV2A 2EX6A 1BH8A 1TVFA 3AV2B 2C6WB 1FR1A 1P34D 3PAGA 3WKJA 2Y2PA 1FSYA 3VOYA 1ES4A 3O87A 1BH9B 1VQQA 4PPRA 4GDNA 5B1LB 1SKFA 4X6TA 4Y0OA 4S2KA 4N1HA 5FI6A 4KZ4A 3KS8A 3REIA 3HUNA 4ZUXD 4J8WB 3B6GD 1BH8B 4XUJA 5CHUA 1P3PD 3NC8A 2AROB 2ZM2A 1M6KA 2ZJ9A 3Q7VA 1K38A 5JA4A 2J8PA 3I7JA 4YS3C 4OOMA 2DRWA 4EO5C 4OUIA 3PBOA 3AZID 4E6XA 3A6NA 3AGEA 1KGEA 5B1MB 4MBKA 1K54C 4JJND 4E3IA 2HUEB 2Y2LA 1E3UA 4EBNA 5FDHA 3AZJD 5CP6D 1K54A 3RELC 4KZBA 3IQAA 5F1FA 3IF5A 4OQGA 4J8VB 4KG2A 4WYYA 1GHMA 4YS3D 2NZDA 3O88A 4OPYA 1XKZA 4Z2MH 3V3RA 3MGSB 2HP6A 1TZYC 4NZ4A 3UE0A 4J8VA 3LJAB 1Z6FA 1U35D 3AYWA 3W99D 2NZDD 1J9MA 5KZHA 4XUJC 1EI5A 4IBIA 3MGSC 1KX3C 5A91A 1P3MD 3ZG8B 4ZUXC 5I94A 4ZDXA 3FWLA 4LD9C 2BYMA 1ID3D 4DF6A 2HIOC 2F8NH 1RGZA 5CPIA 1IKIA 4Z9QA 3M2KA 1MWTA 5EUAA 3WA9D 3KUYD 4LV2A 5EVIB 2WZXA 4C6YA 3AZFB 5B1MC 3NQJA 3IXBA 5AVCD 4KGCA 4CAYB 5AY8C 1P34A 4KZAA 1MWUA 3REKA 4MEZA 5GHZA 3KXBB 1HZOA 4OVDA 3WTPE 2WUQA 4UAAA 2F8NK 4XUZA 3KWQB 1ALQA 4CJNA 2EFXA 3EQVA 1GHIA 2ZM0A 2AROD 4S2NC 3OC2A 3LZ0A 5DNNC 2HDUA 2Q9MA 5B40C 4N9KA 2XD1A 4LENA 1M19C 5G49B 3B6FA 5FUGA 5E2GA 2H0TA 3FKWA 3X1TB 3AFAC 2LY8A 3KWQA 5BOHA 4N92A 4H9PA 1W7FA 5EVIA 1K4FA 4WU8A 4OPRA 3SS3A 2EXAA 3BFEA 1KDSA 2ZQCA 3REJC 3AZND 1P34B 5GLBA 2XEPA 1E4DA 4WU9A 2WGWB 3MGRA 3UT9D 3WA9B 1ERMA 5B0ZA 1AOIC 1YUEA 5B24B 1PZRA 2PU2A 3N4IA 5AV5B 1KVLA 2IO5B 2ZM5A 3LZ1D 1PW8A 3HVFA 4RX3A 4AWLB 3Q7ZA 3V50A 3O62A 5JRGC 1ONGA 4Z2MG 3FYZA 3X1UA 3AZMA 1BZAA 3G30A 5G49A 5FAPA 3DW0A 5E5AC 1P3MB 1MPLA 5CPJA 3WRZA 3AV1A 3AYWD 4A5RA 1MKIA 2OLVA 2WAEA 4IJFA 3MKFA 4DDSA 2PU4A 4H9RA 3G35A 1TDGA 3JYIA 2WKHA 3AZEA 1IELA 3LJAD 3BECA 4WM9A 3A3DA 1DJCA 2Y4AA 5CPKA 4E3NA 4H9RB 2WK0A 5CHMA 4GH9A 4CAYA 3KUYC 1YU2A 3AZGC 4R23A 5DTTA 3UTBA 5AVCB 2YFWA 1M1AA 5CPJC 2RCXA 5AY8D 5F82A 5GSUA 1WE4A 4QU3A 3HBRA 5TGFA 1M18A 3GTCA 3W8KA 4JJNB 4BLMA 5B2JC 4BL3A 4YFMA 1CEFA 1N9BA 2WGIA 2B5RA 5E2HA 4ZTKA 1YLJA 5GXQD 4RA7A 2Y91A 3X1UC 3AZMC 1AOID 3GR2A 1LHYA 1BSGA 2H10A 3W99A 2Q9NA 2YFWB 5JYPA 1ESIA 5AQAA 2EFUA 3RXWA 4H9PB 4HBTA 1L0DA 3ZHHA 4DE1A 3REID 5B0ZC 4Z66A 3WTPA 4KHAB 3MGRC 2F2AC 2IO5C 5AV6D 2Y2OA 2WZZA 3TU4C 3AFAD 3MNNB 2WADA 3AGDA 4OPQA 4OP8A 1YU1A 3UE3A 5CRFA 3DTMA 3P98A 4HBUA 3LY3A 4G91B 3NQUB 3B0BA 4PM7A 1KE3A 1HVBA 1U35B 4P0MA 2OLUA 3HLGA 3AV2D 4L0LA 3B6GB 1Y54A 1YLYA 3MGSD 2ZC3B 4IBDA 5DNNA 1WYBA 1M1AC 3VH6A 4Z5TD 1YQSA 1HQ3C 3IWIA 5AQ7A 1EQZD 1ES3A 3C1BB 4DE0A 1YT4A 2Y2JA 4FSFA 5CPKC 2Z2MB 3R45B 3KUYB 4WU8C 1P3FA 4KGCC 3KWQC 2V20A 3Q7VB 3G4PA 4JXVA 5E2FA 3WS0A 1FOFA 3W4PA 3AZKC 2AROA 4S2LA 4NK3A 2YFVB 5EPHA 1YU0A 1Q2QA 3M6HA 1XGJA 1P3KC 5GT3D 3MVDD 1BH9A 4J8WC 2VGKA 5B1LA 3PBNA 4IBEA 4MBFA 4IEDA 2EX8A 5B32A 2PBYA 3REKC 3C1BA 1P34C 5BNVA 2IOUA 4LD9D 5CEDA 2NZDB 1KX3A 5B2JD 5HAQA 1FCNA 3F6TA 3IWOA 4KUDB 1NZOA 3LCEA 1PI4A 2J9OA 1KGFA 1IKGA 4J8VC 3KFUG 2P9VA 5CP6B 3AZNC 1RGYA 1HQ3D 1P3BB 5GT0C 5C3IC 1YLPA 2W8SA 4DRAA 4H9SC 3OPHA 4JLFA 3SS4A 1MBLA 4PMAA 4ZUXA 4JBFA 4NE5A 4X23B 3WS1A 4S2NA 5HFOA 5B31D 3VSKA 4PM9A 5CP6A 3G2ZA 5AQBA 5A93A 4WELA 1I2SA 1FCOA 3IXGA 5F99C 3HLEA 4YS3A 2JC7A 5E5AD 4D2OA 5BO0A 2BYMB 3HUOA 1XA1A 4JJNA 5A92A 3SH9A 3KSYA 3TOIA 1F66D 5FAQA 2ZC7A 1LL5A 1A7WA 1L0EA 2ZQ9A 3EPHA 3S1YA 1JWVA 1SDEA 5F99B 5GLDA 5B2IC 3ZG0A 3WKJB 4S2JA 2HIOB 5GLCA 2EXBA 3W98B 5FQQA 3O62B 4DE2A 5HW3A 3HONA 1MY8A 3A6ND 1GHPA 3N8SA 4QY5A 5B0YB 4JKTA 4J8VD 3IHAA 3LELD 4B4ZA 4Z5TA 4DRBA 4NYYA 4H9OA 5CPJD 4JF6A 5FI2A 3MXRA 3AV1B 5DF7A 1KX4B 4KUDC 4PM8A 1M40A 3A3EA 5B32D 3UPPA 5B2IA 3C4OA 1P3LC 1QMFA 1KDWA 3X1VC 3E2KA 2NZDC 1MXOA 4Z5TC 5B0ZD 1O07A 3RJUA 3REHB 2FFYA 5B2IB 5CPIB 2C5WB 1O7EA 3CJMA 5DTKA 4WV4B 3IWQA 5M1AA 4WMCD 4M6BA 5M18A 3W96D 3AZED 2BG1A 3L28A 1K55A 1H5XA 1M18D 2Y2HA 2ZMAA 2AROC 4WU8B 5GLAA 5B2JB 3HLFA 2CV5C 1EWZA 4JJNC 3G2YA 3KXBA 3N7WA 2HIOD 1L0FA 2WAFA 5BNXB 3W98A 1P3KD 3AZLD 3WTPB 4Z66B 4KGCB 3AZEB 3FKEA 5HX9A 1H3OA 3IH9A 3ZDJA 3MVDB 1CEGA 1QMEA 1HQ3A 3W96C 4E3LA 4X23C 3REHA 3X1SB 1L0GA 5HAPA 3C7VA 3MZEA 2VQRA 4GNUA 1ES5A 3VP3A 1P3PA 4BD0A 4KZ9A 3H0RC 3HLCA 3PBTA 3UTAD 4J8WA 3AZNA 4R8PA 4CSRB 1KX3D 4Y7PA 5AV8D 1KU5A 3N8RA 1P3KA 2Y2GA 3AV2C 2ZLYA 3UDFA 1H8YA 2VGJA 5GT3C 1PWGA 3VP1A 4GB7A 4K0XA 3B0DB 3BFDA 4R3BA 1WWSA 3A1IA 4U3TA 5E2EA 4GD8A 5FSRA 3X1SA 5AVBC 2QMIA 4KZ7A 2IWDA 4KUDD 4NE6A 4J8XB 1Q2PA 3GMWA 4GD6A 2DCFA 3W99C 4IBRA 4MNRA 5CGSA 4DQYB 1ZKJA 4OJOA 3W98D 1JTGA 3LZ1A 1NXYA 1CI9A 3MNNA 1PYYA 3WS4A 5AV8B 5F99D 3NCKA 1U35A 4KHAA 5DNMC 2IWBA 3IXDA 1PZOA 5JRGD 1JFIB 3HLBA 3LJAA 4OPZA 2PYOC 1N4OA 5AVBD 3PAEA 5B2ID 3PBQA 1KX4D 1P3IC 3AV1D 2Y2NA 3FDDA 1BUEA 2HPBA 3BLMA 4UUZB 4GZBA 4R3JA 4UA9A 5B31B 3BYDA 4DRTA 1SCWA 3KS4A 4OLGA 1M1AB 1RP5A 5HAIA 4BD1A 2Y59A 4Z66C 3WTPC 3AZHA 1JFIA 5FQJA 3CG5A 3R45A 3WWXA 1W2EA 3B3XA 3B6GC 1HQ3B 4EWFA 3WKJD 4J8XD 3Q1FA 1NJ4A 4H8RA 3H0LC 4MBHA 3C1CB 4ZJ1A 5KSHA 1ERQA 4ZBJB 4CPKA 3ZG7B 1P3AD 3TU4A 4LD9B 3S22A 3REJB 5AV5C 1R4VA 3REJA 4KENB 3VP4A 5FA7A 3X1UB 3AZMB 5CERA 5GT3B 1P3GB 5B32B 1P3ID 3SS5A 1S0WA 4OKPA 1W5DA 2PYOA 3RXXA 1KX4C 1PI5A 1K4EA 5B2JA 3LJAC 3V9RB 2A49A 5GSUC 3UPNA 3ZG9B 5AV5D 1BLCA 4Z66D 3WTPD 5E5AA 2OSUA 1FSWA 2X71A 4XUXA 2ZQ7A 3OZHA 5FQIA 3UY6A 5JYOA 1N1JB 4H9OB 4OJ5A 4GKUA 4G92C 3O62C 4JXSA 2NQBB 3NIAA 3X1SC 4JXGA 4P87A 2ZY2A 3AZEC 3ZNYA 3W96B 5B1MA 3G34A 2A3UA 2PYOD 1TZYD 2X02A 3VP2A 3ZVTA 4R1GA 4WU9C 5GT3A 1MWSA 5JA4B 5CTNA 1LLBA 4E45A 3VH6W 1JWPA 3OPPA 4RX2A 1P3OA 3NDGA 3KWQD 5EVIC 1BT5A 5CGWA 4LD9A 2DF4C 3B0DC 2ZC6B 1XXMA 3MGQA 3P5JB 5B40A 3MGPC 5GHYA 5B24C 3L2AA 3B6FD 2ZY4A 3LZ0C 1DJBA 3REIB 3MZDA 4J8XC 4K0WA 3LY4A 1AOIA 4ZJ2A 3C1BD 4KZ5A 3REHC 3W96A 1HTZA 3EPJA 5GXQB 3FV7A 5B31G 3MBZA 1NYYA 2YFVA 3ITBA 4XUJB 1WYCA 4KZ6A 4UA7A 1NRFA 3AFAA 3IP4C 4QJGA 3VH5A 5B40B 2CV5A 3B6FC 3UN7A 4KQQA 3NY4A 3WS2A 3AZLC 5AV9B 1BULA 4Y0TA 1HTAA 4IBBA 2RL3A 3IF6C 5F83A 2JSSA 4H9QB 1IYPA 1LI0A 4ZJ3A 2XH9A 1PW1A 5HL1A 4QB8A 3A6NC 5DNND 5CECA 3A3JA 4QY6A 1P3OD 3ZGAB 4R4SA 4S2PA 4O7DA 1M19D 4LCMA 3HLWA 4PM5A 3AL0C 4YS3B 4JF4A 4H9NB 3RELD 2V2FF 5AV8C 3MGSA 5AV6B 3AZFA 4LG2A 3IF6B 4FCFA 3ZNTA 5AV9C 3AYWC 4KUDA 4GHLA 4JPMA 4IVKA 3HSHA 5CPIC 4WJ3C 3O3VA 3MGQD 1TZYA 1P3LD 5DVAA 1TAFA 3BEBA 1YLTA 3PBSA 1S6RA 5FQ9A 3UT9B 4X56A 2XF3A 3WAAD 4OJLA 3AZNB 4J8UB 1P3FB 4ZUXB 4J8WD 2HP9A 3AZJA 4IBXA 3FKVA 5B1LD 3GSGA 4X55A 3AZLA 3A3IA 5FI7A 1KX5A 4X69A 5CGXA 1PWDA 2OV5A 4NZ5A 3REIC 3RELA 3AYWB 3LZ0B 5E43A 3AZGD 1T3UA 1DY6A 1ESUA 4KZ8A 5B33B 3MKEA 1K56D 4OH0A 4E6WA 2NQBC 2Z2LB 3N3FA 1P3BD 2WKEA 4EBLA 4G92B 1HD8A 3UTAA 5HARA 1W79A 5B24A 1U60A 5FQMA 3MGQC 3Q82A 3AZHD 3AZGB 3BLSA 3EPLA 3VMAA 2XFSA 3W97C 5GSUB 1P3OC 1XX2A 3C5AA 4GHAA 4FH2A 1EQZC 1KVMA 5B0YA 5TFQA 2WGWA 2J9PA 3UE1A 4OLDA 1LI9A 5DTSA 3C1BC 4FD8A 5B32C 2PYOB 5CTMA 1E25A 1FR6A 1NYMA 5B1LC 3DWZA 3KXBD 1W8QA 5FAOA 4UA6A 4PM6A 1AXBA 5GHXA 1ZG6A 1BLHA 3AZKD 5BT1C 3HUMA 5B40D 3AGFA 3BFFA 4OJPA 5EVID 2WYXA 2CWEA 5GSUD 1LL9A 3CMZA 4JXWA 3AZKA 4RYEA 2XR0A 3BRMA 1ZLAC 3TU4B 1S32C 5D3OA 2ZQ8A 2H0YA 4QLCC 1L2SA 2HP5A 1NZUA 1IYSA 3AZKB 4E3KA 5KDMA 3OCLA 5GL9A 2QZ6A 3UTBB 4IBJA 5B31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKF A;  3PAE A;  3C7U A;  4DDS A;  2PU4 A;  3PBQ A;  1BLP A;  2Y2M A;  3G35 A;  1TDG A;  3JYI A;  2WKH A;  1IEL A;  3BEC A;  4WM9 A;  1CI8 A;  4FH4 A;  3A3D A;  4LCL A;  2Y2N A;  2FFF B;  1DJC A;  1BUE A;  2HPB A;  2Y4A A;  3BLM A;  4E3N A;  4GZB A;  1VM1 A;  2JE5 A;  1KE0 A;  1G68 A;  2WK0 A;  3LEZ A;  4OOY A;  4R3J A;  5CHM A;  4UA9 A;  1XGI A;  1OME A;  3BYD A;  1SCW A;  4DRT A;  4E3J A;  2GDN A;  3MFD A;  4OLG A;  5HAI A;  1RP5 A;  5AQ9 A;  4BD1 A;  2Y59 A;  4R23 A;  5DTT A;  3MXS A;  5FQJ A;  3CG5 A;  4RVA A;  4S2O A;  3WWX A;  3B3X A;  2RCX A;  5F82 A;  3ZG5 A;  1WE4 A;  4QU3 A;  3HBR A;  5EOO A;  5TGF A;  3GTC A;  3W8K A;  3NDE A;  3D4F A;  3FZC A;  3IXH A;  4EWF A;  4R0Q A;  4BLM A;  2XK1 A;  3TG9 A;  3TSG A;  1E3U D;  3Q1F A;  4BL3 A;  4YFM A;  1CEF A;  1N9B A;  1XP4 A;  2WGI A;  1NJ4 A;  2B5R A;  4XXR A;  5E2H A;  4ZTK A;  4H8R A;  3NBL A;  1CK3 A;  1YLJ A;  3CZD A;  4RA7 A;  4X68 A;  2Y91 A;  4MBH A;  3GR2 A;  2XFT A;  1LHY A;  4ZJ1 A;  1BSG A;  2H10 A;  3S4X A;  5KSH A;  2Q9N A;  3HRE A;  1FQG A;  5JYP A;  1ESI A;  3QHY A;  5AQA A;  1ERQ A;  2EFU A;  3RXW A;  4HBT A;  1L0D A;  4CPK A;  1RCJ A;  3ZHH A;  3ZG7 B;  4DE1 A;  4NET A;  3GVB A;  3ZVW A;  3S22 A;  3EQU A;  3O86 A;  3P09 A;  4DXC A;  2ZC5 B;  3OPR A;  4U0T A;  2H5S A;  4LV0 A;  2Y2O A;  2WZZ A;  3Q07 A;  5EOE A;  4GN2 A;  3W4Q A;  2WAD A;  2J8Y A;  1YM1 A;  3AGD A;  4KEN B;  1JWZ A;  3VP4 A;  1YMS A;  2DNS A;  5EVL A;  4OPQ A;  5FA7 A;  4MLL A;  4OP8 A;  4WZ4 A;  4ZBE A;  5CER A;  4OQI A;  2Y55 A;  3UE3 A;  3Q81 A;  5CRF A;  3BFC A;  4OOL A;  3DTM A;  4P6B A;  3P98 A;  4HBU A;  3LY3 A;  4PM7 A;  1KE3 A;  1HVB A;  4QD4 A;  3SS5 A;  4P0M A;  2OLU A;  3HLG A;  1S0W A;  1K57 C;  4OKP A;  2J7V A;  1W5D A;  4L0L A;  3UO9 A;  3RXX A;  4BQM A;  1Y54 A;  1YLY A;  3HLD A;  1PI5 A;  1K4E A;  3G32 A;  2ZC3 B;  2HDS A;  3M6B A;  4YIN A;  1SHV A;  1K56 A;  2A49 A;  3UPN A;  1WYB A;  2P9V B;  3ZG9 B;  1DJA A;  4QHC A;  5U47 A;  1BLC A;  3ZFZ A;  2OSU A;  1FSW A;  5CXW A;  2X71 A;  2HDQ A;  4XUX A;  2ZQ7 A;  1YQS A;  3IWI A;  5AQ7 A;  3OZH A;  1ES3 A;  5FQI A;  3UY6 A;  4DE0 A;  5JYO A;  2Y2K A;  3MZF A;  4R4R A;  1YT4 A;  3N6I A;  2Y2J A;  2XD5 A;  4GKU A;  1KGG A;  3WRT A;  3ZCZ A;  3ISG A;  1I5Q A;  2Y2Q A;  2QPN A;  4FSF A;  4HES A;  2Z2M B;  4JXS A;  2JBF A;  3NIA A;  1BLS A;  5FAT A;  4JXG A;  4P87 A;  1K6S A;  2P74 A;  3VOZ A;  3ZNY A;  2V20 A;  5A90 A;  3G34 A;  3Q7V B;  2I72 A;  4Q8I A;  3G4P A;  3E2L A;  4JXV A;  5E2F A;  4UHU A;  3WS0 A;  2A3U A;  4DXB A;  1FOF A;  3W4P A;  1JVJ A;  2X02 A;  3VP2 A;  1XPB A;  3ZVT A;  4R1G A;  4S2L A;  4NK3 A;  2Y2I A;  4OP5 A;  4ZAM A;  4B4X A;  1MWS A;  4WEJ A;  3QNC A;  5EPH A;  1Q2Q A;  5CTN A;  1LLB A;  3M6H A;  1XGJ A;  1JWP A;  3OPP A;  4RX2 A;  3BFG A;  3NDG A;  4WZ5 C;  5G18 A;  1TDL A;  5EVI C;  4F94 A;  1BT5 A;  5CGW A;  2VGK A;  4KG5 A;  3VFH A;  3PBN A;  3GV9 A;  2ZC6 B;  4MBF A;  4IED A;  2EX8 A;  1W8Y A;  2PBY A;  3SOI A;  4KQO A;  4C75 A;  1XXM A;  4DE3 A;  2CC1 A;  4OON A;  5GHY A;  4BJP A;  1TEM A;  4OQH A;  4KG6 A;  1FCM A;  5CED A;  3C4P A;  5IHV A;  1YLZ A;  4DDY A;  1DJB A;  4EQI A;  3MZD A;  4K0W A;  3LY4 A;  2R9W A;  4ZJ2 A;  5HAQ A;  1FCN A;  3QNB A;  5EEC A;  3M2J A;  4KZ5 A;  3IWO A;  3IH8 A;  1XA7 A;  1H8Z A;  2ZD8 A;  4KQR A;  1IEM A;  1HTZ A;  1K55 C;  3VFF A;  1NZO A;  3GRJ A;  1NY0 A;  3HL9 A;  3LCE A;  1GA0 A;  3FV7 A;  1PI4 A;  2WKI A;  3G31 A;  2J9O A;  5M19 A;  2EX6 A;  1KGF A;  3MBZ A;  1IKG A;  1NYY A;  3ITB A;  5FAS A;  4E3O A;  1TVF A;  1WYC A;  4KZ6 A;  3PBR A;  4UA7 A;  1NRF A;  2P9V A;  2C6W B;  4QJG A;  1FR1 A;  1RGY A;  3PAG A;  4EV4 A;  2Y2P A;  1FSY A;  3VOY A;  3UN7 A;  1ES4 A;  3O87 A;  4KQQ A;  3NY4 A;  3WS2 A;  1ZG4 A;  2E8I A;  1JTD A;  1VQQ A;  4PPR A;  1YLP A;  1MWR A;  1BUL A;  4GDN A;  1SKF A;  3OPH A;  2HDR A;  4JLF A;  1MBL A;  4X6T A;  5TR7 A;  3SS4 A;  4Y0O A;  3A3F A;  4Y0T A;  2RL3 A;  4PMA A;  1GCE A;  3IF6 C;  4JBF A;  5F83 A;  1ZC2 A;  3WS1 A;  4S2N A;  4S2K A;  5HFO A;  3VSK A;  4N1H A;  1IYP A;  1LI0 A;  4M3K A;  5FI6 A;  4ZJ3 A;  4KZ4 A;  4PM9 A;  2XH9 A;  3G2Z A;  1YMX A;  3VP0 A;  1PW1 A;  4B88 A;  5AQB A;  5HL1 A;  3HUN A;  4QB8 A;  3UDX A;  3OPL A;  1PWC A;  3IT9 A;  2ZC4 B;  5A93 A;  4WEL A;  5CEC A;  5CHU A;  1ERO A;  3NC8 A;  3A3J A;  4QY6 A;  1I2S A;  2BLS A;  3ZGA B;  1FCO A;  2ZM2 A;  3IXG A;  4R4S A;  4S2P A;  3UNW A;  3HLE A;  4O7D A;  1M6K A;  2JC7 A;  4D2O A;  2ZJ9 A;  3Q7V A;  4LCM A;  1K38 A;  3HLW A;  5KSC A;  3HUO A;  4PM5 A;  2R9X A;  1XA1 A;  3I7J A;  4JF4 A;  4OOM A;  4BL2 A;  5CHJ A;  2DRW A;  2V2F F;  5A92 A;  3SH9 A;  3TOI A;  5FAQ A;  1G6A A;  2ZC7 A;  3PBO A;  3SH7 A;  1LL5 A;  5DF9 A;  1L0E A;  2ZQ9 A;  4E6X A;  3S1Y A;  1JWV A;  1SDE A;  2ZM8 A;  3AGE A;  5GLD A;  1KGE A;  4MBK A;  3ZG0 A;  3IF6 B;  4FCF A;  4S2J A;  1K54 C;  4E3I A;  3NI9 A;  2XDM A;  5GLC A;  2EXB A;  2Y2L A;  1E3U A;  3ZNT A;  5FQQ A;  4IVI A;  3LO7 A;  4DE2 A;  5HW3 A;  4JPM A;  4EBN A;  1MY8 A;  4IVK A;  5FDH A;  3O3V A;  3W4O A;  1GHP A;  1K54 A;  5DVA A;  4Y0U A;  4KZB A;  3IQA A;  5F1F A;  3BEB A;  3N8S A;  2X01 A;  4QY5 A;  4JKT A;  3IHA A;  3IF5 A;  1YLT A;  3PBS A;  4OQG A;  4B4Z A;  1S6R A;  4KG2 A;  4WYY A;  5FQ9 A;  1GHM A;  4OPY A;  3O88 A;  1BTL A;  4WBG A;  1XKZ A;  4X56 A;  3V3R A;  2HP6 A;  4JF6 A;  1IYQ A;  1ONH A;  5FI2 A;  2XF3 A;  3UE0 A;  3MXR A;  4BEN A;  5DF7 A;  1IYO A;  1Z6F A;  2XLN A;  4PM8 A;  1M40 A;  1J9M A;  5KZH A;  3A3E A;  1EI5 A;  3UPP A;  2G2U A;  3C4O A;  3IHB A;  4KZ3 A;  2HP9 A;  1QMF A;  1KDW A;  2ZQD A;  5A91 A;  4E3M A;  4DKI A;  4IBX A;  3ZG8 B;  3IF6 A;  5I94 A;  2EX2 A;  4GDB A;  3FKV A;  3GSG A;  3SH8 A;  3ITA A;  4X55 A;  3E2K A;  3A3I A;  1MXO A;  4WEK A;  5FI7 A;  1O07 A;  4ZDX A;  5FQK A;  3RJU A;  3FWL A;  2FFY A;  4X69 A;  5CGX A;  2C5W B;  4S2I A;  1O7E A;  1K25 A;  1PWD A;  2OV5 A;  3V5M A;  3CJM A;  4DF6 A;  5DTK A;  4GOG A;  1RGZ A;  2WGV A;  1IKI A;  4Z9Q A;  3M2K A;  1MWT A;  3IWQ A;  5E43 A;  5M1A A;  4WMC D;  2XQZ A;  5M18 A;  4X53 A;  5EUA A;  2JCH A;  1DY6 A;  1ESU A;  5CEB A;  2BG1 A;  1K55 A;  1H5X A;  1K6R A;  4KZ8 A;  3MKE A;  4LV2 A;  1K56 D;  2Y2H A;  4OH0 A;  2ZMA A;  5EVI B;  2WZX A;  4E6W A;  4C6Y A;  2Z2L B;  5GLA A;  3HLF A;  2WKE A;  1EWZ A;  3G2Y A;  4EBL A;  2ZQA A;  3IXB A;  1HD8 A;  3N7W A;  1L0F A;  2WAF A;  5F1G A;  5HAR A;  3N8L A;  3OCN A;  4EUZ A;  1W79 A;  1U60 A;  5FQM A;  4KZA A;  4N9L A;  1MWU A;  3Q82 A;  2EX9 A;  1KE4 A;  4MEZ A;  5GHZ A;  3VSL A;  5HX9 A;  1HZO A;  4OVD A;  4HEF A;  2WUQ A;  4UAA A;  3BLS A;  3IH9 A;  3VMA A;  4LV1 A;  3ZDJ A;  2IWC A;  3UPO A;  2XFS A;  1CEG A;  1QME A;  1PIO A;  4XUZ A;  4E3L A;  1ALQ A;  1L0G A;  4CJN A;  2EFX A;  1C3B A;  1XX2 A;  3EQV A;  3C5A A;  1GHI A;  5HAP A;  2ZM0 A;  4N1X A;  1I2W A;  4LV3 A;  4FH2 A;  3C7V A;  3OC2 A;  3PTE A;  1KVM A;  4S2N C;  3MZE A;  5TFQ A;  2WGW A;  2J9P A;  4GNU A;  3UE1 A;  4OLD A;  5EE8 A;  1LI9 A;  2HDU A;  1ES5 A;  5DTS A;  2Q9M A;  3VP3 A;  4N9K A;  4FD8 A;  2XD1 A;  4LEN A;  4BD0 A;  3GQZ A;  4KZ9 A;  5CTM A;  1E25 A;  3HLC A;  4OQ0 A;  1FR6 A;  5E2G A;  1NYM A;  2G2W A;  2H0T A;  3DWZ A;  1SDN A;  3FKW A;  3PBT A;  4U0X A;  5BOH A;  1W8Q A;  4N92 A;  5FAO A;  1W7F A;  4UA6 A;  4Y7P A;  1K4F A;  5EVI A;  3UDI A;  4OPR A;  4WZ5 A;  4PM6 A;  1AXB A;  5GHX A;  3SS3 A;  5J8X A;  2EXA A;  3N8R A;  3BFE A;  1ZG6 A;  1BLH A;  2Y2G A;  2ZLY A;  3UDF A;  3HUM A;  1KDS A;  1H8Y A;  2ZQC A;  2VGJ A;  5GLB A;  3AGF A;  2XEP A;  3BFF A;  5EVI D;  1E4D A;  2WYX A;  4C3Q A;  1PWG A;  4ID4 A;  3VP1 A;  4GB7 A;  4K0X A;  1LL9 A;  3CMZ A;  4JXW A;  4WMC A;  4RYE A;  2WGW B;  3BFD A;  3DWK A;  2XR0 A;  4R3B A;  1ERM A;  3BRM A;  1YLW A;  1ES2 A;  3BM6 A;  4U3T A;  2PU2 A;  3N4I A;  4GD8 A;  5E2E A;  1KVL A;  5KMW A;  5D3O A;  4K91 A;  5FSR A;  2XGN A;  1PW8 A;  4JF5 A;  2ZQ8 A;  3HVF A;  4RX3 A;  2QMI A;  3Q7Z A;  4KZ7 A;  3V50 A;  3V39 A;  5L2F A;  4S2M A;  2IWD A;  3GMW A;  1Q2P A;  4GD6 A;  2DCF A;  4IBR A;  2H0Y A;  4MNR A;  1ONG A;  3V3S A;  5CGS A;  2UWX A;  3FYZ A;  1ZKJ A;  1L2S A;  3WS5 A;  1BZA A;  5DF8 A;  3G30 A;  1JTG A;  2HP5 A;  1NXY A;  1CI9 A;  1NZU A;  1IYS A;  5FAP A;  3DW0 A;  1PYY A;  3WS4 A;  3NCK A;  4E3K A;  5GL9 A;  3OCL A;  2V1Z A;  4P85 A;  2IWB A;  2QZ6 A;  1MPL A;  3IXD A;  3WRZ A;  1GA9 A;  1PZO A;  3HLB A;  4OPZ A;  4EBP A;  4A5R A;  1MKI A;  1PZP A;  2OLV A;  2WAE A;  1N4O A;  1K57 A; 
#chains in the Genus database with same CATH topology
 1DP6 A;  4R6L A;  3C7U A;  3MVD A;  4GS9 A;  3WA9 A;  4IJE A;  1CI8 A;  2ZY3 A;  2FFF B;  3AZI A;  3LR0 A;  4QNL A;  3LEL C;  3B33 A;  1G68 A;  1KE0 A;  4OOY A;  4E3J A;  1VET B;  2GDN A;  3MFD A;  2BYK A;  5B31 C;  1F1E A;  5BT1 D;  4NYU A;  1KX5 D;  2NQB D;  3MXS A;  3S7Q A;  3AN2 A;  3X1T A;  3BY9 A;  2VV6 A;  5DJU A;  3AZF D;  3ZG5 A;  4DN0 A;  2F8N G;  5EOO A;  3D4F A;  3FZC A;  3IXH A;  2XK1 A;  1E3U D;  3HJK A;  5TBM A;  4XXR A;  1P3M C;  4IBG A;  1P3G C;  1CK3 A;  4YM6 C;  4AWL C;  3CZD A;  4X68 A;  2F8N A;  4NE3 A;  1P3A A;  1T1B A;  1F66 C;  3NQU A;  3HRE A;  3AZI C;  1FQG A;  3NHQ A;  3UME A;  3C1C A;  3AZJ B;  4NFT A;  1RCJ A;  4BBU A;  1S32 A;  3GVB A;  5AVB B;  3P09 A;  4GJ4 A;  1KX5 B;  3OPR A;  4MN6 A;  5JRG B;  3X1U D;  3AZM D;  1K0K A;  3Q07 A;  3X1T D;  3AZI B;  5LBR A;  4GN2 A;  3W4Q A;  1YM1 A;  1JWZ A;  1TS8 A;  3H9W A;  5EVL A;  4E44 A;  5DNM D;  3C1C C;  4WZ4 A;  3EPK A;  4OQI A;  3H7W A;  2LB5 A;  1F66 A;  2W3F A;  3L26 A;  3C2W A;  1P3F D;  1M19 B;  5AVC C;  3MQ0 A;  5KIZ A;  3VH5 W;  4HP4 A;  4QD4 A;  1P3G A;  1P3P B;  2FJ7 A;  5DNN B;  4UUZ A;  1K57 C;  3UO9 A;  2O9B A;  4BQM A;  2G5I C;  1ZLA D;  3HLD A;  3AV1 C;  5AVB A;  3M6B A;  4YIN A;  1TZY B;  5DKL A;  4YNR A;  5CHL B;  2FJ7 B;  5EM1 A;  1TAF B;  1K56 A;  1EQZ A;  2P9V B;  2B18 A;  3AN2 C;  4QHC A;  1ZLA A;  3AZH B;  1V9Y A;  1P3B A;  5CXW A;  4WNN B;  4PHT A;  2HDQ A;  5AV9 D;  2JHE A;  5AV6 A;  3W97 A;  2HGV A;  3MGQ B;  5BPV A;  3MZF A;  2XD5 A;  4WNN A;  3ZCZ A;  1I5Q A;  5JRG A;  3LEL A;  1E8B A;  4HES A;  3KYQ A;  2Y79 A;  2JBF A;  5BS7 C;  5B33 D;  1BLS A;  3H0M C;  3FC7 A;  1M1A D;  2PD8 A;  1K6S A;  3UTA C;  5A90 A;  3MVD C;  2I72 A;  4Y2F A;  4F3L A;  5BNV B;  5B24 D;  3ZYT A;  4DXB A;  4FTX A;  4B9O A;  3P01 A;  3LEQ A;  3LZ0 D;  1P3P C;  4D60 A;  4H9N A;  1O6I A;  4B4X A;  4WEJ A;  2F8N B;  3QNC A;  3ULF A;  4HHD A;  3BFG A;  4WZ5 C;  5G18 A;  1TDL A;  4X23 A;  4PKY A;  4F94 A;  3CPT B;  5DJT A;  3VFH A;  1KX5 C;  4QLC A;  1UR9 A;  3SOI A;  4DE3 A;  4C75 A;  4BJP A;  4OQH A;  4X1L A;  1FCM A;  2EA9 A;  3C4P A;  3AZJ C;  4HME A;  5IHV A;  4J8U D;  4DDY A;  3B0C W;  4QLC D;  2L5A A;  2NQB A;  3NOT C;  3WAA B;  3QNB A;  4I39 A;  1SKO B;  3IH8 A;  1H8Z A;  2ZD8 A;  4KQR A;  3VFF A;  3BW6 A;  2XA7 M;  3HL9 A;  1NY0 A;  2P7J A;  3X1V B;  1GA0 A;  2WKI A;  3G31 A;  5M19 A;  1BFM A;  1ID3 A;  1J3W A;  4E3O A;  5FAS A;  3PBR A;  5AY8 A;  2RVQ C;  1P3L B;  4LRZ E;  4EV4 A;  3REH D;  1JNU A;  2LB9 A;  1GOI A;  3WAA C;  1ZG4 A;  1Y4O A;  4J8U C;  2E8I A;  1JTD A;  3EG5 B;  1MWR A;  5B1M D;  2HDR A;  3X1V A;  5TR7 A;  1S32 D;  3A3F A;  5B0Y C;  1GCE A;  3DTE A;  1ZC2 A;  5BO0 B;  3B0C T;  3UT9 C;  1PNE A;  3TE8 A;  2IA2 A;  2G5H C;  4M3K A;  3TRC A;  2HIO A;  4MN5 A;  1P3L A;  3KSI A;  1YMX A;  4EO5 B;  3KX0 X;  3K3D A;  4Q0J A;  3VP0 A;  4B88 A;  2Z6D A;  4G3W A;  3UDX A;  3OPL A;  1PWC A;  3IT9 A;  2ZC4 B;  1ID3 B;  3R7W B;  1ERO A;  3F1O A;  5AV8 A;  2BLS A;  1P3O B;  3UNW A;  1ULY A;  3UB9 A;  4BBV A;  5KSC A;  3IS2 B;  3V67 A;  4WU9 B;  2R9X A;  5HDD A;  3NQJ B;  4BL2 A;  1Y28 A;  5CHJ A;  4Z2I A;  3A1K A;  2JKT M;  5HWT A;  1G6A A;  3SH7 A;  5DF9 A;  2ZM8 A;  5IU1 A;  2CV5 B;  4IBF A;  2W1R A;  3QP8 A;  4IBK A;  3NI9 A;  2XDM A;  4OJ6 A;  3A6N B;  4NZ3 A;  3D3O A;  3W99 B;  3LO7 A;  4IVI A;  3MGR D;  3O62 D;  3UT9 A;  1H3Q A;  5AV9 A;  3W4O A;  4Y0U A;  4HP9 A;  2BTF P;  4XUJ D;  2YKH A;  4J8U A;  2X01 A;  3WAA A;  3H82 A;  2ZY5 A;  1BTL A;  3BY8 A;  4WBG A;  2W3D A;  5GT0 B;  4EEU A;  5GXQ A;  1IYQ A;  3VE4 A;  1ONH A;  4BEN A;  5CPI D;  4Z2L A;  3UB7 A;  5F99 A;  1IYO A;  1EAK A;  2XLN A;  1MKM A;  5HDS A;  4XZQ D;  2G2U A;  1KX3 B;  5CP6 C;  3IHB A;  4KZ3 A;  3QP5 A;  3MGP B;  1UR8 A;  3VH5 T;  1IFQ A;  3REL B;  2ZQD A;  4E3M A;  4DKI A;  4HGA C;  4HH3 A;  3IF6 A;  5GXQ C;  2EX2 A;  4GDB A;  4CQH A;  3SH8 A;  4H9S A;  3ITA A;  3MGP A;  2V8C A;  3REJ D;  3NOP C;  3REK D;  2HUE C;  4WEK A;  5GT0 A;  5CPK D;  5FQK A;  2V8F A;  3CUE C;  4MDZ A;  2HF6 A;  4S2I A;  5HSQ A;  1K25 A;  3X1S D;  3WX7 A;  3V5M A;  2O9A A;  2FZ0 A;  4ZBJ C;  4GS9 B;  4GOG A;  2GJ3 A;  2WGV A;  2HZ5 A;  1B6W A;  3W97 D;  2XQZ A;  4X53 A;  2JCH A;  3NJA A;  1NWZ A;  2RVQ D;  5CEB A;  3T4Q A;  1K6R A;  4FUW A;  5F68 A;  3AZF C;  2BYK B;  2NUT C;  4R70 A;  4CSR A;  3L25 A;  3WKJ C;  3PXP A;  2ZQA A;  3MFX A;  5F1G A;  2A24 A;  3S7N A;  3N8L A;  3OCN A;  4EUZ A;  4YM6 D;  4N9L A;  1ID3 C;  1E88 A;  2EX9 A;  2FH5 A;  1KE4 A;  3VSL A;  3UTA B;  4GLQ A;  3E4Q A;  5HPF A;  4HEF A;  1WA9 A;  3SW1 A;  4LV1 A;  2D01 A;  2IWC A;  3UPO A;  1PIO A;  5FUG B;  5AVF A;  2RIQ A;  5J3W A;  1C3B A;  4CLC A;  4N1X A;  1I2W A;  4LV3 A;  4KQD A;  3PTE A;  2UV0 E;  5EE8 A;  2V1A A;  2ACG A;  3B6F B;  5FL3 A;  3TJZ C;  3K2N A;  1KX4 A;  4GW9 A;  4IUK A;  5HZH A;  3GQZ A;  5BNX A;  3T1X A;  4OQ0 A;  2G2W A;  4X23 D;  1SDN A;  4KGC D;  5AVC A;  3AN2 B;  4U0X A;  3AZL B;  1P3F C;  3UDI A;  4WZ5 A;  5J8X A;  4XZQ B;  1X0O A;  4X25 A;  1P3A B;  3KYZ A;  2W27 A;  4IUH A;  4R3A A;  4R8P D;  4C3Q A;  4ID4 A;  5AV5 A;  1DP8 A;  4WMC A;  3DWK A;  1YLW A;  1ES2 A;  3BM6 A;  4J8X A;  4UQI S;  5KMW A;  4K91 A;  5B0Y D;  2FJ7 D;  2XGN A;  1P3K B;  4JF5 A;  5BS7 A;  5L2F A;  4YM6 B;  3V39 A;  1H0G A;  4S2M A;  4JGP A;  2H28 A;  3V3S A;  2UWX A;  3WS5 A;  5DF8 A;  5B0Z B;  4YM6 A;  1P3M A;  5AV6 C;  4Q0H A;  1H8P A;  4O8G A;  1M18 B;  4I3A A;  2V1Z A;  4P85 A;  3B6G A;  1GA9 A;  3AFA B;  3X1T C;  4WU9 D;  4UQI M;  2QJ5 A;  4GHI B;  4EBP A;  1PZP A;  1K57 A;  4NY2 A;  4XZQ A;  5CPK B;  2Y2M A;  1BLP A;  1L6J A;  2PYR A;  2F8N D;  1P3I B;  3FPW A;  4EQ1 A;  4FH4 A;  4LCL A;  5CPJ B;  4H9Q A;  1P3G D;  5GT0 D;  2VKS A;  4HIA A;  4NXB A;  4K08 A;  1VM1 A;  2JE5 A;  3L27 A;  4EET B;  1WWI A;  3LEZ A;  1SZV A;  2V9A A;  4EU0 A;  1XGI A;  3LEL B;  1OME A;  4NZ1 A;  3MGP D;  2VGL S;  5AQ9 A;  1UWP X;  2W1T A;  1P3B C;  2OAQ 1;  5J7E A;  1M18 C;  4RVA A;  4S2O A;  5AY8 B;  5MC7 A;  5DNM A;  3NDE A;  4WU8 D;  3UTB C;  4R0Q A;  3AZH C;  1U35 C;  2CV5 D;  3TG9 A;  3TSG A;  3UE6 A;  3AZG A;  1XP4 A;  1Q9C A;  3MNN C;  3NBL A;  2FJ7 C;  3C1C D;  3LZ1 C;  5B33 C;  3KUY A;  5B33 A;  3X1V D;  4IBC A;  2XFT A;  2PAV P;  3S4X A;  1ZLA B;  1N1J A;  3QHY A;  5IT5 A;  4G91 C;  4R8P B;  1T1A A;  4QLC B;  5F5Y A;  3MGR B;  4Z2H A;  2M7U A;  4NET A;  3ZVW A;  3REK B;  4DMZ A;  3EQU A;  5KDM B;  3O86 A;  4DXC A;  2ZC5 B;  4U0T A;  2H5S A;  3UTB D;  4LV0 A;  3AN2 D;  3F1P B;  4O0P A;  5EOE A;  3IS2 A;  1F66 B;  2J8Y A;  1YMS A;  2DNS A;  3MNN D;  4HGA B;  2A2L A;  4MLL A;  4ZBE A;  4ZRR A;  1S32 B;  2Y55 A;  3Q81 A;  3BFC A;  4OOL A;  3WA9 C;  1P3A C;  4P6B A;  1B67 A;  4R8P C;  1VB6 A;  4YWZ A;  4XZQ C;  3C8C A;  4UPK A;  2J7V A;  2OAP 1;  3G32 A;  4WZS B;  4TX8 A;  3LI9 A;  2HDS A;  1SHV A;  5L8M A;  3MJQ A;  4G3K A;  3DTI A;  3TU4 D;  2JKR I;  1DJA A;  5U47 A;  3ZFZ A;  2J3T D;  1H3O B;  2Y2K A;  4R4R A;  3N6I A;  2EWW A;  3VH6 T;  4KUK A;  1KGG A;  3WRT A;  3ISG A;  1EQZ B;  2PYP A;  2Y2Q A;  2QPN A;  4Y17 A;  3W98 C;  1OPX A;  5FAT A;  3VOZ A;  1P3I A;  2P74 A;  3KXB C;  3W97 B;  1IOU A;  4Q8I A;  4Q0I A;  1H0I A;  3E2L A;  4UHU A;  2AVX A;  5FEF A;  1Z2C B;  1JVJ A;  1M19 A;  1XPB A;  2Y2I A;  4OP5 A;  4ZAM A;  5E5A B;  3M7P A;  2W3E A;  3V9R A;  3PYP A;  2QKP A;  1LT0 A;  3CLO A;  3D72 A;  1YU4 A;  1S66 L;  5DNM B;  3LIE A;  4KG5 A;  2QWS A;  3GV9 A;  1W8Y A;  2V0U A;  4KQO A;  1YU3 A;  2CC1 A;  4OON A;  1TEM A;  4KG6 A;  5K5B A;  3L29 A;  1YLZ A;  2O99 A;  4EQI A;  4EER A;  3LIA A;  5C3I B;  2R9W A;  4YOF A;  3T4O A;  5EEC A;  3M2J A;  5B32 G;  1XA7 A;  4Z5T B;  1IEM A;  3MR0 A;  1K55 C;  3LZ1 B;  2DQN C;  1AOI B;  3GRJ A;  3AV2 A;  1OJG A;  2EX6 A;  3OOV A;  1BH8 A;  1TVF A;  4IHQ A;  4RQ9 A;  3AV2 B;  2C6W B;  3EGD C;  3L7H A;  1FR1 A;  4BMW A;  1P34 D;  3PAG A;  3WKJ A;  2Y2P A;  1FSY A;  3VOY A;  3T4K A;  1ES4 A;  3O87 A;  1ZHH B;  5F69 A;  1BH9 B;  1VQQ A;  4PPR A;  4QWO A;  4GDN A;  5B1L B;  1SKF A;  3F1O B;  4X6T A;  1GSV A;  4Y0O A;  3ZQ5 A;  4S2K A;  4N1H A;  1LSX A;  5FI6 A;  4AFI A;  4KZ4 A;  3KS8 A;  3REI A;  3A0V A;  3HUN A;  4L9E A;  3KYE A;  4ZUX D;  4J8W B;  3B6G D;  1BH8 B;  3UB5 P;  4XUJ A;  5TJJ A;  5CHU A;  1P3P D;  3NC8 A;  2ARO B;  4FOF A;  2ZM2 A;  5HWV A;  1M6K A;  2ZJ9 A;  3Q7V A;  1K38 A;  5JA4 A;  4LFU A;  1CF0 A;  2J8P A;  3I7J A;  4YS3 C;  4OOM A;  2DRW A;  4EO5 C;  4OUI A;  3LR4 A;  3DTK A;  3SZT A;  3PBO A;  3AZI D;  4Y3I A;  4E6X A;  3A6N A;  3AGE A;  1KGE A;  5B1M B;  4MBK A;  1YKD A;  2Y8H A;  1K54 C;  4JJN D;  4E3I A;  2XRO A;  2HUE B;  1E3U A;  2Y2L A;  4NXG A;  4EBN A;  2PRF A;  5FDH A;  5HWW A;  3AZJ D;  1P9W A;  5CP6 D;  1K54 A;  1OTA A;  4MMN A;  3REL C;  4KZB A;  3IQA A;  5F1F A;  4QPR A;  4HMD A;  3IF5 A;  4OQG A;  4J8V B;  4KG2 A;  4JGQ A;  4WYY A;  1GHM A;  4YS3 D;  2NZD A;  3O88 A;  4OPY A;  1XKZ A;  4BWI A;  4Z2M H;  2EWV A;  3V3R A;  3MGS B;  2HP6 A;  1TZY C;  4NZ4 A;  2E8J A;  3UE0 A;  4J8V A;  3LJA B;  1T18 A;  1HLU P;  1Z6F A;  1U35 D;  3AYW A;  3W99 D;  1H8M A;  2NZD D;  2B95 A;  1J9M A;  2K31 A;  5TBM B;  5KZH A;  1E6P A;  1VHM A;  4XUJ C;  1EI5 A;  4IBI A;  3NEC A;  2A24 B;  3MGS C;  1KX3 C;  5A91 A;  1P3M D;  3ZG8 B;  4ZUX C;  5I94 A;  3RTY A;  1XFN A;  4Z2K A;  2O9C A;  1G6O A;  4ZDX A;  3FWL A;  2M7V A;  4LD9 C;  2BYM A;  1ID3 D;  3CPT A;  1TS0 A;  4DF6 A;  2HIO C;  2F8N H;  1RGZ A;  5CPI A;  1IKI A;  4Z9Q A;  5AJG A;  3M2K A;  1MWT A;  5EUA A;  2D02 A;  3WA9 D;  3IX8 A;  3KUY D;  4LV2 A;  5EVI B;  2WZX A;  4C6Y A;  3AZF B;  5B1M C;  3NQJ A;  3IXB A;  5AVC D;  4KGC A;  5EVE A;  4CAY B;  5AY8 C;  2XRN A;  1P34 A;  2PR6 A;  4KZA A;  1MWU A;  3REK A;  4MEZ A;  5GHZ A;  3KXB B;  1HZO A;  4OVD A;  3WTP E;  2WUQ A;  2ZL1 A;  4UAA A;  3R4K A;  2F8N K;  3W2Z A;  5FEG A;  4XUZ A;  3KWQ B;  3T50 A;  1ALQ A;  4CJN A;  2EFX A;  3EQV A;  1GHI A;  2ZM0 A;  2ARO D;  4S2N C;  2NUP C;  3OC2 A;  3LZ0 A;  3NUL A;  5DNN C;  3WD3 A;  3A0R A;  2HDU A;  1VET A;  2Q9M A;  5B40 C;  4N9K A;  2XD1 A;  4LEN A;  1M19 C;  3IX3 A;  5G49 B;  3B6F A;  5FUG A;  5E2G A;  2H0T A;  3KWQ A;  3X1T B;  3AFA C;  2LY8 A;  3FKW A;  5BOH A;  4N92 A;  1D1J A;  4H9P A;  1W7F A;  5EVI A;  1K4F A;  4WU8 A;  4OPR A;  4LLO B;  3SS3 A;  1T1C A;  2EXA A;  3BFE A;  2JKR M;  3T4L A;  3F1N B;  1KDS A;  2ZQC A;  3VOL A;  3PHY A;  3REJ C;  3AZN D;  1P34 B;  5GLB A;  2XEP A;  1FIK A;  1E4D A;  4WU9 A;  4MN7 A;  4MCW A;  5EM0 A;  2WGW B;  3MGR A;  3UT9 D;  3WA9 B;  1ERM A;  5B0Z A;  3D9Y A;  1AOI C;  1YUE A;  5B24 B;  1PZR A;  2PU2 A;  3N4I A;  5AV5 B;  1KVL A;  2IO5 B;  2ZM5 A;  1AIW A;  3LZ1 D;  1PW8 A;  2W0N A;  3HVF A;  4RX3 A;  4AWL B;  3Q7Z A;  3V50 A;  3OLO A;  3O62 A;  5JRG C;  1ODV A;  1ONG A;  3UB8 A;  3FG8 A;  4Z2M G;  3HJI A;  3FYZ A;  3X1U A;  3AZM A;  1E15 A;  1GXD A;  1BZA A;  3G30 A;  5G49 A;  5FAP A;  3DW0 A;  3VE3 A;  5E5A C;  1W63 M;  2L1M A;  1CXW A;  1P3M B;  1MPL A;  4XT2 A;  5CPJ A;  3WRZ A;  1GSX A;  2O0Y A;  4BBT A;  3AV1 A;  1F9I A;  3AYW D;  4A5R A;  1MKI A;  2OLV A;  2WAE A;  4NKP A;  4IJF A;  1ED7 A;  1P9R A;  3MKF A;  4DDS A;  2PU4 A;  4H9R A;  3G35 A;  1TDG A;  3JYI A;  2WKH A;  3QP6 A;  3AZE A;  1D06 A;  1IEL A;  3LJA D;  3BEC A;  4WM9 A;  3A3D A;  1DJC A;  2Y4A A;  5CPK A;  4E3N A;  4H9R B;  2VV7 A;  2WK0 A;  5CHM A;  4GH9 A;  4CAY A;  3KUY C;  1NLZ A;  1YU2 A;  3AZG C;  4R23 A;  5DTT A;  3UTB A;  5AVC B;  2YFW A;  1M1A A;  5CPJ C;  4HY8 A;  2J3T C;  2RCX A;  5AY8 D;  5F82 A;  5GSU A;  1WE4 A;  4QU3 A;  3G6O A;  3HBR A;  5TGF A;  1M18 A;  3GTC A;  3W8K A;  4JJN B;  4BLM A;  1E6R A;  5B2J C;  4HJ3 A;  4BL3 A;  4YFM A;  1CEF A;  1N9B A;  1VEU A;  2WGI A;  2B5R A;  5E2H A;  4ZTK A;  3MS6 A;  1YLJ A;  5GXQ D;  4RA7 A;  2Y91 A;  3WD2 A;  3X1U C;  3AZM C;  4LGW A;  1AOI D;  3GR2 A;  1LHY A;  1GSW A;  1BSG A;  2H10 A;  3W99 A;  2Q9N A;  3LUQ A;  4MB5 A;  2YFW B;  2L0W A;  5JYP A;  1ESI A;  3MSH A;  2JN7 A;  4HI4 A;  5AQA A;  2PHY A;  4DJ2 A;  2EFU A;  3RXW A;  1XJ2 A;  4H9P B;  4HBT A;  1L0D A;  3ZHH A;  4DE1 A;  3REI D;  1OTB A;  5B0Z C;  4Z66 A;  3WTP A;  4KHA B;  3MGR C;  5C5K A;  2F2A C;  1YSP A;  2IO5 C;  5AV6 D;  3RH8 B;  2Y2O A;  2WZZ A;  3TU4 C;  3AFA D;  3MNN B;  2WAD A;  3LGO A;  5G4Z A;  3AGD A;  1F2K A;  4OPQ A;  4CLC E;  4OP8 A;  1YU1 A;  3UE3 A;  1TS7 A;  5CRF A;  3DTM A;  2OWH A;  2ZBB A;  3P98 A;  4HBU A;  3LY3 A;  4G91 B;  3NQU B;  3B0B A;  1T19 A;  4JGO A;  2VZW A;  1KE3 A;  1HVB A;  1U35 B;  4PM7 A;  4P0M A;  2OLU A;  3HLG A;  3AV2 D;  1W1Y A;  4L0L A;  3B6G B;  1Y54 A;  1YLY A;  2HJ9 C;  3MGS D;  1PFL A;  3BQ8 A;  2ZC3 B;  4IBD A;  5DNN A;  3MQO A;  1WYB A;  1M1A C;  3VH6 A;  4Z5T D;  1YQS A;  1HQ3 C;  3IWI A;  2ZL1 B;  5AQ7 A;  1EQZ D;  1ES3 A;  3C1B B;  4DE0 A;  1YT4 A;  2Y2J A;  2INW A;  3T12 B;  4FSF A;  5CPK C;  2D49 A;  2Z2M B;  3R45 B;  3KUY B;  3LI8 A;  4WU8 C;  1W63 Q;  1P3F A;  3U2A A;  4KGC C;  1ZTU A;  3KWQ C;  2V20 A;  3Q7V B;  1BYW A;  3G4P A;  4JXV A;  5E2F A;  3WS0 A;  1FOF A;  3W4P A;  3AZK C;  2ARO A;  4S2L A;  4NK3 A;  2YFV B;  1OGG A;  5EPH A;  1YU0 A;  4WN5 A;  1Q2Q A;  3M6H A;  1XGJ A;  3EOI A;  1TF1 A;  1P3K C;  1XFQ A;  5GT3 D;  4L9G A;  3MVD D;  3LIF A;  1BH9 A;  4J8W C;  1W1T A;  2VGK A;  5HPI A;  5B1L A;  3PBN A;  4IBE A;  2VV8 A;  4MBF A;  4IED A;  2EX8 A;  5B32 A;  2PBY A;  3REK C;  3C1B A;  1EW0 A;  1P34 C;  5BNV A;  4R38 A;  2IOU A;  4LD9 D;  5CED A;  2NZD B;  2PT7 A;  1KX3 A;  5B2J D;  5HAQ A;  1FCN A;  3F6T A;  3IWO A;  4KUD B;  4HJ6 A;  4B93 A;  1NZO A;  4UEY A;  5HDC A;  3LCE A;  3S7P A;  2W1T B;  1PI4 A;  2J9O A;  1KGF A;  1IKG A;  1OTD A;  3R7W A;  4J8V C;  2VEA A;  3K3C A;  3LR3 A;  4P6Z S;  3KFU G;  2MJ6 A;  2P9V A;  5CP6 B;  3AZN C;  1RGY A;  1HQ3 D;  3CUE A;  1P3B B;  2VK3 A;  5GT0 C;  5C3I C;  3C38 A;  1YLP A;  2W8S A;  4DRA A;  3BJN A;  4H9S C;  3MMH A;  3OPH A;  4JLF A;  1MBL A;  3SS4 A;  4PMA A;  4ZUX A;  4JBF A;  4NE5 A;  4X23 B;  3WS1 A;  3LR5 A;  4S2N A;  2P08 A;  5HFO A;  5B31 D;  3VSK A;  5EFW A;  1CJF A;  4PM9 A;  5CP6 A;  3G2Z A;  3TW8 A;  5AQB A;  2XA7 S;  5A93 A;  4WEL A;  1I2S A;  1FCO A;  3IXG A;  5F99 C;  3HLE A;  4YS3 A;  2JC7 A;  5E5A D;  4D2O A;  1YPR A;  5BO0 A;  2BYM B;  3HUO A;  4DJ3 A;  1XA1 A;  4H6J A;  4JJN A;  5A92 A;  3SH9 A;  3KSY A;  3TOI A;  1F66 D;  5FAQ A;  1YSQ A;  2ZC7 A;  1LL5 A;  1A7W A;  1CQA A;  1L0E A;  2ZQ9 A;  3VV4 A;  3EPH A;  3S1Y A;  1JWV A;  2PDR A;  3CAX A;  1SDE A;  5F99 B;  5GLD A;  1Z09 A;  5B2I C;  3ZG0 A;  3WKJ B;  4LRY C;  4S2J A;  2HIO B;  2YKF A;  5GLC A;  2EXB A;  1W1V A;  3W98 B;  5FQQ A;  3O62 B;  3KO6 A;  4DE2 A;  3HON A;  5HW3 A;  1MY8 A;  3A6N D;  1GHP A;  1DP9 A;  3JVU A;  3N8S A;  4QY5 A;  5B0Y B;  4JKT A;  4J8V D;  3IHA A;  1H0M A;  3LEL D;  4B4Z A;  4Z5T A;  1SKO A;  3UMD A;  4DRB A;  4NYY A;  3GEC A;  4H9O A;  5CPJ D;  3IBJ A;  4JF6 A;  1STZ A;  5FI2 A;  3MXR A;  3AV1 B;  5DF7 A;  4EW7 A;  1KX4 B;  4KUD C;  4I38 A;  1OT9 A;  4PM8 A;  1M40 A;  2ZMF A;  2QYB A;  3BWL A;  3A3E A;  5B32 D;  3UPP A;  5B2I A;  1S4R A;  4WL9 A;  3C4O A;  1P3L C;  1QMF A;  1KDW A;  5I5L A;  1S1Y A;  1UGU A;  3WD1 A;  3X1V C;  3E2K A;  2Q0O A;  2NZD C;  1MXO A;  3EWK A;  4Z5T C;  5B0Z D;  1O07 A;  3CHW P;  3RJU A;  3REH B;  1S4S A;  2FFY A;  5B2I B;  5CPI B;  2C5W B;  1O7E A;  2W3G A;  1YAX A;  4JGR A;  3CJM A;  5DTK A;  3S7O A;  4WV4 B;  3DBA A;  3IWQ A;  5HD5 A;  2WKR A;  5M1A A;  4WMC D;  4M6B A;  5M18 A;  3W96 D;  3AZE D;  2BG1 A;  3L28 A;  1K55 A;  1H5X A;  1M18 D;  2Y2H A;  1KOU A;  2ARO C;  2ZMA A;  4WU8 B;  4XT2 B;  5GLA A;  5B2J B;  3HLF A;  4PKY G;  2CV5 C;  1EWZ A;  4JJN C;  3G2Y A;  1NRJ A;  3KXB A;  3N7W A;  2HIO D;  1L0F A;  2WAF A;  5BNX B;  4HJ4 A;  3W98 A;  4G3V A;  1P3K D;  3AZL D;  3WTP B;  4Z66 B;  4KGC B;  3AZE B;  3FKE A;  5HX9 A;  1H3O A;  3IH9 A;  3ZDJ A;  3MVD B;  1CEG A;  1QME A;  1HQ3 A;  3W96 C;  4E3L A;  4X23 C;  3REH A;  1UWN X;  3X1S B;  1L0G A;  3PR6 A;  5HAP A;  3C7V A;  3MZE A;  2VQR A;  4GNU A;  3KSH A;  1ES5 A;  1MZU A;  3VP3 A;  1P3P A;  1FIL A;  4BD0 A;  4KZ9 A;  3H0R C;  3HLC A;  4ETX A;  4HQA A;  3PBT A;  3UTA D;  4J8W A;  3AZN A;  4R8P A;  4CSR B;  1KX3 D;  2M1C A;  4Y7P A;  5AV8 D;  2VLG A;  1KU5 A;  3N8R A;  1P3K A;  2L4R A;  2Y2G A;  3AV2 C;  2ZLY A;  3UDF A;  1H8Y A;  2VGJ A;  5GT3 C;  1PWG A;  1QO6 A;  3VP1 A;  4GB7 A;  4K0X A;  3B0D B;  3BFD A;  4R3B A;  1WWS A;  3A1I A;  3A0S A;  4U3T A;  5E2E A;  4GD8 A;  3WD4 A;  5FSR A;  3X1S A;  2DMW A;  5AVB C;  2PBD P;  2QMI A;  4KZ7 A;  2IWD A;  4KUD D;  4NE6 A;  4J8X B;  1Q2P A;  3GMW A;  4GD6 A;  2DCF A;  3W99 C;  4IBR A;  4MNR A;  5CGS A;  2JKG A;  4DQY B;  1ZKJ A;  4OJO A;  3W98 D;  1JTG A;  3LZ1 A;  1NXY A;  2G7U A;  1CI9 A;  3JPU A;  3MNN A;  1PYY A;  3WS4 A;  5AV8 B;  5F99 D;  3EGX C;  3NCK A;  5DKK A;  1U35 A;  2JKF A;  4KHA A;  3MXQ A;  5DNM C;  3LID A;  5DFY A;  2RTS A;  5FDS A;  2IWB A;  4ARZ B;  3IXD A;  5HD3 A;  1PZO A;  5JRG D;  1JFI B;  3HLB A;  3LJA A;  2BAS A;  4OPZ A;  4L9F A;  2PYO C;  1N4O A;  4I5S A;  1OJ5 A;  5AVB D;  3PAE A;  5B2I D;  2CMN A;  3PBQ A;  1KX4 D;  2K2N A;  1P3I C;  3T1S A;  3AV1 D;  2JKT I;  2Y2N A;  3F1P A;  3FDD A;  1BUE A;  2HPB A;  4CLC B;  3BLM A;  4UUZ B;  4GZB A;  4R3J A;  4UA9 A;  5B31 B;  3BYD A;  4DRT A;  1SCW A;  3KS4 A;  5L09 A;  4OLG A;  1M1A B;  1RP5 A;  5HAI A;  4BD1 A;  2Y59 A;  4NXF A;  4Z66 C;  3WTP C;  3AZH A;  1JFI A;  5FQJ A;  3CG5 A;  3UB6 A;  3R45 A;  3WWX A;  1W2E A;  3B3X A;  4MB3 A;  3B6G C;  1HQ3 B;  1VEU B;  4II7 A;  4EWF A;  3WKJ D;  5CX7 A;  4J8X D;  4F3L B;  3Q1F A;  1F5M A;  3T4T A;  1NJ4 A;  1N9L A;  4H8R A;  2VA0 A;  3H0L C;  4MBH A;  3C1C B;  1DRM A;  4ZJ1 A;  5KSH A;  1OTE A;  1TD5 A;  5F6A A;  1ERQ A;  2ZOH A;  4ZBJ B;  1A0K A;  1S1Z A;  2WKQ A;  4CPK A;  3ZG7 B;  1P3A D;  4NXE A;  3TU4 A;  4HOI A;  4LD9 B;  4X1M A;  3S22 A;  3REJ B;  1OTI A;  1NLY A;  1G5U A;  5AV5 C;  3DAV A;  2ZOI A;  5G4Y A;  3KSG A;  1XJ4 A;  3E98 A;  1R4V A;  3REJ A;  4KEN B;  3VP4 A;  5FA7 A;  3X1U B;  3AZM B;  2K7S A;  5CER A;  5GT3 B;  4CLC D;  1P3G B;  4ARZ A;  5B32 B;  1P3I D;  3OBF A;  4MB4 A;  3SS5 A;  1PRQ A;  1S0W A;  4OKP A;  1W5D A;  2PYO A;  3MQL A;  4LPZ A;  3RXX A;  1KX4 C;  1PI5 A;  1K4E A;  5B2J A;  3LJA C;  3V9R B;  2A49 A;  5GSU C;  4I3J A;  3UPN A;  3ZG9 B;  5AV5 D;  2PR5 A;  4HMC A;  1MC0 A;  1BLC A;  4Z66 D;  3WTP D;  5E5A A;  2OSU A;  1FSW A;  2X71 A;  4HH2 A;  4XUX A;  2ZQ7 A;  3E0Y A;  3OZH A;  5FQI A;  3UY6 A;  5JYO A;  1N1J B;  4H9O B;  4OJ5 A;  4HNB A;  4GKU A;  4IJG A;  4G92 C;  1E6N A;  3O62 C;  2B02 A;  4JXS A;  2NQB B;  3NIA A;  2GX5 A;  3X1S C;  4JXG A;  4P87 A;  2ZY2 A;  3AZE C;  5L07 A;  3ZNY A;  3W96 B;  5B1M A;  3G34 A;  3H7W B;  2A3U A;  2PYO D;  1TZY D;  2X02 A;  3VP2 A;  3ZVT A;  4R1G A;  4WU9 C;  3LIC A;  5GT3 A;  2I9V A;  1MWS A;  2V1B A;  5JA4 B;  3LYX A;  2OOL A;  3EEA A;  5CTN A;  4M4X A;  1LLB A;  4E45 A;  3VH6 W;  1JWP A;  3OPP A;  4RX2 A;  4WUJ A;  1P3O A;  3NDG A;  3KWQ D;  4LRX C;  5EVI C;  3CIT A;  1BT5 A;  3T4J A;  5CGW A;  2Z6C A;  5DFX A;  2QJ7 A;  4LD9 A;  2DF4 C;  3B0D C;  2ZC6 B;  2HV1 A;  1XXM A;  3MGQ A;  3P5J B;  4Z1W A;  5B40 A;  3MGP C;  3T1R A;  5GHY A;  5B24 C;  3L2A A;  3QP1 A;  3B6F D;  2ZY4 A;  4I3I A;  2KLI A;  3LZ0 C;  1DJB A;  3REI B;  3MZD A;  1P0Z A;  3KSF A;  5J4E A;  4J8X C;  4K0W A;  3LY4 A;  4ME4 A;  1AOI A;  4ZJ2 A;  3C1B D;  4KZ5 A;  3REH C;  3W96 A;  1L3L A;  1HTZ A;  3CWF A;  3MF0 A;  3EPJ A;  3BQA A;  5GXQ B;  3FV7 A;  3LFV A;  5B31 G;  3MBZ A;  1NYY A;  2YFV A;  1S67 L;  3ITB A;  4XUJ B;  2KOI A;  1WYC A;  4KZ6 A;  4UA7 A;  1NRF A;  3E4P A;  3AFA A;  3IP4 C;  4QJG A;  3VH5 A;  5B40 B;  2CV5 A;  3B6F C;  3UN7 A;  4KQQ A;  3NY4 A;  3WS2 A;  3AZL C;  5AV9 B;  1BUL A;  4Y0T A;  1G28 A;  1HTA A;  4IBB A;  4P6Z M;  2RL3 A;  3IF6 C;  5F83 A;  2JSS A;  4H9Q B;  4CLC C;  4E04 A;  1IYP A;  1LI0 A;  4ZJ3 A;  3QP4 A;  2XH9 A;  1N9N A;  1PW1 A;  5HL1 A;  4QB8 A;  1GPF A;  2J80 A;  3A6N C;  5DNN D;  3B42 A;  5CEC A;  1LSV A;  3WD0 A;  3A3J A;  4QY6 A;  1P3O D;  2V5O A;  3ZGA B;  4R4S A;  4S2P A;  4O7D A;  4H6J B;  1M19 D;  4LCM A;  3HLW A;  3C30 A;  4PM5 A;  5L10 A;  3AL0 C;  4YS3 B;  4JF4 A;  4H9N B;  3REL D;  2V2F F;  1LSW A;  2ZMV A;  4PAU A;  3FPV A;  4EUV A;  5AV8 C;  3MGS A;  3T4S A;  4Y5F A;  1KS0 A;  5AV6 B;  3AZF A;  1XJ6 A;  2GZA A;  4LG2 A;  2VGL M;  3IF6 B;  4FCF A;  1ACF A;  1J7M A;  3ZNT A;  5AV9 C;  3AYW C;  4KUD A;  4GHL A;  4JPM A;  4IVK A;  3HSH A;  5CPI C;  4WJ3 C;  3O3V A;  3MGQ D;  1TZY A;  1E6Z A;  1P3L D;  3RFB A;  3P7N A;  5DVA A;  1TAF A;  1XJ3 A;  4EES A;  4ESP A;  3BEB A;  4NEE D;  1YLT A;  3PBS A;  1S6R A;  5FQ9 A;  3UT9 B;  4X56 A;  3EEH A;  4Z2G A;  2KX6 A;  2XF3 A;  3WAA D;  4OJL A;  4GHI A;  2HJE A;  3AZN B;  2J3W A;  4J8U B;  1P3F B;  3NOU C;  4ZUX B;  4J8W D;  4KUO A;  2HP9 A;  5HL6 A;  2VJW A;  2KDK A;  2P04 A;  3AZJ A;  4IBX A;  1LL8 A;  3FKV A;  5B1L D;  3GSG A;  4X55 A;  3AZL A;  1PDC A;  3A3I A;  3IX4 A;  5FI7 A;  1KX5 A;  4X69 A;  5CGX A;  3GDI A;  3ICY A;  1PWD A;  2OV5 A;  4NZ5 A;  4EEP A;  3REI C;  2QHK A;  3REL A;  3AYW B;  1W1P A;  1OT6 A;  1P97 A;  3LZ0 B;  1D7E A;  2VX8 A;  5E43 A;  3AZG D;  1T3U A;  1DY6 A;  1ESU A;  1F98 A;  5B33 B;  4KZ8 A;  3MKE A;  1K56 D;  4ETZ A;  4OH0 A;  4E6W A;  2NQB C;  2Z2L B;  3N3F A;  1P3B D;  2WKE A;  4EBL A;  4G92 B;  1HD8 A;  3UTA A;  3E4O A;  5HAR A;  4WLA A;  1W79 A;  5B24 A;  1U60 A;  5FQM A;  3H82 B;  3MGQ C;  3Q82 A;  3AZH D;  5A8B A;  3MQQ A;  3AZG B;  3BLS A;  3EPL A;  3VMA A;  2XFS A;  3W97 C;  3F1N A;  5GSU B;  4WF0 A;  1P3O C;  3HCY A;  1XX2 A;  4Y13 A;  3C5A A;  4GHA A;  5EV0 A;  3L9K A;  3O5Y A;  4FH2 A;  1EQZ C;  1KVM A;  5B0Y A;  5TFQ A;  2WGW A;  2J9P A;  3UE1 A;  4OLD A;  1LI9 A;  5DTS A;  3LIB A;  3C1B C;  4FD8 A;  5B32 C;  2PYO B;  5CTM A;  2OWJ A;  1E25 A;  1FR6 A;  2FN2 A;  1NYM A;  1V9Z A;  3JVV A;  5B1L C;  3DWZ A;  3KXB D;  1W8Q A;  5AVE A;  5IS1 A;  5FAO A;  4UA6 A;  1AWI A;  4PM6 A;  1AXB A;  5GHX A;  3IBR A;  1ZG6 A;  1BLH A;  3AZK D;  5BT1 C;  3HUM A;  2PD7 A;  1CK7 A;  2GNX A;  5B40 D;  3AGF A;  3BFF A;  4NG2 A;  4OJP A;  5EVI D;  2WYX A;  2CWE A;  5GSU D;  1LL9 A;  3CMZ A;  4JXW A;  3AZK A;  4RYE A;  2XR0 A;  3CI6 A;  3BRM A;  1ZLA C;  4GCZ A;  3TU4 B;  1S32 C;  5D3O A;  2V0W A;  2ZQ8 A;  2H0Y A;  4QLC C;  4Y15 A;  4Z2J A;  4EXO A;  1OGB A;  1L2S A;  1TS6 A;  2HP5 A;  3B47 A;  1NZU A;  1IYS A;  3AZK B;  3QP2 A;  2W3H A;  1N9O A;  4E3K A;  5KDM A;  3OCL A;  5GL9 A;  2QZ6 A;  3U4L P;  3T1Q B;  2R78 A;  3UTB B;  4O01 A;  4IBJ A;  2XSS A;  5B31 A;  2WKP A; 
#chains in the Genus database with same CATH homology
 3C7U A;  3MVD A;  3WA9 A;  4IJE A;  1CI8 A;  2ZY3 A;  2FFF B;  3AZI A;  4QNL A;  3LEL C;  1G68 A;  1KE0 A;  4OOY A;  4E3J A;  2GDN A;  3MFD A;  2BYK A;  5B31 C;  1F1E A;  5BT1 D;  4NYU A;  1KX5 D;  2NQB D;  3MXS A;  3AN2 A;  3X1T A;  3ZG5 A;  3AZF D;  2F8N G;  5EOO A;  3D4F A;  3FZC A;  3IXH A;  2XK1 A;  1E3U D;  4XXR A;  1P3M C;  4IBG A;  1P3G C;  1CK3 A;  4YM6 C;  4AWL C;  3CZD A;  4X68 A;  2F8N A;  4NE3 A;  1P3A A;  1F66 C;  3NQU A;  3HRE A;  3AZI C;  1FQG A;  3C1C A;  3AZJ B;  4NFT A;  1RCJ A;  1S32 A;  3GVB A;  5AVB B;  3P09 A;  1KX5 B;  3OPR A;  5JRG B;  3X1U D;  3AZM D;  3Q07 A;  3X1T D;  3AZI B;  4GN2 A;  3W4Q A;  1YM1 A;  1JWZ A;  5EVL A;  4E44 A;  5DNM D;  3C1C C;  4WZ4 A;  3EPK A;  4OQI A;  1F66 A;  3L26 A;  1P3F D;  1M19 B;  5AVC C;  3VH5 W;  4QD4 A;  1P3G A;  1P3P B;  2FJ7 A;  5DNN B;  4UUZ A;  1K57 C;  3UO9 A;  4BQM A;  2G5I C;  1ZLA D;  3HLD A;  3AV1 C;  5AVB A;  3M6B A;  4YIN A;  1TZY B;  5CHL B;  2FJ7 B;  1TAF B;  1K56 A;  1EQZ A;  2P9V B;  3AN2 C;  4QHC A;  1ZLA A;  3AZH B;  1P3B A;  5CXW A;  4WNN B;  2HDQ A;  5AV9 D;  5AV6 A;  3W97 A;  3MGQ B;  5BPV A;  3MZF A;  2XD5 A;  4WNN A;  3ZCZ A;  1I5Q A;  5JRG A;  3LEL A;  4HES A;  2JBF A;  5BS7 C;  5B33 D;  1BLS A;  3H0M C;  1M1A D;  1K6S A;  3UTA C;  5A90 A;  3MVD C;  2I72 A;  5BNV B;  5B24 D;  4DXB A;  3LZ0 D;  1P3P C;  4H9N A;  4B4X A;  4WEJ A;  2F8N B;  3QNC A;  3BFG A;  4WZ5 C;  5G18 A;  1TDL A;  4X23 A;  4F94 A;  3VFH A;  1KX5 C;  4QLC A;  3SOI A;  4DE3 A;  4C75 A;  4BJP A;  4OQH A;  1FCM A;  3C4P A;  3AZJ C;  5IHV A;  4J8U D;  4DDY A;  3B0C W;  4QLC D;  2L5A A;  2NQB A;  3WAA B;  3QNB A;  3IH8 A;  1H8Z A;  2ZD8 A;  4KQR A;  3VFF A;  3HL9 A;  1NY0 A;  3X1V B;  1GA0 A;  2WKI A;  3G31 A;  5M19 A;  1BFM A;  1ID3 A;  4E3O A;  5FAS A;  3PBR A;  5AY8 A;  2RVQ C;  1P3L B;  4EV4 A;  3REH D;  3WAA C;  1ZG4 A;  2E8I A;  4J8U C;  1JTD A;  3EG5 B;  1MWR A;  5B1M D;  2HDR A;  3X1V A;  5TR7 A;  1S32 D;  3A3F A;  5B0Y C;  1GCE A;  1ZC2 A;  5BO0 B;  3B0C T;  3UT9 C;  2G5H C;  4M3K A;  2HIO A;  1P3L A;  1YMX A;  4EO5 B;  3VP0 A;  4B88 A;  3UDX A;  3OPL A;  1PWC A;  3IT9 A;  2ZC4 B;  1ID3 B;  1ERO A;  5AV8 A;  2BLS A;  1P3O B;  3UNW A;  1ULY A;  5KSC A;  4WU9 B;  2R9X A;  3NQJ B;  4BL2 A;  5CHJ A;  3A1K A;  1G6A A;  3SH7 A;  5DF9 A;  2ZM8 A;  2CV5 B;  4IBF A;  4IBK A;  3NI9 A;  2XDM A;  4OJ6 A;  3A6N B;  4NZ3 A;  4IVI A;  3W99 B;  3LO7 A;  3MGR D;  3O62 D;  3UT9 A;  5AV9 A;  3W4O A;  4Y0U A;  4XUJ D;  4J8U A;  2X01 A;  3WAA A;  2ZY5 A;  1BTL A;  4WBG A;  5GT0 B;  5GXQ A;  1IYQ A;  1ONH A;  4BEN A;  5CPI D;  5F99 A;  1IYO A;  2XLN A;  4XZQ D;  2G2U A;  1KX3 B;  5CP6 C;  3IHB A;  4KZ3 A;  3MGP B;  3VH5 T;  3REL B;  2ZQD A;  4E3M A;  4DKI A;  4HGA C;  3IF6 A;  5GXQ C;  2EX2 A;  4GDB A;  3SH8 A;  4H9S A;  3ITA A;  3MGP A;  3REJ D;  3REK D;  2HUE C;  4WEK A;  5GT0 A;  5CPK D;  5FQK A;  4S2I A;  1K25 A;  3X1S D;  3WX7 A;  3V5M A;  4ZBJ C;  4GOG A;  2WGV A;  1B6W A;  3W97 D;  2XQZ A;  4X53 A;  2JCH A;  2RVQ D;  5CEB A;  1K6R A;  3AZF C;  2BYK B;  4CSR A;  3L25 A;  3WKJ C;  2ZQA A;  5F1G A;  4EUZ A;  3N8L A;  3OCN A;  4YM6 D;  4N9L A;  1ID3 C;  2EX9 A;  1KE4 A;  3VSL A;  3UTA B;  4HEF A;  4LV1 A;  2IWC A;  3UPO A;  1PIO A;  5FUG B;  2RIQ A;  1C3B A;  4N1X A;  1I2W A;  4LV3 A;  3PTE A;  5EE8 A;  3B6F B;  1KX4 A;  3GQZ A;  5BNX A;  4OQ0 A;  2G2W A;  4X23 D;  1SDN A;  4KGC D;  5AVC A;  3AN2 B;  4U0X A;  3AZL B;  1P3F C;  3UDI A;  4WZ5 A;  5J8X A;  4XZQ B;  1P3A B;  4R8P D;  4C3Q A;  4ID4 A;  5AV5 A;  4WMC A;  3DWK A;  1YLW A;  1ES2 A;  3BM6 A;  4J8X A;  5KMW A;  4K91 A;  5B0Y D;  2FJ7 D;  2XGN A;  1P3K B;  4JF5 A;  5BS7 A;  5L2F A;  4YM6 B;  3V39 A;  4S2M A;  3V3S A;  2UWX A;  3WS5 A;  5DF8 A;  5B0Z B;  4YM6 A;  1P3M A;  5AV6 C;  1M18 B;  2V1Z A;  4P85 A;  3B6G A;  1GA9 A;  3AFA B;  3X1T C;  4WU9 D;  4EBP A;  1PZP A;  1K57 A;  4NY2 A;  4XZQ A;  5CPK B;  2Y2M A;  1BLP A;  2F8N D;  1P3I B;  4FH4 A;  4LCL A;  5CPJ B;  4H9Q A;  1P3G D;  5GT0 D;  1VM1 A;  2JE5 A;  3L27 A;  1WWI A;  3LEZ A;  1XGI A;  3LEL B;  1OME A;  4NZ1 A;  3MGP D;  5AQ9 A;  1P3B C;  1M18 C;  4RVA A;  4S2O A;  5AY8 B;  5DNM A;  3NDE A;  4WU8 D;  3UTB C;  4R0Q A;  3AZH C;  1U35 C;  2CV5 D;  3TG9 A;  3TSG A;  3AZG A;  1XP4 A;  1Q9C A;  3MNN C;  3NBL A;  2FJ7 C;  3C1C D;  3LZ1 C;  5B33 C;  3KUY A;  5B33 A;  3X1V D;  4IBC A;  2XFT A;  3S4X A;  1ZLA B;  1N1J A;  3QHY A;  4G91 C;  4R8P B;  4QLC B;  3MGR B;  4NET A;  3ZVW A;  3REK B;  3EQU A;  5KDM B;  3O86 A;  4DXC A;  2ZC5 B;  4U0T A;  2H5S A;  3UTB D;  4LV0 A;  3AN2 D;  5EOE A;  1F66 B;  2J8Y A;  1YMS A;  2DNS A;  3MNN D;  4HGA B;  4MLL A;  4ZBE A;  1S32 B;  2Y55 A;  3Q81 A;  3BFC A;  4OOL A;  3WA9 C;  1P3A C;  4P6B A;  1B67 A;  4R8P C;  4XZQ C;  4UPK A;  2J7V A;  3G32 A;  4WZS B;  2HDS A;  1SHV A;  3TU4 D;  1DJA A;  5U47 A;  3ZFZ A;  1H3O B;  2Y2K A;  4R4R A;  3N6I A;  3VH6 T;  1KGG A;  3WRT A;  3ISG A;  1EQZ B;  2Y2Q A;  2QPN A;  3W98 C;  5FAT A;  3VOZ A;  1P3I A;  2P74 A;  3KXB C;  3W97 B;  4Q8I A;  3E2L A;  4UHU A;  1Z2C B;  1JVJ A;  1M19 A;  1XPB A;  2Y2I A;  4OP5 A;  4ZAM A;  5E5A B;  3V9R A;  1YU4 A;  5DNM B;  4KG5 A;  3GV9 A;  1W8Y A;  4KQO A;  1YU3 A;  2CC1 A;  4OON A;  1TEM A;  4KG6 A;  3L29 A;  1YLZ A;  4EQI A;  5C3I B;  2R9W A;  5EEC A;  3M2J A;  5B32 G;  1XA7 A;  4Z5T B;  1IEM A;  1K55 C;  3LZ1 B;  2DQN C;  1AOI B;  3GRJ A;  3AV2 A;  2EX6 A;  1BH8 A;  1TVF A;  3AV2 B;  2C6W B;  1FR1 A;  1P34 D;  3PAG A;  3WKJ A;  2Y2P A;  1FSY A;  3VOY A;  1ES4 A;  3O87 A;  1BH9 B;  1VQQ A;  4PPR A;  4GDN A;  5B1L B;  1SKF A;  4X6T A;  4Y0O A;  4S2K A;  4N1H A;  5FI6 A;  4KZ4 A;  3KS8 A;  3REI A;  3HUN A;  4ZUX D;  4J8W B;  3B6G D;  1BH8 B;  4XUJ A;  5CHU A;  1P3P D;  3NC8 A;  2ARO B;  2ZM2 A;  1M6K A;  2ZJ9 A;  3Q7V A;  1K38 A;  5JA4 A;  2J8P A;  3I7J A;  4YS3 C;  4OOM A;  2DRW A;  4EO5 C;  4OUI A;  3PBO A;  3AZI D;  4E6X A;  3A6N A;  3AGE A;  1KGE A;  5B1M B;  4MBK A;  1K54 C;  4JJN D;  4E3I A;  2HUE B;  2Y2L A;  1E3U A;  4EBN A;  5FDH A;  3AZJ D;  5CP6 D;  1K54 A;  3REL C;  4KZB A;  3IQA A;  5F1F A;  3IF5 A;  4OQG A;  4J8V B;  4KG2 A;  4WYY A;  1GHM A;  4YS3 D;  2NZD A;  3O88 A;  4OPY A;  1XKZ A;  4Z2M H;  3V3R A;  3MGS B;  2HP6 A;  1TZY C;  4NZ4 A;  3UE0 A;  4J8V A;  3LJA B;  1Z6F A;  1U35 D;  3AYW A;  3W99 D;  2NZD D;  1J9M A;  5KZH A;  4XUJ C;  1EI5 A;  4IBI A;  3MGS C;  1KX3 C;  5A91 A;  1P3M D;  3ZG8 B;  4ZUX C;  5I94 A;  4ZDX A;  3FWL A;  4LD9 C;  2BYM A;  1ID3 D;  4DF6 A;  2HIO C;  2F8N H;  1RGZ A;  5CPI A;  1IKI A;  4Z9Q A;  3M2K A;  1MWT A;  5EUA A;  3WA9 D;  3KUY D;  4LV2 A;  5EVI B;  2WZX A;  4C6Y A;  3AZF B;  5B1M C;  3NQJ A;  3IXB A;  5AVC D;  4KGC A;  4CAY B;  5AY8 C;  1P34 A;  4KZA A;  1MWU A;  3REK A;  4MEZ A;  5GHZ A;  3KXB B;  1HZO A;  4OVD A;  3WTP E;  2WUQ A;  4UAA A;  2F8N K;  4XUZ A;  3KWQ B;  1ALQ A;  4CJN A;  2EFX A;  3EQV A;  1GHI A;  2ZM0 A;  2ARO D;  4S2N C;  3OC2 A;  3LZ0 A;  5DNN C;  2HDU A;  2Q9M A;  5B40 C;  4N9K A;  2XD1 A;  4LEN A;  1M19 C;  5G49 B;  3B6F A;  5FUG A;  5E2G A;  2H0T A;  3FKW A;  3X1T B;  3AFA C;  2LY8 A;  3KWQ A;  5BOH A;  4N92 A;  4H9P A;  1W7F A;  5EVI A;  1K4F A;  4WU8 A;  4OPR A;  3SS3 A;  2EXA A;  3BFE A;  1KDS A;  2ZQC A;  3REJ C;  3AZN D;  1P34 B;  5GLB A;  2XEP A;  1E4D A;  4WU9 A;  2WGW B;  3MGR A;  3UT9 D;  3WA9 B;  1ERM A;  5B0Z A;  1AOI C;  1YUE A;  5B24 B;  1PZR A;  2PU2 A;  3N4I A;  5AV5 B;  1KVL A;  2IO5 B;  2ZM5 A;  3LZ1 D;  1PW8 A;  3HVF A;  4RX3 A;  4AWL B;  3Q7Z A;  3V50 A;  3O62 A;  5JRG C;  1ONG A;  4Z2M G;  3FYZ A;  3X1U A;  3AZM A;  1BZA A;  3G30 A;  5G49 A;  5FAP A;  3DW0 A;  5E5A C;  1P3M B;  1MPL A;  5CPJ A;  3WRZ A;  3AV1 A;  3AYW D;  4A5R A;  1MKI A;  2OLV A;  2WAE A;  4IJF A;  3MKF A;  4DDS A;  2PU4 A;  4H9R A;  3G35 A;  1TDG A;  3JYI A;  2WKH A;  3AZE A;  1IEL A;  3LJA D;  3BEC A;  4WM9 A;  3A3D A;  1DJC A;  2Y4A A;  5CPK A;  4E3N A;  4H9R B;  2WK0 A;  5CHM A;  4GH9 A;  4CAY A;  3KUY C;  1YU2 A;  3AZG C;  4R23 A;  5DTT A;  3UTB A;  5AVC B;  2YFW A;  1M1A A;  5CPJ C;  2RCX A;  5AY8 D;  5F82 A;  5GSU A;  1WE4 A;  4QU3 A;  3HBR A;  5TGF A;  1M18 A;  3GTC A;  3W8K A;  4JJN B;  4BLM A;  5B2J C;  4BL3 A;  4YFM A;  1CEF A;  1N9B A;  2WGI A;  2B5R A;  5E2H A;  4ZTK A;  1YLJ A;  5GXQ D;  4RA7 A;  2Y91 A;  3X1U C;  3AZM C;  1AOI D;  3GR2 A;  1LHY A;  1BSG A;  2H10 A;  3W99 A;  2Q9N A;  2YFW B;  5JYP A;  1ESI A;  5AQA A;  2EFU A;  3RXW A;  4H9P B;  4HBT A;  1L0D A;  3ZHH A;  4DE1 A;  3REI D;  5B0Z C;  4Z66 A;  3WTP A;  4KHA B;  3MGR C;  2F2A C;  2IO5 C;  5AV6 D;  2Y2O A;  2WZZ A;  3TU4 C;  3AFA D;  3MNN B;  2WAD A;  3AGD A;  4OPQ A;  4OP8 A;  1YU1 A;  3UE3 A;  5CRF A;  3DTM A;  3P98 A;  4HBU A;  3LY3 A;  4G91 B;  3NQU B;  3B0B A;  4PM7 A;  1KE3 A;  1HVB A;  1U35 B;  4P0M A;  2OLU A;  3HLG A;  3AV2 D;  4L0L A;  3B6G B;  1Y54 A;  1YLY A;  3MGS D;  2ZC3 B;  4IBD A;  5DNN A;  1WYB A;  1M1A C;  3VH6 A;  4Z5T D;  1YQS A;  1HQ3 C;  3IWI A;  5AQ7 A;  1EQZ D;  1ES3 A;  3C1B B;  4DE0 A;  1YT4 A;  2Y2J A;  4FSF A;  5CPK C;  2Z2M B;  3R45 B;  3KUY B;  4WU8 C;  1P3F A;  4KGC C;  3KWQ C;  2V20 A;  3Q7V B;  3G4P A;  4JXV A;  5E2F A;  3WS0 A;  1FOF A;  3W4P A;  3AZK C;  2ARO A;  4S2L A;  4NK3 A;  2YFV B;  5EPH A;  1YU0 A;  1Q2Q A;  3M6H A;  1XGJ A;  1P3K C;  5GT3 D;  3MVD D;  1BH9 A;  4J8W C;  2VGK A;  5B1L A;  3PBN A;  4IBE A;  4MBF A;  4IED A;  2EX8 A;  5B32 A;  2PBY A;  3REK C;  3C1B A;  1P34 C;  5BNV A;  2IOU A;  4LD9 D;  5CED A;  2NZD B;  1KX3 A;  5B2J D;  5HAQ A;  1FCN A;  3F6T A;  3IWO A;  4KUD B;  1NZO A;  3LCE A;  1PI4 A;  2J9O A;  1KGF A;  1IKG A;  4J8V C;  3KFU G;  2P9V A;  5CP6 B;  3AZN C;  1RGY A;  1HQ3 D;  1P3B B;  5GT0 C;  5C3I C;  1YLP A;  2W8S A;  4DRA A;  4H9S C;  3OPH A;  4JLF A;  3SS4 A;  1MBL A;  4PMA A;  4ZUX A;  4JBF A;  4NE5 A;  4X23 B;  3WS1 A;  4S2N A;  5HFO A;  5B31 D;  3VSK A;  4PM9 A;  5CP6 A;  3G2Z A;  5AQB A;  5A93 A;  4WEL A;  1I2S A;  1FCO A;  3IXG A;  5F99 C;  3HLE A;  4YS3 A;  2JC7 A;  5E5A D;  4D2O A;  5BO0 A;  2BYM B;  3HUO A;  1XA1 A;  4JJN A;  5A92 A;  3SH9 A;  3KSY A;  3TOI A;  1F66 D;  5FAQ A;  2ZC7 A;  1LL5 A;  1A7W A;  1L0E A;  2ZQ9 A;  3EPH A;  3S1Y A;  1JWV A;  1SDE A;  5F99 B;  5GLD A;  5B2I C;  3ZG0 A;  3WKJ B;  4S2J A;  2HIO B;  5GLC A;  2EXB A;  3W98 B;  5FQQ A;  3O62 B;  4DE2 A;  5HW3 A;  3HON A;  1MY8 A;  3A6N D;  1GHP A;  3N8S A;  4QY5 A;  5B0Y B;  4JKT A;  4J8V D;  3IHA A;  3LEL D;  4B4Z A;  4Z5T A;  4DRB A;  4NYY A;  4H9O A;  5CPJ D;  4JF6 A;  5FI2 A;  3MXR A;  3AV1 B;  5DF7 A;  1KX4 B;  4KUD C;  4PM8 A;  1M40 A;  3A3E A;  5B32 D;  3UPP A;  5B2I A;  3C4O A;  1P3L C;  1QMF A;  1KDW A;  3X1V C;  3E2K A;  2NZD C;  1MXO A;  4Z5T C;  5B0Z D;  1O07 A;  3RJU A;  3REH B;  2FFY A;  5B2I B;  5CPI B;  2C5W B;  1O7E A;  3CJM A;  5DTK A;  4WV4 B;  3IWQ A;  5M1A A;  4WMC D;  4M6B A;  5M18 A;  3W96 D;  3AZE D;  2BG1 A;  3L28 A;  1K55 A;  1H5X A;  1M18 D;  2Y2H A;  2ZMA A;  2ARO C;  4WU8 B;  5GLA A;  5B2J B;  3HLF A;  2CV5 C;  1EWZ A;  4JJN C;  3G2Y A;  3KXB A;  3N7W A;  2HIO D;  1L0F A;  2WAF A;  5BNX B;  3W98 A;  1P3K D;  3AZL D;  3WTP B;  4Z66 B;  4KGC B;  3AZE B;  3FKE A;  5HX9 A;  1H3O A;  3IH9 A;  3ZDJ A;  3MVD B;  1CEG A;  1QME A;  1HQ3 A;  3W96 C;  4E3L A;  4X23 C;  3REH A;  3X1S B;  1L0G A;  5HAP A;  3C7V A;  3MZE A;  2VQR A;  4GNU A;  1ES5 A;  3VP3 A;  1P3P A;  4BD0 A;  4KZ9 A;  3H0R C;  3HLC A;  3PBT A;  3UTA D;  4J8W A;  3AZN A;  4R8P A;  4CSR B;  1KX3 D;  4Y7P A;  5AV8 D;  1KU5 A;  3N8R A;  1P3K A;  2Y2G A;  3AV2 C;  2ZLY A;  3UDF A;  1H8Y A;  2VGJ A;  5GT3 C;  1PWG A;  3VP1 A;  4GB7 A;  4K0X A;  3B0D B;  3BFD A;  4R3B A;  1WWS A;  3A1I A;  4U3T A;  5E2E A;  4GD8 A;  5FSR A;  3X1S A;  5AVB C;  2QMI A;  4KZ7 A;  2IWD A;  4KUD D;  4NE6 A;  4J8X B;  1Q2P A;  3GMW A;  4GD6 A;  2DCF A;  3W99 C;  4IBR A;  4MNR A;  5CGS A;  4DQY B;  1ZKJ A;  4OJO A;  3W98 D;  1JTG A;  3LZ1 A;  1NXY A;  1CI9 A;  3MNN A;  1PYY A;  3WS4 A;  5AV8 B;  5F99 D;  3NCK A;  1U35 A;  4KHA A;  5DNM C;  2IWB A;  3IXD A;  1PZO A;  5JRG D;  1JFI B;  3HLB A;  3LJA A;  4OPZ A;  2PYO C;  1N4O A;  5AVB D;  3PAE A;  5B2I D;  3PBQ A;  1KX4 D;  1P3I C;  3AV1 D;  2Y2N A;  3FDD A;  1BUE A;  2HPB A;  3BLM A;  4UUZ B;  4GZB A;  4R3J A;  4UA9 A;  5B31 B;  3BYD A;  4DRT A;  1SCW A;  3KS4 A;  4OLG A;  1M1A B;  1RP5 A;  5HAI A;  4BD1 A;  2Y59 A;  4Z66 C;  3WTP C;  3AZH A;  1JFI A;  5FQJ A;  3CG5 A;  3R45 A;  3WWX A;  1W2E A;  3B3X A;  3B6G C;  1HQ3 B;  4EWF A;  3WKJ D;  4J8X D;  3Q1F A;  1NJ4 A;  4H8R A;  3H0L C;  4MBH A;  3C1C B;  4ZJ1 A;  5KSH A;  1ERQ A;  4ZBJ B;  4CPK A;  3ZG7 B;  1P3A D;  3TU4 A;  4LD9 B;  3S22 A;  3REJ B;  5AV5 C;  1R4V A;  3REJ A;  4KEN B;  3VP4 A;  5FA7 A;  3X1U B;  3AZM B;  5CER A;  5GT3 B;  1P3G B;  5B32 B;  1P3I D;  3SS5 A;  1S0W A;  4OKP A;  1W5D A;  2PYO A;  3RXX A;  1KX4 C;  1PI5 A;  1K4E A;  5B2J A;  3LJA C;  3V9R B;  2A49 A;  5GSU C;  3UPN A;  3ZG9 B;  5AV5 D;  1BLC A;  4Z66 D;  3WTP D;  5E5A A;  2OSU A;  1FSW A;  2X71 A;  4XUX A;  2ZQ7 A;  3OZH A;  5FQI A;  3UY6 A;  5JYO A;  1N1J B;  4H9O B;  4OJ5 A;  4GKU A;  4G92 C;  3O62 C;  4JXS A;  2NQB B;  3NIA A;  3X1S C;  4JXG A;  4P87 A;  2ZY2 A;  3AZE C;  3ZNY A;  3W96 B;  5B1M A;  3G34 A;  2A3U A;  2PYO D;  1TZY D;  2X02 A;  3VP2 A;  3ZVT A;  4R1G A;  4WU9 C;  5GT3 A;  1MWS A;  5JA4 B;  5CTN A;  1LLB A;  4E45 A;  3VH6 W;  1JWP A;  3OPP A;  4RX2 A;  1P3O A;  3NDG A;  3KWQ D;  5EVI C;  1BT5 A;  5CGW A;  4LD9 A;  2DF4 C;  3B0D C;  2ZC6 B;  1XXM A;  3MGQ A;  3P5J B;  5B40 A;  3MGP C;  5GHY A;  5B24 C;  3L2A A;  3B6F D;  2ZY4 A;  3LZ0 C;  1DJB A;  3REI B;  3MZD A;  4J8X C;  4K0W A;  3LY4 A;  1AOI A;  4ZJ2 A;  3C1B D;  4KZ5 A;  3REH C;  3W96 A;  1HTZ A;  3EPJ A;  5GXQ B;  3FV7 A;  5B31 G;  3MBZ A;  1NYY A;  2YFV A;  3ITB A;  4XUJ B;  1WYC A;  4KZ6 A;  4UA7 A;  1NRF A;  3AFA A;  3IP4 C;  4QJG A;  3VH5 A;  5B40 B;  2CV5 A;  3B6F C;  3UN7 A;  4KQQ A;  3NY4 A;  3WS2 A;  3AZL C;  5AV9 B;  1BUL A;  4Y0T A;  1HTA A;  4IBB A;  2RL3 A;  3IF6 C;  5F83 A;  2JSS A;  4H9Q B;  1IYP A;  1LI0 A;  4ZJ3 A;  2XH9 A;  1PW1 A;  5HL1 A;  4QB8 A;  3A6N C;  5DNN D;  5CEC A;  3A3J A;  4QY6 A;  1P3O D;  3ZGA B;  4R4S A;  4S2P A;  4O7D A;  1M19 D;  4LCM A;  3HLW A;  4PM5 A;  3AL0 C;  4YS3 B;  4JF4 A;  4H9N B;  3REL D;  2V2F F;  5AV8 C;  3MGS A;  5AV6 B;  3AZF A;  4LG2 A;  3IF6 B;  4FCF A;  3ZNT A;  5AV9 C;  3AYW C;  4KUD A;  4GHL A;  4JPM A;  4IVK A;  3HSH A;  5CPI C;  4WJ3 C;  3O3V A;  3MGQ D;  1TZY A;  1P3L D;  5DVA A;  1TAF A;  3BEB A;  1YLT A;  3PBS A;  1S6R A;  5FQ9 A;  3UT9 B;  4X56 A;  2XF3 A;  3WAA D;  4OJL A;  3AZN B;  4J8U B;  1P3F B;  4ZUX B;  4J8W D;  2HP9 A;  3AZJ A;  4IBX A;  3FKV A;  5B1L D;  3GSG A;  4X55 A;  3AZL A;  3A3I A;  5FI7 A;  1KX5 A;  4X69 A;  5CGX A;  1PWD A;  2OV5 A;  4NZ5 A;  3REI C;  3REL A;  3AYW B;  3LZ0 B;  5E43 A;  3AZG D;  1T3U A;  1DY6 A;  1ESU A;  4KZ8 A;  5B33 B;  3MKE A;  1K56 D;  4OH0 A;  4E6W A;  2NQB C;  2Z2L B;  3N3F A;  1P3B D;  2WKE A;  4EBL A;  4G92 B;  1HD8 A;  3UTA A;  5HAR A;  1W79 A;  5B24 A;  1U60 A;  5FQM A;  3MGQ C;  3Q82 A;  3AZH D;  3AZG B;  3BLS A;  3EPL A;  3VMA A;  2XFS A;  3W97 C;  5GSU B;  1P3O C;  1XX2 A;  3C5A A;  4GHA A;  4FH2 A;  1EQZ C;  1KVM A;  5B0Y A;  5TFQ A;  2WGW A;  2J9P A;  3UE1 A;  4OLD A;  1LI9 A;  5DTS A;  3C1B C;  4FD8 A;  5B32 C;  2PYO B;  5CTM A;  1E25 A;  1FR6 A;  1NYM A;  5B1L C;  3DWZ A;  3KXB D;  1W8Q A;  5FAO A;  4UA6 A;  4PM6 A;  1AXB A;  5GHX A;  1ZG6 A;  1BLH A;  3AZK D;  5BT1 C;  3HUM A;  5B40 D;  3AGF A;  3BFF A;  4OJP A;  5EVI D;  2WYX A;  2CWE A;  5GSU D;  1LL9 A;  3CMZ A;  4JXW A;  3AZK A;  4RYE A;  2XR0 A;  3BRM A;  1ZLA C;  3TU4 B;  1S32 C;  5D3O A;  2ZQ8 A;  2H0Y A;  4QLC C;  1L2S A;  2HP5 A;  1NZU A;  1IYS A;  3AZK B;  4E3K A;  5KDM A;  3OCL A;  5GL9 A;  2QZ6 A;  3UTB B;  4IBJ A;  5B31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...