2FFFB

Open form of a class a transpeptidase domain
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
453
structure length
453
Chain Sequence
DYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSRRAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of an "open" form of PBP1B from Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Membrane protein, transferase
molecule keywords penicillin-binding protein 1B
total genus 147
structure length 453
sequence length 453
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2fffB01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2fffB03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2fffB02
1HZOA 1CI8A 3MZEA 3Q1FA 2Y2LA 1HD8A 3BFDA 4PMAA 5GHXA 3WS1A 1PWDA 1ESUA 2QZ6A 2ZD8A 1PZPA 3IXBA 1MY8A 2WKHA 2XR0A 4M3KA 2VGKA 5CGSA 3IHBA 2EXBA 3G35A 3QHYA 1IELA 3UDIA 1MKIA 3MBZA 4WMCD 4E6XA 3WS5A 1K4FA 4FSFA 4YINA 1NXYA 1YLPA 2J8YA 2C6WB 3GQZA 3HUOA 1JWZA 3G4PA 3IH9A 5HFOA 1H5XA 1DJBA 3BYDA 4JF4A 4WMCA 4KZAA 3ITBA 1DY6A 3LO7A 3WS0A 3BLSA 4GD6A 2JCHA 1YMSA 1KGFA 4PM8A 3QNCA 3WRZA 2BLSA 5FASA 5DF9A 4R0QA 5FAOA 5HX9A 2B5RA 3FKWA 3QNBA 3PAGA 1ONGA 1PZOA 1K4EA 4Z9QA 2Y2QA 5KZHA 1ZKJA 4WZ5C 1LI0A 2Z2MB 3ZG0A 4PM6A 3LCEA 1K55C 4OPZA 1SKFA 3NDGA 4OQ0A 2HP6A 1YMXA 2WAEA 4JXGA 3VOYA 3DW0A 4ZTKA 1Z6FA 1RP5A 2EX6A 4PPRA 1K57C 4OOLA 5KMWA 5FQ9A 4E3IA 4JXVA 5CGXA 2QMIA 4WBGA 5EOEA 5F1FA 2XF3A 2ZC3B 1J9MA 4OLGA 5IHVA 3UE0A 3DTMA 4IVKA 3C4PA 3GSGA 4BL2A 2JE5A 3SH9A 2Q9NA 2EX2A 4GN2A 3VP4A 1IYOA 2XFSA 1ES4A 2Y2KA 3P09A 3BRMA 1BZAA 4GZBA 3N6IA 3NDEA 4N92A 4YFMA 3ZFZA 4EBPA 1KE4A 1BT5A 2ZQ7A 1YM1A 1ZC2A 3OPRA 4U0XA 3GMWA 1VM1A 3HLFA 5TR7A 1ES2A 4EBLA 5HAQA 2EX8A 2JBFA 4DE3A 4DE1A 1FQGA 1YLTA 4N9LA 3W4PA 5J8XA 1NY0A 3Q7VB 1N9BA 2XFTA 1MWSA 2PU4A 5EUAA 5GLDA 1IYPA 1SCWA 1W5DA 2JC7A 4NK3A 1XX2A 1ONHA 3GR2A 4IEDA 4PM9A 5AQ9A 2Y91A 4GDNA 5TGFA 3EQVA 5FQJA 1JWVA 1XGJA 1BULA 3VP1A 1XXMA 4PM7A 3M6HA 3VSLA 1YLJA 5GLCA 1W7FA 2ZQ8A 3E2KA 1GCEA 2WYXA 3CG5A 4LV0A 3TG9A 3ZVTA 4Q8IA 1PWGA 3UY6A 4OPYA 2WGVA 1SDEA 5CRFA 2J9PA 4LENA 4QJGA 3C5AA 4LV2A 3G30A 5FDHA 5DVAA 4S2IA 5CXWA 4ZJ1A 4GB7A 3N7WA 3RJUA 4CJNA 2DNSA 2ZC6B 3M2KA 4GDBA 5L2FA 1FCOA 4N1HA 2FFYA 4OONA 4BD0A 1MBLA 1KVLA 4XUXA 2DCFA 1U60A 3P98A 4S2KA 4WZ5A 3HLWA 1ERQA 5CHJA 4KZBA 3G32A 2WGWB 1JTDA 1YT4A 2P9VB 3IXDA 2G2UA 5KSHA 2ZC7A 4RX2A 2HP5A 4LCMA 1PW8A 3UE1A 5HL1A 1H8ZA 1EI5A 1JWPA 3S4XA 4P87A 3ZG7B 3I7JA 4C6YA 3SOIA 3JYIA 2XQZA 5FQKA 1IYQA 3CMZA 5DF8A 3VMAA 2VGJA 5GHYA 3OZHA 1KVMA 5EVIC 3HLGA 3M6BA 3Q07A 5DTTA 4N1XA 4A5RA 4BQMA 4KQRA 3TSGA 1I5QA 1LI9A 2WGWA 1KGGA 3AGDA 4GOGA 5FATA 5FI6A 1ZG4A 3NC8A 1EROA 4B4XA 2ZM8A 3Q81A 3PTEA 4WEKA 1PI5A 4P0MA 4QY6A 1K54C 1FCMA 1L0EA 1OMEA 4FH4A 4O7DA 5F1GA 3S1YA 4R4SA 3UE3A 1LL9A 2XLNA 4DKIA 2ZC5B 4DXCA 3D4FA 3WS2A 3C7VA 2FFFB 3ZGAB 3IHAA 2HDQA 1KGEA 2EFUA 1MXOA 2ZQCA 5FQMA 4OP8A 2UWXA 3OC2A 5EVIB 1H8YA 3O3VA 5GL9A 4X69A 1K25A 1M40A 5E2EA 3IXHA 4S2NC 3ZVWA 1O7EA 4XUZA 4BJPA 3FV7A 4C3QA 2ZLYA 4S2JA 1GA0A 2X01A 3GRJA 4EV4A 1Q2PA 4BL3A 3IXGA 4CPKA 3SH8A 5HW3A 4E3JA 5A92A 4R3BA 1L2SA 1BLPA 1K6RA 4E3OA 5HAPA 1C3BA 2X02A 4OPQA 2OLUA 4QY5A 3RXWA 5CTNA 3IT9A 1K55A 2Y2MA 3W8KA 5M19A 1S6RA 4DE0A 2V2FF 2ZC4B 3OCNA 3OPLA 2P9VA 2Y55A 1L0FA 3VP2A 2C5WB 1XA1A 2WKEA 2XH9A 1KDSA 4GNUA 1QMEA 4BD1A 2OLVA 3MZDA 4H8RA 4OKPA 1DJAA 2P74A 5E2FA 2E8IA 3HLDA 4OH0A 4U0TA 3BM6A 1GHMA 4OQHA 4HBTA 1CI9A 4S2PA 2QPNA 1O07A 5M18A 1NYYA 4ZJ3A 1WYCA 3MXSA 4KZ8A 1SHVA 5U47A 1KE0A 5E2HA 2IWDA 4ID4A 1YLYA 3NY4A 4KZ6A 3MZFA 4E3KA 1YLWA 1FOFA 3IF5A 1FCNA 4JLFA 3ZNYA 3PBOA 4EQIA 3PBQA 4LCLA 1TDLA 4IBXA 2Q9MA 3IH8A 4N9KA 3ISGA 5GLBA 4KZ5A 4X53A 2A3UA 3O86A 4KZ7A 1W8QA 2R9WA 5DTKA 3DWKA 4RA7A 4UAAA 5M1AA 4E3LA 3BEBA 4B4ZA 5JYOA 1K54A 1TEMA 3VP3A 2IWCA 1PI4A 4KG5A 4OOYA 1ERMA 4Y0OA 5CECA 1LHYA 3Q7VA 2G2WA 3SS3A 4E3NA 1ALQA 2OV5A 1L0GA 4KZ9A 3A3FA 3OCLA 4D2OA 1KE3A 2OSUA 5EVIA 2WADA 5CERA 4EBNA 3O88A 2ZQDA 3E2LA 4IBRA 1NJ4A 1HTZA 1WYBA 3PBTA 4KQOA 2IWBA 3SS5A 4MBHA 5G18A 4UA6A 4WELA 4UA9A 4RX3A 1IYSA 2HPBA 1XP4A 1K38A 3SH7A 3VFFA 4MBFA 4NETA 4OP5A 4QB8A 1TVFA 2HP9A 3IF6B 5DF7A 4F94A 3SS4A 4L0LA 2XK1A 3V3SA 5CGWA 5FAQA 3O87A 5EPHA 4WM9A 2WZZA 3UN7A 2BG1A 4MLLA 1YLZA 4LV1A 5FAPA 4S2NA 2PU2A 4OLDA 1MWTA 1PW1A 1ZG6A 3LY3A 4KZ4A 4K0WA 4X68A 1NZOA 1JTGA 1VQQA 3GV9A 4E3MA 1MWRA 3UO9A 1BSGA 4RYEA 3G2YA 5A93A 3CJMA 2Y2NA 2ZQAA 2Y2HA 2EFXA 4BLMA 1BLSA 3HLEA 1RCJA 4WYYA 1G68A 1PYYA 3BFCA 1Q2QA 5FI2A 4Y0UA 4ZAMA 2H0TA 3DWZA 1W8YA 1FR1A 2Y2PA 3MXRA 5I94A 4MNRA 5A90A 1RGZA 4RVAA 3BECA 3IQAA 2V20A 1K56D 1MPLA 3BLMA 1YQSA 3N8SA 3LEZA 3NBLA 1E3UA 4HESA 4DE2A 5EECA 1NZUA 2DRWA 2XDMA 1ES3A 4S2OA 4X55A 2Z2LB 1IKIA 1GA9A 2Y59A 4QU3A 3MKEA 4XXRA 1XKZA 4WEJA 4E6WA 3W4QA 3ZNTA 1BLCA 4JKTA 5CTMA 2EXAA 3GVBA 3HREA 3HVFA 1HVBA 3NCKA 1PIOA 5FQIA 3C4OA 3VP0A 3UPOA 1QMFA 1SDNA 1EWZA 4OQIA 3V50A 4JBFA 1NYMA 2J9OA 3FYZA 3RXXA 4R3JA 3G31A 2J7VA 3A3EA 4DDYA 3VFHA 2V1ZA 1PWCA 5EOOA 2XEPA 4JXWA 5F83A 3IWIA 1FR6A 4JF6A 4JPMA 5EVID 3PAEA 4KG2A 3AGEA 1LL5A 3C7UA 1N4OA 1XGIA 5FSRA 5AQAA 1TDGA 3HUNA 2HDUA 2CC1A 3GTCA 4JF5A 3V39A 3FKVA 4FD8A 3IWOA 3UPNA 3WS4A 4HBUA 3MFDA 3ZCZA 4KENB 4R1GA 2ZMAA 1IKGA 4QD4A 1XA7A 3CZDA 5JYPA 5CHUA 3UNWA 3MKFA 3ITAA 3V5MA 3ZDJA 1FSYA 4R23A 3BFFA 5KSCA 3WRTA 1K57A 5FQQA 3FZCA 4C75A 5AQ7A 2ZJ9A 1CEGA 3UDFA 4DXBA 2A49A 5AQBA 4EUZA 1E25A 5HARA 4MBKA 2XD5A 1E4DA 3AGFA 3NI9A 3A3IA 3NIAA 5EVLA 2I72A 1ESIA 2Y2OA 1CEFA 1Y54A 4R4RA 1GHIA 5GLAA 3BFEA 1I2SA 3FWLA 4JXSA 4ZJ2A 2WKIA 4PM5A 2XGNA 3B3XA 3VSKA 4UHUA 3V3RA 5DTSA 3HBRA 4GKUA 5GHZA 4OPRA 5FA7A 2R9XA 3PBSA 3A3DA 2GDNA 3HL9A 2WZXA 4S2MA 2WK0A 1S0WA 3Q7ZA 4S2LA 1RGYA 1E3UD 3TOIA 4DDSA 5BOHA 4U3TA 4BENA 5CEBA 1G6AA 1KDWA 3EQUA 1ES5A 3LY4A 4X56A 1DJCA 3PBNA 4UA7A 1I2WA 3A3JA 3HUMA 4KZ3A 1JVJA 4MEZA 5F82A 5HAIA 3G34A 3M2JA 3ZG8B 4B88A 1MWUA 4DRTA 1BUEA 2ZM0A 2H0YA 4OOMA 4WZ4A 3OPPA 5CHMA 4LV3A 4ZDXA 3ZG9B 4GD8A 2RCXA 4K0XA 2Y2IA 2X71A 4P85A 4Y0TA 3IF6C 4IVIA 2Y2GA 1XPBA 2WUQA 3N8LA 1K6SA 4K91A 4Y7PA 4ZBEA 3ZHHA 3BFGA 3WWXA 2HDSA 5FI7A 4HEFA 3PBRA 4KG6A 4X6TA 2H10A 5CEDA 5TFQA 4FCFA 1BTLA 1K56A 1WE4A 2RL3A 2HDRA 2PBYA 5E43A 3IWQA 2Y4AA 3UPPA 1BLHA 3S22A 3N8RA 2XD1A 1LLBA 1M6KA 4P6BA 3HLCA 1GHPA 3UDXA 3N4IA 1W79A 4QHCA 5E2GA 4OQGA 1IEMA 3HLBA 4KQQA 4OVDA 5A91A 1FSWA 3G2ZA 3OPHA 4EWFA 2H5SA 2ZM2A 3Q82A 4FH2A 2WGIA 5D3OA 2ZQ9A 1L0DA 3IF6A 3ZG5A 5EE8A 3VOZA 1NRFA 2Y2JA 3W4OA 1CK3A 4DF6A 1AXBA 2WAFA 2EX9A
chains in the Genus database with same CATH superfamily
4PMAA 4I3JA 5GHXA 1HD8A 4G92B 4L9FA 1PWDA 2ZD8A 4CAYA 3IS2B 2WKHA 3IX3A 3L2AA 4G3VA 1M18D 3WS5A 4FSFA 3MNNB 5DNMA 3AZFB 3X1UB 1NXYA 2HIOD 3CWFA 2J8YA 3TU4D 5HPIA 2XA7S 5HFOA 3G4PA 2ZY5A 1H5XA 3BYDA 3OBFA 3BQ8A 4WMCA 3ITBA 4RQ9A 3REIC 3O62C 1KX3D 3VH5W 1Y28A 2BLSA 4MB3A 5FAOA 3WD2A 4HJ6A 2NUTC 1OGBA 3WD1A 5CPIB 1ONGA 1K4EA 1ZKJA 3MGQC 5B2JA 3MNNC 1TS8A 2D49A 4PM6A 1K55C 4ZUXB 3MGRB 1ID3C 4WUJA 4OQ0A 2HP6A 4ZTKA 1TS7A 2EX6A 3X1VD 4OOLA 1BH8B 4X1MA 5TJJA 4IBEA 2QMIA 5AV5C 5EOEA 1M1AC 1F5MA 1CQAA 3X1SA 1KX3C 2VZWA 2WKQA 3X1UA 3C30A 2RTSA 4OLGA 3DTMA 3CPTB 3PXPA 4XUJB 2Q9NA 2EX2A 2L4RA 3VP4A 1IYOA 5B31D 2XFSA 3AYWB 1N1JB 2Y2KA 3AZLB 3REHD 4GZBA 4EBPA 2A24A 4E45A 3T4TA 3KYZA 5TR7A 3OLOA 1H0IA 3GMWA 3X1VA 3HLFA 3REKA 4DE3A 4UQIS 4N9LA 5J8XA 2Q0OA 4OJOA 5A8BA 1MWSA 2PU4A 2B02A 3MFXA 3RELB 5AV9A 1XX2A 4Z2HA 4IEDA 2Y91A 3LYXA 5TGFA 3EQVA 4HP4A 4KGCC 3GDIA 3VP1A 4PM7A 3L28A 3M6HA 1YLJA 4Q8IA 4L9GA 2UV0E 3TG9A 3AV1C 3WA9A 1VB6A 4BBTA 4Z5TD 5B1LD 3REHC 2D01A 2BYKB 4G92C 3TU4A 5DVAA 1M18A 5B40B 3N7WA 1HQ3D 4GDBA 3TU4C 4WF0A 2FFYA 1KU5A 3AZKD 2D02A 3REHA 4KZBA 2VV6A 3UB5P 5B31A 1JTDA 1Y4OA 2P9VB 3WA9C 4NE3A 2FJ7D 2HP5A 3HJKA 5CX7A 1H8ZA 1EI5A 4J8XA 2YFWA 4G91B 2P08A 3MVDB 3LI8A 1NLYA 5AV5D 4HOIA 2V1AA 5B0ZB 3CI6A 3NJAA 5HD5A 1KVMA 3M6BA 3X1VC 5GT0B 3Q07A 5DTTA 3AZGC 3TSGA 1I5QA 5FATA 1KX4D 3TE8A 2J3TC 3NC8A 4R6LA 3FDDA 3B6FB 1STZA 2ZOIA 3QP2A 4WEKA 1KX5C 5AVCB 4FH4A 1KX3A 4WNNB 4DKIA 4WU8D 3ZGAB 2HDQA 2ZQCA 1MC0A 1L6JA 1H3QA 4GHIB 4OP8A 3KUYA 3KXBC 1D06A 4KQDA 3HSHA 4Z2GA 5E2EA 3VE4A 3WA9B 5GSUB 1IOUA 5E5AD 4NEED 4C3QA 4R8PB 3MGQA 4OJPA 3GRJA 4EV4A 4BL3A 5AV6C 1P0ZA 3SH8A 4E3JA 5A92A 2P7JA 3V9RA 3O62A 1D1JA 3WTPE 1BH9A 3RXWA 1ULYA 3MQ0A 5B32D 1K55A 3REJB 3W8KA 1P3GD 3OPLA 3L27A 2PR6A 2C5WB 1KDSA 4UUZB 2OAQ1 5HSQA 4H8RA 5E2FA 3RH8B 3KSIA 1V9ZA 4S2PA 3C1CA 2QPNA 1O07A 1UGUA 4ZJ3A 3B47A 5GXQA 2VJWA 3MZFA 2PRFA 3S7OA 3A1KA 4NZ5A 2L5AA 1QO6A 4LCLA 4K08A 2Q9MA 3IH8A 3T1SA 4N9KA 3ISGA 4R8PD 5B32G 1W8QA 4H9NA 4E3LA 5M1AA 1KX5A 4I38A 5J4EA 3SS3A 5DKLA 2F8ND 2W1TB 4IBDA 3AZGA 5JA4B 4YS3B 3KUYC 5I5LA 4EBNA 3NOUC 5IU1A 3O88A 2QJ5A 3E2LA 2ZOHA 2QYBA 4CLCB 1NJ4A 3T12B 5B2IB 1UR9A 2PHYA 1HTZA 3PBTA 3SS5A 4WELA 3AFAD 4UA9A 4RX3A 1V9YA 5L8MA 1K38A 3KSHA 2W8SA 4NETA 2HP9A 3MGPB 3IF6B 4L0LA 3AN2B 5B31C 1ZHHB 3NOTC 5F99B 2FZ0A 3UN7A 5B32C 1YLZA 3PR6A 1P3FA 2PU2A 3VH6W 4KZ4A 4J8XC 4J8VB 4X68A 4BWIA 2W0NA 5AVBB 3G2YA 5GT3A 2EFXA 4XT2B 1BLSA 1G68A 1Q2QA 2I9VA 4ZAMA 3MGQD 3AYWA 2H0TA 1HLUP 2Y2PA 5I94A 1RGZA 4H9QA 2P04A 4KUDC 2VV8A 2IA2A 4HJ3A 5AV9C 1YQSA 2NZDC 2GZAA 3N8SA 5B40A 3NBLA 4HMEA 4LRZE 4HESA 4DE2A 2XROA 2A2LA 1NZUA 2CV5D 1M19D 4YM6B 2XDMA 4HIAA 2PAVP 1XKZA 3W4QA 2VKSA 3MQQA 3GVBA 3HREA 3NCKA 5FQIA 2XA7M 3VE3A 3UPOA 3UTAB 3L9KA 1EWZA 1UWNX 5DNNC 1NYMA 2HGVA 2J9OA 3FYZA 2EA9A 1P3BD 3BW6A 3A3EA 5AV5A 3AZIA 2XEPA 4JXWA 4QLCB 2V5OA 3T4LA 3L29A 1W63M 3WKJA 3W98A 4LD9B 5B0ZC 5EVID 3B6GC 4KG2A 1CF0A 4QPRA 3AZLD 1ID3A 3GTCA 4JF5A 1DP8A 3QP4A 4FD8A 3IWOA 3UPNA 2ZMAA 1IKGA 4QD4A 1XA7A 5EM1A 3CZDA 3V5MA 3REJA 5KSCA 3WRTA 1TAFB 2HZ5A 5B1LC 1E6PA 5AQ7A 3UDFA 4DXBA 4IHQA 5FL3A 1P3FB 1E25A 5DFXA 4MBKA 2XD5A 5B2JB 3AGFA 4CSRA 1CEFA 2YKFA 1GHIA 3A6NB 3WTPD 2ZM5A 1YSPA 5B1MD 4WU9D 4OUIA 3VSKA 4ZBJB 4OPRA 5FA7A 3AZKA 4S2MA 2WK0A 3WAAB 5AV8A 1X0OA 4MB5A 4LD9D 1OT9A 5BOHA 5CEBA 3P5JB 3LZ1C 4Z2KA 4KUOA 3LR3A 4H9RA 1ES5A 3LY4A 3PBNA 3AFAB 2J3TD 3NQJA 1JFIB 1I2WA 4KZ3A 5B1MA 4DRTA 4Z5TA 1BUEA 4YM6A 1S66L 2H0YA 2PR5A 4AFIA 5DJUA 3H0LC 4LV3A 1F98A 1P3KD 4P85A 5HWTA 2WUQA 4K91A 4ZBEA 5DNMD 3EPLA 3PBRA 4X6TA 3SZTA 5CEDA 1XJ2A 4KHAB 3NQJB 1JFIA 2GNXA 3EGXC 1XFNA 5B0ZD 1WE4A 1ED7A 5AV5B 1OPXA 5IS1A 1MZUA 3WKJB 3HLCA 1GHPA 4JGQA 4ESPA 5GT0D 3AZNA 2PYOA 3C1BA 3N4IA 3WAAD 5AV6D 4QHCA 5A91A 1P3MA 3WD0A 1KS0A 4MB4A 3Q82A 4H6JB 1L0DA 5FUGB 3ZG5A 4IJGA 1E6ZA 1TZYD 1M1AB 2QJ7A 1HZOA 3A0SA 5AV9B 3MZEA 2Y2LA 3Q1FA 4CLCA 3LELD 1MY8A 4M3KA 2VGKA 1WA9A 4WU9C 3WAAC 3UDIA 4WMCD 1EQZA 4JJNA 1YLPA 3EEHA 2NQBA 3AN2D 3S7QA 3GQZA 1OGGA 3VH6T 1HQ3C 4J8VD 1J3WA 2HV1A 1DJBA 1P3AC 3WS0A 4GD6A 1YMSA 4H9SA 3QNCA 5FASA 2B5RA 3PAGA 2FJ7C 4Z66A 2Y2QA 4WZ5C 1LI0A 4HGAC 1ID3D 3VOYA 4JXGA 1S32C 3DW0A 2GX5A 4PPRA 5KMWA 3NOPC 5FQ9A 2CV5B 1M19B 4J8XB 4J8VC 5AY8C 2FN2A 2JKGA 4CQHA 5F1FA 2XF3A 5IHVA 4JJNB 4IVKA 3GSGA 4BL2A 3SH9A 4GN2A 3NHQA 1ES4A 3KWQD 4J8WA 1BZAA 3N6IA 4YFMA 4QLCC 1BT5A 2ZQ7A 1YM1A 4U0XA 1T18A 5HAQA 1VM1A 4HP9A 5JRGD 4UEYA 2JBFA 2GJ3A 1FQGA 1P3AB 1NY0A 3Q7VB 2CV5A 1M19A 1N9BA 5EUAA 2IO5C 4QNLA 1SCWA 1W5DA 1UR8A 1OJ5A 2JC7A 5AQ9A 5CP6C 4PM9A 4X23A 3BQAA 5FQJA 2W1RA 4YS3C 5CPJD 5GLCA 1W7FA 3ZVTA 3MGSB 1GCEA 3CG5A 4X23C 1P3IB 1PWGA 4OPYA 2WGVA 1LSVA 5CRFA 3KWQC 4OJ6A 2J9PA 4HI4A 4QJGA 1R4VA 3G30A 4LV2A 4ZJ1A 5F69A 4CJNA 3W99D 3LJAD 3EPJA 2NQBB 3AZEC 4J8WC 3AN2C 4OONA 3REJC 3JVVA 5LBRA 3QP8A 1U60A 3R45B 1P3KA 2ZMVA 3B0DC 4UUZA 1ERQA 4Q0IA 5B0YC 2M7UA 1YT4A 2NUPC 1P34D 1EQZB 2ZC7A 5KSHA 2K7SA 2O0YA 4QWOA 1PW8A 5HL1A 1L3LA 2ZY3A 1A0KA 2J3WA 3W98C 4HH2A 3LZ0C 3ZG7B 5G4ZA 1FILA 3AZEB 3JYIA 2V8CA 5FQKA 4P6ZM 3UTAD 3VMAA 4WL9A 1CXWA 3OZHA 4XZQD 5EVIC 5HWWA 4A5RA 4N1XA 4KQRA 3DTIA 5GSUA 1KGGA 5FI6A 5B24C 1EROA 4B4XA 3Q81A 2K2NA 3PTEA 1CK7A 5E5AA 4GS9B 2G5HC 1KX5D 4P0MA 4Y3IA 3LI9A 3E0YA 4O7DA 5F1GA 3S1YA 3UE3A 2ZC5B 1DP6A 3IHAA 2EFUA 1MXOA 5B33B 2V8FA 5DNMB 2UWXA 3AZFA 1P3LA 1H8YA 3F1PA 3H82A 5L09A 4EERA 1AIWA 1M40A 3MGPC 3IXHA 4S2NC 5EM0A 1O7EA 4XUZA 4E04A 3RELA 5HD3A 5F99C 3QP5A 5HW3A 3UTBC 5CPJC 1BLPA 1K6RA 1ZLAD 5J7EA 4ETZA 3AZLA 5G49A 3BY9A 2OLUA 1F66B 5CTNA 2G5IC 5BS7A 3F1PB 3H82B 5DFYA 2Y2MA 3WTPB 3CUEC 3C1BC 1PRQA 4BD1A 1XA1A 5B2IC 5JRGA 2XH9A 3AZID 1QMEA 4GNUA 3O62D 1TZYC 5BNXA 4MN5A 3ZQ5A 2E8IA 3HLDA 4GHIA 1FIKA 4U0TA 1GHMA 4MN6A 4HBTA 1KX5B 4KUKA 5M18A 1NYYA 1WYCA 3MXSA 2IWDA 2O99A 5BO0A 3UT9B 1IFQA 4KGCB 2AROC 1PFLA 4H6JA 3AV2B 4Z2JA 3IF5A 3T4OA 1FCNA 4JLFA 3X1TB 1S4SA 2JN7A 1LSXA 5GLBA 2OAP1 2KX6A 1SKOA 3WD4A 4R8PC 3K3CA 1F2KA 3BEBA 4B4ZA 3VP3A 1TEMA 4EW7A 3X1VB 3AYWD 4WN5A 1LHYA 2CWEA 1ALQA 4IBKA 4EO5B 3C2WA 3LIEA 2OSUA 2WADA 1P3OA 3W97D 2AROD 5AVCC 3FC7A 1H0MA 1P3LD 4X1LA 5GXQC 3L7HA 1WYBA 4ZRRA 5EV0A 2IWBA 4MBHA 2XSSA 3C1CC 1TVFA 3UTBA 3X1TA 3KFUG 1CJFA 3V3SA 3TU4B 4UPKA 5F99A 5CGWA 2BYKA 1O6IA 3ZYTA 5GSUD 5EPHA 3AFAA 4XZQA 3F1NA 4S2NA 4H9PA 4L9EA 3A6ND 1ZG6A 1P3AD 4ETXA 1P3GC 1YU4A 1NZOA 3AV1B 3GV9A 4E3MA 2RVQD 1VETA 5AV6A 5JRGB 5A93A 2Y2HA 3AZND 1EAKA 1RCJA 3KSYA 5E5AC 3DWZA 3MVDD 3MXRA 4MNRA 5A90A 4KHAA 2HIOC 4RVAA 2V20A 3B6GA 5B0ZA 2AROB 1W1VA 4HJ4A 1EW0A 2VA0A 3LJAA 3W99A 4EUVA 3UMEA 5BPVA 2DRWA 4S2OA 4X55A 1IKIA 1GA9A 2Z2LB 3W99C 3LJAC 3MR0A 2M7VA 3B0DB 3MKEA 1KX4B 4WEJA 3ZNTA 1BLCA 5CTMA 1SKOB 3MGSA 2EXAA 3BJNA 3HVFA 3H9WA 1PIOA 1W63Q 1QMFA 1SDNA 4GHLA 5BNVB 2HJ9C 4DDYA 4TX8A 1PWCA 5EOOA 3LZ0D 1FR6A 4JF6A 3MNND 4JPMA 2VEAA 1NWZA 5CP6D 3PAEA 4KUDA 1N4OA 5FSRA 4YS3D 3LELA 3AV2C 3VH5A 5IT5A 4KENB 5MC7A 1TD5A 3ITAA 3LR0A 4R23A 3T4JA 3BFFA 1HQ3B 5CPID 4I39A 4DN0A 5JA4A 4YS3A 3T1RA 2IOUA 1K57A 2O9AA 4IJEA 5FQQA 5CP6A 1M18C 1TZYB 1CEGA 1MKMA 2YKHA 3AZMA 5AQBA 5HARA 1P3OC 3NIAA 2I72A 2Y2OA 2EWVA 3UT9C 3H7WB 3A0VA 4R4RA 3FWLA 1I2SA 2WKIA 1Q9CA 1LSWA 4LLOB 5DNNB 4UHUA 4LGWA 3DAVA 5B0YD 2EWWA 1LL8A 4GCZA 2R9XA 2GDNA 4M6BA 4D60A 1S0WA 3LZ0B 4Y15A 3FPVA 1RGYA 4EEUA 3TOIA 4J8VA 1W2EA 4U3TA 4BENA 1KDWA 1P3IA 3LIFA 5B24D 5J3WA 4UA7A 3A3JA 3HUMA 4R3AA 1JVJA 5F82A 3V9RB 3O62B 3TJZC 3K3DA 4Z66C 2YFWB 4WZ4A 1H0GA 1M1AA 3LJAB 3W99B 2Y8HA 5CHMA 4CLCD 4YWZA 3B6FC 4GD8A 2RCXA 2DQNC 4K0XA 2X71A 3IF6C 4IVIA 3ULFA 3MQOA 5B2IA 4GHAA 4BBUA 3BFGA 2HDSA 4KUDD 4HEFA 2HIOB 3AV2D 4KG6A 3CAXA 5B2JC 3MNNA 5TFQA 1P3MD 4GLQA 2JKTI 4HMCA 2JKFA 3WAAA 2RL3A 4WU9A 2PYOD 2PBYA 1ODVA 3R7WB 1KX3B 4XT2A 3HCYA 3IWQA 4YOFA 3RTYA 5CPKD 3REIA 2PD7A 3W96A 1LLBA 4WNNA 4NXGA 4NXBA 2YFVB 1W79A 5E2GA 4OVDA 1FSWA 3G2ZA 3OPHA 3W97A 1P3OD 1WWIA 2VGLS 4ARZB 4EXOA 2ZQ9A 2ZY4A 2OWJA 1JNUA 1P3MC 3UE6A 5EE8A 3VOZA 2Y2JA 1E88A 1XJ6A 3W4OA 1AXBA 2WAFA 1CI8A 2HF6A 3BFDA 3REIB 1ESUA 2F8NK 2B18A 5CGSA 5HZHA 3IHBA 4Y2FA 4J8UC 3EOIA 3QHYA 3IBJA 3KXBA 1IELA 4E6XA 3MBZA 3IH9A 1JWZA 1VETB 4LD9A 3VV4A 3UB7A 1ZLAB 5HPFA 3KSGA 1ZTUA 2E8JA 1KGFA 5HDCA 4PM8A 1PDCA 1A7WA 5DF9A 4KGCD 4GH9A 3B0BA 3QNBA 3TRCA 5FEFA 1PZOA 3AV1D 3UMDA 4Z9QA 4XUJC 5FUGA 5KZHA 5DKKA 3QP1A 5B1MC 4IBIA 1GOIA 4OPZA 1SKFA 2WAEA 3AZEA 1P3PA 3LZ1A 1RP5A 3VH5T 1N9LA 3FPWA 5CGXA 2ZC3B 1J9MA 3UE0A 4I3IA 3C4PA 5AJGA 2JE5A 3ZFZA 3NDEA 2ZY2A 3OPRA 1N1JA 4EBLA 3AZFD 2EX8A 3R4KA 1YLTA 3EGDC 3W4PA 4NYYA 2RVQC 1YUEA 1P3FD 2XFTA 5GLDA 3WKJD 1J7MA 1ONHA 4H9OA 3AV1A 1H3OB 1N9OA 2JKRI 5KIZA 3W97B 1JWVA 3CHWP 1BULA 1KX4C 1P3LB 4KGCA 1XXMA 2ZQ8A 1XJ3A 1BYWA 2V0WA 3UY6A 1SDEA 3KS4A 2DF4C 2ZL1A 3EWKA 3AZNB 5AY8A 3R7WA 5AV8B 4S2IA 5CXWA 4NG2A 4GB7A 3RJUA 2DNSA 5L2FA 3C1BD 4JGPA 3K2NA 1PZRA 3WA9D 1KVLA 4XUXA 2DCFA 3W2ZA 3P98A 3UT9D 4WZ5A 3G32A 4XUJD 2WGWB 3X1SC 3IXDA 2G2UA 3T4SA 4F3LB 4LCMA 1KX4A 1H3OA 4LG2A 3IS2A 3S4XA 3LR5A 3SOIA 4ARZA 5GHYA 1EQZC 3W96D 3HLGA 4BQMA 4AWLB 2G7UA 1LI9A 2WGWA 4GOGA 4Z2IA 2ZBBA 2VK3A 4EQ1A 4O8GA 3AYWC 4WV4B 1PI5A 4CLCC 4QY6A 1K54C 4I3AA 2V0UA 4LPZA 3S7NA 3AZHB 1FCMA 5AV6B 4R4SA 4DXCA 1LL9A 2XLNA 1M18B 1BFMA 3C7VA 4O01A 1KGEA 2PBDP 5AVBC 3SW1A 4DMZA 3KSFA 3OC2A 3DBAA 1K25A 3FKEA 3NQUB 1P3FC 3ZVWA 1YPRA 1M1AD 3FV7A 2PYOC 3WTPA 5CP6B 1Q2PA 3D3OA 3IXGA 4DJ3A 2PDRA 1GSXA 1L2SA 4E3OA 2VQRA 5HAPA 1OTIA 1C3BA 2X02A 2F2AC 2NZDD 4FTXA 4OPQA 1P3PC 4QY5A 3V67A 4IJFA 5KDMA 1S6RA 4DE0A 2V2FF 2W3HA 2W3EA 2A24B 2HUEC 5GXQB 2ZC4B 5B2ID 3OCNA 3VP2A 2WKEA 4EU0A 5B0YB 3IX8A 4Z66D 1P97A 2OLVA 3MZDA 1VEUA 2OOLA 4OH0A 3B6FD 5B33A 3REID 1CI9A 2BTFP 2XRNA 3LFVA 4Z2LA 5DNND 2V9AA 4YM6C 4KZ8A 3WTPC 1SHVA 3X1SD 5U47A 1KE0A 4ID4A 4WU8B 1YLYA 3NY4A 4GW9A 1YLWA 4ZUXA 3MGRA 1EQZD 1G28A 1U35A 5TBMB 2BYMB 3PBOA 3ZNYA 4EQIA 2PYPA 1TDLA 4J8UA 2A3UA 3O86A 3DTEA 5CPIA 5AV8C 1GSWA 3C38A 4YNRA 4KZ7A 4NE5A 3T1XA 2L0WA 2R9WA 3DWKA 2J80A 1K54A 3KX0X 2INWA 3T1QB 1TS6A 3Q7VA 4E3NA 2OV5A 4KZ9A 5AVFA 3EEAA 3OCLA 4D2OA 3W97C 1T19A 4H9QB 4DRBA 5B32B 5B40D 2ZQDA 5F68A 3KS8A 3AZJD 2W1TA 5B1LA 4WZSB 2LY8A 4UA6A 1IYSA 1XP4A 2K31A 1W1YA 1P9RA 5B33D 3VFFA 3B6FA 4QB8A 5DF7A 4F94A 3MGSD 1U35B 4LRYC 5TBMA 3SS4A 5GT3D 1P3MB 2QWSA 5HWVA 3CITA 2WZZA 2BG1A 4LV1A 1GSVA 2PT7A 1MWTA 4J8UD 3B6GD 4K0WA 2NQBD 3WKJC 3KO6A 4RYEA 3CJMA 4Q0HA 2Y2NA 2ZQAA 4BLMA 3HLEA 1F9IA 3NULA 5DNNA 1VEUB 3BFCA 3VOLA 4Y13A 3UB6A 3F6TA 4B9OA 5BT1D 1K56D 3AZGB 3AZMB 5AV8D 5EECA 4HMDA 2F8NH 3LZ1B 2Y59A 2NZDA 1YAXA 4XXRA 2CMNA 4E6WA 1VHMA 1HVBA 3UT9A 3HJIA 1P3BC 3LR4A 3KWQB 1XJ4A 3AZKB 4NXEA 2J7VA 3AZMC 3VFHA 5K5BA 3AZJC 1ACFA 5F83A 3IWIA 5AY8D 5CPJB 5C3IC 3A1IA 3AGEA 5AQAA 2IO5B 4BBVA 3A0RA 2HDUA 2CC1A 3OOVA 3WS4A 5EVEA 4UQIM 4XUJA 5CHUA 5FDSA 1AOIC 3MSHA 3MVDA 3MKFA 1P3OB 3UNWA 3ZDJA 3UTBD 3T4QA 3MGSC 1BH9B 3FZCA 1SZVA 3B33A 2ZJ9A 4MCWA 4PKYA 3F1OA 3L25A 2KOIA 5B31B 1D7EA 2WKPA 3NI9A 3A3IA 5EVLA 4BMWA 1ESIA 3EPHA 4AWLC 4DJ2A 5GLAA 3BFEA 4JXSA 1P34B 4H9RB 3B3XA 3X1TD 3WD3A 5DTSA 3AZIB 3UB9A 3MS6A 3X1UC 4LD9C 5B1LB 3A3DA 3PBSA 2WZXA 1OTEA 3Q7ZA 1NLZA 4S2LA 1E8BA 4ME4A 5BT1C 1G6AA 2W3GA 4H9PB 1G5UA 2HIOA 3KYEA 3KXBB 4HHDA 4X56A 2NZDB 4IUHA 4MEZA 5HAIA 4B88A 3ZG8B 3W96C 3REJD 4OOMA 4HH3A 4WJ3C 3UTBB 2FJ7B 3X1TC 3ZG9B 2Y2IA 4Y0TA 2Y2GA 1K6SA 1UWPX 3N3FA 4NZ3A 5FI7A 4XZQC 1HTAA 2YFVA 3X1SB 3RFBA 1BTLA 5DNMC 3AZHD 3W96B 2JSSA 2HDRA 3M7PA 3VH6A 3C8CA 4PAUA 2Y4AA 3UPPA 1BLHA 4MN7A 2Y79A 4NE6A 1AOID 3UTAA 1IEMA 3HLBA 4KQQA 1P3PB 1YKDA 4WU8C 3B0CW 5GT0C 4G3WA 4NYUA 2H5SA 5D3OA 3U2AA 4EWFA 3P01A 3LZ1D 4OJLA 3KXBD 3IF6A 4NFTA 1NRFA 1CK3A 5C3IB 1ZLAA 4DF6A 5CPKA 2EX9A 3WS1A 1E6RA 2QZ6A 1ZLAC 4R8PA 1PZPA 3IXBA 1TF1A 2XR0A 1P3IC 2EXBA 3NQUA 3G35A 3LGOA 1W1PA 1MKIA 3IBRA 1K4FA 3LEQA 4YINA 3KUYB 4CAYB 4Z1WA 5GT3B 1OTBA 2C6WB 1Z2CB 4MDZA 3HUOA 4PKYG 1P3GB 4JF4A 4KZAA 5HL6A 1OJGA 1DY6A 3LO7A 2JKTM 3BLSA 2JCHA 3WRZA 5CPJA 4R0QA 5HX9A 1E6NA 3FKWA 3MF0A 4IBBA 3H7WA 1P9WA 1S32D 2Z2MB 3ZG0A 3CLOA 3LCEA 2Z6CA 5BS7C 3AV2A 2PD8A 3E4QA 3MGPA 3NDGA 1YMXA 4EO5C 1Z6FA 5BO0B 1DP9A 1K57C 4E3IA 4JXVA 5B2JD 2MJ6A 4Y5FA 4WBGA 4Z2MG 3AZGD 4J8WB 3AZHC 4WU9B 1P34A 3LELC 1W1TA 3P09A 5B24A 3BRMA 4N92A 1Z09A 1KE4A 2ZMFA 1ZC2A 4FUWA 3P7NA 1ES2A 3KUYD 5HDSA 4DE1A 1DRMA 4OJ5A 5G49B 4QLCD 2Z6DA 5CPKB 2QKPA 2R78A 5AY8B 1IYPA 2ZL1B 2RIQA 4NK3A 3REKC 3GR2A 5BNVA 3TW8A 2KLIA 4GDNA 3KYQA 1GPFA 1XGJA 2V1BA 2VV7A 3VSLA 4HGAB 5GSUC 3E2KA 4LV0A 2WYXA 4J8UB 1YU1A 4EESA 3ICYA 4X23D 4LENA 3C5AA 3AN2A 5FDHA 4NZ1A 3LZ0A 1P3GA 4CLCE 2VGLM 4Q0JA 3REKB 1T1BA 4J8XD 3M2KA 2ZC6B 4IBCA 5L10A 1FCOA 3B6GB 4N1HA 3S7PA 4BD0A 1MBLA 4PHTA 1P34C 4Z2MH 3DTKA 4S2KA 3KWQA 5B0YA 4J8WD 3HLWA 5CHJA 3E4OA 4M4XA 4RX2A 3D72A 3UE1A 1OTAA 5CHLB 1JWPA 1BH8A 1N9NA 1S1ZA 4P87A 1S4RA 3I7JA 3MGQB 4C6YA 5B1MB 3AZMD 3AZJA 3AFAC 2XQZA 1IYQA 4P6ZS 3CMZA 5DF8A 3MXQA 2VGJA 1WWSA 1E15A 1F66C 1OT6A 3AGDA 3MQLA 2BYMA 4KUDB 1ZG4A 2ZM8A 3PHYA 4HQAA 4WLAA 3LELB 1YU3A 1L0EA 1OMEA 5F5YA 2BASA 5HDDA 3D4FA 3WS2A 2FFFB 3A6NA 5FQMA 5AVCA 5F6AA 3MGPD 3REKD 1U35D 1H8PA 5EVIB 3UB8A 3O3VA 5GL9A 1S32A 4X69A 3U4LP 1P3BB 5EFWA 4G3KA 4BJPA 5F99D 2W3FA 2ZLYA 3BY8A 4S2JA 5KDMB 2O9CA 1GA0A 2X01A 4IBJA 4II7A 3X1UD 2W3DA 2FJ7A 3WX7A 3G6OA 4NXFA 4CPKA 4ZBJC 4R3BA 1YU0A 5G4YA 1TZYA 1P3AA 4LRXC 5JRGC 3E4PA 3LIBA 4LFUA 2AROA 4NKPA 1HQ3A 3IT9A 5M19A 3UTAC 2NQBC 2P9VA 1L0FA 1AOIB 2Y55A 3EG5B 3O5YA 3D9YA 4OKPA 1DJAA 2P74A 3MJQA 1OTDA 3H0RC 3BM6A 1F1EA 4OQHA 4B93A 5BNXB 4JGOA 4YM6D 5E2HA 3CUEA 1AWIA 5AV9D 4KZ6A 4E3KA 1FOFA 3AZLC 3LUQA 3PBQA 4IBXA 4KZ5A 4X53A 1T1CA 2PYOB 5DTKA 4RA7A 4UAAA 4H9OB 3AZNC 3B42A 5JYOA 3C1CB 4E44A 2IWCA 1PI4A 3RELC 4HNBA 4KG5A 4OOYA 1ERMA 4Y0OA 5CECA 5B31G 4HY8A 2G2WA 1L0GA 4R70A 3A3FA 4X25A 1P3LC 3R45A 1S32B 1P3KB 1KE3A 3AZFC 3W98D 5EVIA 4ZUXC 3MGRC 1ID3B 5CERA 1NRJA 4Y17A 5DJTA 4IBRA 4MMNA 4KQOA 5AVCD 1K0KA 1KOUA 5G18A 2AVXA 2OWHA 2HPBA 5B33C 3SH7A 1G6OA 4MBFA 4OP5A 2B95A 2XK1A 1GXDA 4EEPA 5FAQA 3O87A 2KDKA 4WM9A 5AVEA 5FAPA 4MLLA 2VLGA 4OLDA 1P3PD 3JVUA 3AZED 1PW1A 3LY3A 3T50A 4DRAA 3C1BB 2PYRA 1JTGA 1VQQA 3A6NC 1MWRA 3UO9A 1BSGA 3MVDC 5FEGA 1AOIA 1TS0A 4WYYA 1PYYA 4Z5TC 5FI2A 4Y0UA 1P3KC 2J8PA 1W8YA 1FR1A 2H28A 3LIDA 3BECA 3IQAA 1PNEA 2HJEA 3FG8A 1MPLA 1F66A 3BLMA 5AVBA 3LEZA 4H9NB 1E3UA 3CPTA 3AZKC 2CV5C 1M19C 1ES3A 2JKRM 3EPKA 4QU3A 5L07A 2ACGA 2WKRA 4I5SA 1TAFA 1P3BA 4IUKA 2FH5A 4JKTA 2F8NG 3C4OA 2JHEA 3VP0A 3REHB 2HUEB 4OQIA 3V50A 4JBFA 1S1YA 3E98A 2O9BA 3RXXA 3RELD 4O0PA 4R3JA 3G31A 1YSQA 3GECA 2V1ZA 3NECA 3AL0C 3JPUA 3IP4C 1LL5A 4QLCA 1T3UA 3C7UA 2F8NB 1XGIA 2DMWA 5E5AB 1TDGA 3HUNA 1H8MA 5B24B 3FKVA 3IX4A 3V39A 4HBUA 3MFDA 3ZCZA 4R1GA 5JYPA 3AZJB 4NZ4A 1FSYA 4H9SC 3H0MC 4IBFA 5C5KA 4C75A 2QHKA 1YU2A 3AZIC 2A49A 5GXQD 4EUZA 3QP6A 5B40C 1E4DA 4IBGA 1Y54A 2F8NA 4ZJ2A 4PM5A 2XGNA 4EETB 3AZHA 3V3RA 3L26A 3BWLA 3HBRA 4GKUA 1P3ID 5GHZA 4R38A 5GT3C 3HL9A 3W98B 1E3UD 4JJNC 4GJ4A 1B67A 1F66D 4GS9A 3EQUA 4X23B 1DJCA 3LIAA 4DDSA 3G34A 3M2JA 4JGRA 1MWUA 2VX8A 2ZM0A 2L1MA 2LB9A 3MMHA 2LB5A 3PYPA 3OPPA 4ZDXA 5CPIC 1S67L 4Z5TB 4F3LA 2W27A 1U35C 1XPBA 1XFQA 3N8LA 4Y7PA 1B6WA 3ZHHA 4JJND 3WWXA 5B32A 2H10A 1T1AA 4FCFA 4DQYB 3HONA 1K56A 4FOFA 4G91C 5E43A 1LT0A 3C1CD 3S22A 3N8RA 3B0CT 2XD1A 1M6KA 4XZQB 3F1NB 4P6BA 3UDXA 5CPKC 4OQGA 4CSRB 4ZUXD 3MGRD 2ZM2A 4FH2A 2WGIA 2M1CA 3F1OB 5GT0A 5AVBD 4Z66B 3T4KA 4WU8A 3LICA 4NY2A
chains in the Genus database with same CATH topology
4PMAA 5GHXA 1HD8A 4G92B 1PWDA 2ZD8A 4CAYA 2WKHA 3L2AA 1M18D 3WS5A 4FSFA 3MNNB 5DNMA 3AZFB 3X1UB 1NXYA 2HIOD 2J8YA 3TU4D 5HFOA 3G4PA 2ZY5A 1H5XA 3BYDA 4WMCA 3ITBA 3REIC 3O62C 1KX3D 3VH5W 2BLSA 5FAOA 5CPIB 1ONGA 1K4EA 1ZKJA 3MGQC 5B2JA 3MNNC 4PM6A 1K55C 4ZUXB 3MGRB 1ID3C 4OQ0A 2HP6A 4ZTKA 2EX6A 3X1VD 4OOLA 1BH8B 4IBEA 2QMIA 5AV5C 5EOEA 1M1AC 4OLGA 3X1SA 1KX3C 3X1UA 3DTMA 4XUJB 2Q9NA 2EX2A 3VP4A 1IYOA 5B31D 2XFSA 3AYWB 1N1JB 2Y2KA 3AZLB 3REHD 4GZBA 4EBPA 4E45A 5TR7A 3GMWA 3X1VA 3HLFA 3REKA 4DE3A 4N9LA 5J8XA 4OJOA 1MWSA 2PU4A 3RELB 5AV9A 1XX2A 4IEDA 2Y91A 5TGFA 3EQVA 4KGCC 3VP1A 4PM7A 3L28A 3M6HA 1YLJA 4Q8IA 3TG9A 3AV1C 3WA9A 4Z5TD 5B1LD 3REHC 2BYKB 4G92C 3TU4A 5DVAA 1M18A 5B40B 3N7WA 1HQ3D 4GDBA 3TU4C 2FFYA 1KU5A 3AZKD 3REHA 4KZBA 5B31A 1JTDA 2P9VB 3WA9C 4NE3A 2FJ7D 2HP5A 1H8ZA 1EI5A 4J8XA 2YFWA 4G91B 3MVDB 5AV5D 5B0ZB 1KVMA 3M6BA 3X1VC 5GT0B 3Q07A 5DTTA 3AZGC 3TSGA 1I5QA 5FATA 1KX4D 3NC8A 3FDDA 3B6FB 4WEKA 1KX5C 5AVCB 4FH4A 1KX3A 4WNNB 4DKIA 4WU8D 3ZGAB 2HDQA 2ZQCA 4OP8A 3KUYA 3KXBC 3HSHA 5E2EA 3WA9B 5GSUB 5E5AD 4C3QA 4R8PB 3MGQA 4OJPA 3GRJA 4EV4A 4BL3A 5AV6C 3SH8A 4E3JA 5A92A 3V9RA 3O62A 3WTPE 1BH9A 3RXWA 1ULYA 5B32D 1K55A 3REJB 3W8KA 1P3GD 3OPLA 3L27A 2C5WB 1KDSA 4UUZB 4H8RA 5E2FA 4S2PA 3C1CA 2QPNA 1O07A 4ZJ3A 5GXQA 3MZFA 3A1KA 4NZ5A 2L5AA 4LCLA 2Q9MA 3IH8A 4N9KA 3ISGA 4R8PD 5B32G 1W8QA 4H9NA 4E3LA 5M1AA 1KX5A 3SS3A 2F8ND 4IBDA 3AZGA 5JA4B 4YS3B 3KUYC 4EBNA 3O88A 3E2LA 1NJ4A 5B2IB 1HTZA 3PBTA 3SS5A 4WELA 3AFAD 4UA9A 4RX3A 1K38A 2W8SA 4NETA 2HP9A 3MGPB 3IF6B 4L0LA 3AN2B 5B31C 5F99B 3UN7A 5B32C 1YLZA 1P3FA 2PU2A 3VH6W 4KZ4A 4J8XC 4J8VB 4X68A 5AVBB 3G2YA 5GT3A 2EFXA 1BLSA 1G68A 1Q2QA 4ZAMA 3MGQD 3AYWA 2H0TA 2Y2PA 5I94A 1RGZA 4H9QA 4KUDC 5AV9C 1YQSA 2NZDC 3N8SA 5B40A 3NBLA 4HESA 4DE2A 2CV5D 1M19D 1NZUA 4YM6B 2XDMA 1XKZA 3W4QA 3GVBA 3HREA 3NCKA 5FQIA 3UPOA 3UTAB 1EWZA 5DNNC 1NYMA 2J9OA 3FYZA 1P3BD 3A3EA 5AV5A 3AZIA 2XEPA 4JXWA 4QLCB 3L29A 3WKJA 3W98A 4LD9B 5B0ZC 5EVID 3B6GC 4KG2A 3AZLD 1ID3A 3GTCA 4JF5A 4FD8A 3IWOA 3UPNA 2ZMAA 1IKGA 4QD4A 1XA7A 3CZDA 3V5MA 3REJA 5KSCA 3WRTA 1TAFB 5B1LC 5AQ7A 3UDFA 4DXBA 1P3FB 1E25A 4MBKA 2XD5A 5B2JB 3AGFA 4CSRA 1CEFA 1GHIA 3A6NB 3WTPD 2ZM5A 5B1MD 4WU9D 4OUIA 3VSKA 4ZBJB 4OPRA 5FA7A 3AZKA 4S2MA 2WK0A 3WAAB 5AV8A 4LD9D 5BOHA 5CEBA 3P5JB 3LZ1C 4H9RA 1ES5A 3LY4A 3PBNA 3AFAB 3NQJA 1JFIB 1I2WA 4KZ3A 5B1MA 4DRTA 4Z5TA 1BUEA 4YM6A 2H0YA 3H0LC 4LV3A 1P3KD 4P85A 2WUQA 4K91A 4ZBEA 5DNMD 3EPLA 3PBRA 4X6TA 5CEDA 4KHAB 3NQJB 1JFIA 5B0ZD 1WE4A 5AV5B 3WKJB 3HLCA 1GHPA 5GT0D 3AZNA 2PYOA 3C1BA 3N4IA 3WAAD 5AV6D 4QHCA 5A91A 1P3MA 3Q82A 1L0DA 5FUGB 3ZG5A 1TZYD 1M1AB 1HZOA 5AV9B 3MZEA 2Y2LA 3Q1FA 3LELD 1MY8A 4M3KA 2VGKA 4WU9C 3WAAC 3UDIA 4WMCD 1EQZA 4JJNA 1YLPA 2NQBA 3AN2D 3GQZA 3VH6T 1HQ3C 4J8VD 1DJBA 1P3AC 3WS0A 4GD6A 1YMSA 4H9SA 3QNCA 5FASA 2B5RA 3PAGA 2FJ7C 4Z66A 2Y2QA 4WZ5C 1LI0A 4HGAC 1ID3D 3VOYA 4JXGA 1S32C 3DW0A 4PPRA 5KMWA 5FQ9A 2CV5B 1M19B 4J8XB 4J8VC 5AY8C 5F1FA 2XF3A 5IHVA 4JJNB 4IVKA 3GSGA 4BL2A 3SH9A 4GN2A 1ES4A 3KWQD 4J8WA 1BZAA 3N6IA 4YFMA 4QLCC 1BT5A 2ZQ7A 1YM1A 4U0XA 5HAQA 1VM1A 5JRGD 2JBFA 1FQGA 1P3AB 1NY0A 3Q7VB 2CV5A 1M19A 1N9BA 5EUAA 2IO5C 4QNLA 1SCWA 1W5DA 2JC7A 5AQ9A 5CP6C 4PM9A 4X23A 5FQJA 4YS3C 5CPJD 5GLCA 1W7FA 3ZVTA 3MGSB 1GCEA 3CG5A 4X23C 1P3IB 1PWGA 4OPYA 2WGVA 5CRFA 3KWQC 4OJ6A 2J9PA 4QJGA 1R4VA 3G30A 4LV2A 4ZJ1A 4CJNA 3W99D 3LJAD 3EPJA 2NQBB 3AZEC 4J8WC 3AN2C 4OONA 3REJC 1U60A 3R45B 1P3KA 3B0DC 4UUZA 1ERQA 5B0YC 1YT4A 1P34D 1EQZB 2ZC7A 5KSHA 1PW8A 5HL1A 2ZY3A 3W98C 3LZ0C 3ZG7B 3AZEB 3JYIA 5FQKA 3UTAD 3VMAA 3OZHA 4XZQD 5EVIC 4A5RA 4N1XA 4KQRA 5GSUA 1KGGA 5FI6A 5B24C 1EROA 4B4XA 3Q81A 3PTEA 5E5AA 2G5HC 1KX5D 4P0MA 4O7DA 5F1GA 3S1YA 3UE3A 2ZC5B 3IHAA 2EFUA 1MXOA 5B33B 5DNMB 2UWXA 3AZFA 1P3LA 1H8YA 1M40A 3MGPC 3IXHA 4S2NC 1O7EA 4XUZA 3RELA 5F99C 5HW3A 3UTBC 5CPJC 1BLPA 1K6RA 1ZLAD 3AZLA 5G49A 2OLUA 1F66B 5CTNA 2G5IC 5BS7A 2Y2MA 3WTPB 3C1BC 4BD1A 4GNUA 1XA1A 5B2IC 5JRGA 3AZID 1QMEA 2XH9A 3O62D 1TZYC 5BNXA 2E8IA 3HLDA 4U0TA 1GHMA 4HBTA 1KX5B 5M18A 1NYYA 1WYCA 3MXSA 2IWDA 5BO0A 3UT9B 4KGCB 2AROC 3AV2B 3IF5A 1FCNA 4JLFA 3X1TB 5GLBA 4R8PC 3BEBA 4B4ZA 3VP3A 1TEMA 3X1VB 3AYWD 1LHYA 2CWEA 1ALQA 4IBKA 4EO5B 2OSUA 2WADA 1P3OA 3W97D 2AROD 5AVCC 1P3LD 5GXQC 1WYBA 2IWBA 4MBHA 3C1CC 1TVFA 3UTBA 3X1TA 3KFUG 3V3SA 3TU4B 4UPKA 5F99A 5CGWA 2BYKA 5GSUD 5EPHA 3AFAA 4XZQA 4S2NA 4H9PA 3A6ND 1ZG6A 1P3AD 1P3GC 1YU4A 1NZOA 3AV1B 3GV9A 4E3MA 2RVQD 5AV6A 5JRGB 5A93A 2Y2HA 3AZND 1RCJA 3KSYA 5E5AC 3DWZA 3MVDD 3MXRA 4MNRA 5A90A 4KHAA 2HIOC 4RVAA 3B6GA 2V20A 5B0ZA 2AROB 3LJAA 3W99A 5BPVA 2DRWA 4S2OA 4X55A 1IKIA 1GA9A 2Z2LB 3W99C 3LJAC 3B0DB 3MKEA 1KX4B 4WEJA 3ZNTA 1BLCA 5CTMA 3MGSA 2EXAA 3HVFA 1PIOA 1QMFA 1SDNA 4GHLA 5BNVB 4DDYA 1PWCA 5EOOA 3LZ0D 1FR6A 4JPMA 3MNND 4JF6A 5CP6D 3PAEA 4KUDA 1N4OA 5FSRA 4YS3D 3LELA 3AV2C 3VH5A 4KENB 3ITAA 4R23A 3BFFA 1HQ3B 5CPID 5JA4A 4YS3A 2IOUA 1K57A 5FQQA 4IJEA 5CP6A 1M18C 1TZYB 1CEGA 3AZMA 5AQBA 5HARA 1P3OC 3NIAA 2I72A 2Y2OA 3UT9C 4R4RA 3FWLA 1I2SA 2WKIA 1Q9CA 5DNNB 4UHUA 5B0YD 2R9XA 2GDNA 4M6BA 1S0WA 3LZ0B 1RGYA 3TOIA 4J8VA 1W2EA 4U3TA 4BENA 1KDWA 1P3IA 5B24D 4UA7A 3A3JA 3HUMA 5F82A 1JVJA 3V9RB 3O62B 4Z66C 2YFWB 4WZ4A 1M1AA 3LJAB 3W99B 5CHMA 3B6FC 4GD8A 2RCXA 2DQNC 4K0XA 2X71A 3IF6C 4IVIA 5B2IA 4GHAA 3BFGA 2HDSA 4KUDD 4HEFA 2HIOB 3AV2D 4KG6A 5B2JC 3MNNA 5TFQA 1P3MD 3WAAA 2RL3A 4WU9A 2PYOD 2PBYA 1KX3B 3IWQA 5CPKD 3REIA 3W96A 1LLBA 4WNNA 2YFVB 1W79A 5E2GA 4OVDA 1FSWA 3G2ZA 3OPHA 3W97A 1P3OD 1WWIA 2ZQ9A 2ZY4A 1P3MC 5EE8A 3VOZA 2Y2JA 3W4OA 1AXBA 2WAFA 1CI8A 3BFDA 3REIB 1ESUA 2F8NK 5CGSA 3IHBA 4J8UC 3QHYA 3KXBA 1IELA 4E6XA 3MBZA 3IH9A 1JWZA 4LD9A 1ZLAB 1KGFA 4PM8A 1A7WA 5DF9A 4KGCD 4GH9A 3B0BA 3QNBA 1PZOA 3AV1D 4Z9QA 4XUJC 5FUGA 5KZHA 5B1MC 4IBIA 4OPZA 1SKFA 2WAEA 3AZEA 1P3PA 3LZ1A 1RP5A 3VH5T 5CGXA 2ZC3B 1J9MA 3UE0A 3C4PA 2JE5A 3ZFZA 3NDEA 2ZY2A 3OPRA 1N1JA 4EBLA 3AZFD 2EX8A 1YLTA 3W4PA 4NYYA 2RVQC 1YUEA 1P3FD 2XFTA 5GLDA 3WKJD 1ONHA 4H9OA 3AV1A 1H3OB 3W97B 1JWVA 1BULA 1KX4C 1P3LB 4KGCA 1XXMA 2ZQ8A 3UY6A 1SDEA 3KS4A 2DF4C 3AZNB 5AY8A 5AV8B 4S2IA 5CXWA 4GB7A 3RJUA 2DNSA 5L2FA 3C1BD 1PZRA 3WA9D 1KVLA 4XUXA 2DCFA 3P98A 3UT9D 4WZ5A 3G32A 2WGWB 4XUJD 3X1SC 3IXDA 2G2UA 4LCMA 1KX4A 1H3OA 4LG2A 3S4XA 3SOIA 5GHYA 1EQZC 3W96D 3HLGA 4BQMA 4AWLB 1LI9A 2WGWA 4GOGA 3AYWC 4WV4B 1PI5A 4QY6A 1K54C 3AZHB 1FCMA 5AV6B 4R4SA 4DXCA 1LL9A 2XLNA 1M18B 1BFMA 3C7VA 1KGEA 5AVBC 3OC2A 1K25A 3FKEA 3NQUB 1P3FC 3ZVWA 1M1AD 3FV7A 2PYOC 3WTPA 5CP6B 1Q2PA 3IXGA 1L2SA 4E3OA 2VQRA 5HAPA 1C3BA 2X02A 2F2AC 2NZDD 4OPQA 1P3PC 4QY5A 4IJFA 5KDMA 1S6RA 4DE0A 2V2FF 2ZC4B 3OCNA 2HUEC 5GXQB 3VP2A 5B2ID 2WKEA 5B0YB 4Z66D 2OLVA 3MZDA 4OH0A 3B6FD 5B33A 3REID 1CI9A 5DNND 4YM6C 4KZ8A 3WTPC 1SHVA 3X1SD 5U47A 1KE0A 4ID4A 4WU8B 1YLYA 3NY4A 1YLWA 4ZUXA 3MGRA 1EQZD 1U35A 3ZNYA 2BYMB 3PBOA 4EQIA 1TDLA 4J8UA 2A3UA 3O86A 5CPIA 5AV8C 4KZ7A 4NE5A 2R9WA 3DWKA 1K54A 3Q7VA 4E3NA 2OV5A 4KZ9A 3OCLA 4D2OA 3W97C 4H9QB 4DRBA 5B32B 5B40D 2ZQDA 3KS8A 3AZJD 5B1LA 4WZSB 2LY8A 4UA6A 1IYSA 1XP4A 3VFFA 5B33D 3B6FA 4QB8A 5DF7A 4F94A 3MGSD 1U35B 3SS4A 5GT3D 1P3MB 2WZZA 2BG1A 4LV1A 1MWTA 4J8UD 3B6GD 4K0WA 2NQBD 3WKJC 4RYEA 3CJMA 2Y2NA 2ZQAA 4BLMA 3HLEA 5DNNA 3BFCA 3F6TA 5BT1D 1K56D 3AZGB 3AZMB 5AV8D 5EECA 2F8NH 3LZ1B 2Y59A 2NZDA 4XXRA 4E6WA 1HVBA 3UT9A 1P3BC 3KWQB 3AZKB 2J7VA 3AZMC 3VFHA 3AZJC 5F83A 3IWIA 5AY8D 5CPJB 5C3IC 3A1IA 3AGEA 5AQAA 2IO5B 2HDUA 2CC1A 3WS4A 4XUJA 5CHUA 1AOIC 3MVDA 3MKFA 1P3OB 3UNWA 3ZDJA 3UTBD 3MGSC 1BH9B 3FZCA 2ZJ9A 3L25A 5B31B 3NI9A 3A3IA 5EVLA 1ESIA 3EPHA 4AWLC 5GLAA 3BFEA 4JXSA 1P34B 4H9RB 3B3XA 3X1TD 5DTSA 3AZIB 3X1UC 4LD9C 5B1LB 3A3DA 3PBSA 2WZXA 3Q7ZA 4S2LA 5BT1C 1G6AA 4H9PB 2HIOA 3KXBB 4X56A 2NZDB 4MEZA 5HAIA 4B88A 3ZG8B 3W96C 3REJD 4OOMA 4WJ3C 3UTBB 2FJ7B 3X1TC 3ZG9B 2Y2IA 4Y0TA 2Y2GA 1K6SA 3N3FA 4NZ3A 5FI7A 4XZQC 1HTAA 2YFVA 3X1SB 1BTLA 5DNMC 3AZHD 3W96B 2JSSA 2HDRA 3VH6A 2Y4AA 3UPPA 1BLHA 4NE6A 1AOID 3UTAA 1IEMA 3HLBA 4KQQA 1P3PB 4WU8C 3B0CW 5GT0C 4EWFA 4NYUA 2H5SA 5D3OA 3LZ1D 4OJLA 3KXBD 3IF6A 4NFTA 1NRFA 1CK3A 5C3IB 1ZLAA 4DF6A 5CPKA 2EX9A 3WS1A 2QZ6A 1ZLAC 4R8PA 1PZPA 3IXBA 2XR0A 1P3IC 2EXBA 3NQUA 3G35A 1MKIA 1K4FA 4YINA 3KUYB 4CAYB 5GT3B 2C6WB 1Z2CB 3HUOA 1P3GB 4JF4A 4KZAA 1DY6A 3LO7A 3BLSA 2JCHA 3WRZA 5CPJA 4R0QA 5HX9A 3FKWA 4IBBA 1S32D 2Z2MB 3ZG0A 3LCEA 5BS7C 3AV2A 3MGPA 3NDGA 1YMXA 4EO5C 1Z6FA 5BO0B 1K57C 4E3IA 4JXVA 5B2JD 4WBGA 4Z2MG 3AZGD 4J8WB 3AZHC 4WU9B 1P34A 3LELC 3P09A 5B24A 3BRMA 4N92A 1KE4A 1ZC2A 1ES2A 3KUYD 4DE1A 4OJ5A 5G49B 4QLCD 5CPKB 5AY8B 1IYPA 2RIQA 4NK3A 3REKC 3GR2A 5BNVA 4GDNA 1XGJA 3VSLA 4HGAB 5GSUC 3E2KA 4LV0A 2WYXA 4J8UB 1YU1A 4X23D 4LENA 3C5AA 3AN2A 5FDHA 4NZ1A 3LZ0A 1P3GA 3REKB 4J8XD 3M2KA 2ZC6B 4IBCA 1FCOA 3B6GB 4N1HA 4BD0A 1MBLA 1P34C 4Z2MH 4S2KA 3KWQA 5B0YA 4J8WD 3HLWA 5CHJA 4RX2A 3UE1A 5CHLB 1JWPA 1BH8A 4P87A 3I7JA 3MGQB 4C6YA 5B1MB 3AZMD 3AZJA 3AFAC 2XQZA 1IYQA 3CMZA 5DF8A 2VGJA 1WWSA 1F66C 3AGDA 2BYMA 4KUDB 1ZG4A 2ZM8A 3LELB 1YU3A 1L0EA 1OMEA 3D4FA 3WS2A 2FFFB 3A6NA 5FQMA 5AVCA 3MGPD 3REKD 1U35D 5EVIB 3O3VA 5GL9A 1S32A 4X69A 1P3BB 4BJPA 5F99D 2ZLYA 4S2JA 5KDMB 1GA0A 2X01A 4IBJA 3X1UD 2FJ7A 3WX7A 4CPKA 4ZBJC 4R3BA 1YU0A 1TZYA 1P3AA 5JRGC 2AROA 1HQ3A 3IT9A 5M19A 3UTAC 2NQBC 2P9VA 2Y55A 1AOIB 1L0FA 3EG5B 4OKPA 1DJAA 2P74A 3H0RC 3BM6A 1F1EA 4OQHA 5BNXB 4YM6D 5E2HA 5AV9D 4KZ6A 4E3KA 1FOFA 3AZLC 3PBQA 4IBXA 4KZ5A 4X53A 2PYOB 5DTKA 4RA7A 4UAAA 4H9OB 3AZNC 5JYOA 3C1CB 4E44A 2IWCA 1PI4A 3RELC 4KG5A 4OOYA 1ERMA 4Y0OA 5CECA 5B31G 2G2WA 1L0GA 3A3FA 1P3LC 3R45A 1S32B 1P3KB 1KE3A 3AZFC 3W98D 5EVIA 4ZUXC 3MGRC 1ID3B 5CERA 4IBRA 4KQOA 5AVCD 5G18A 2HPBA 5B33C 3SH7A 4MBFA 4OP5A 2XK1A 5FAQA 3O87A 4WM9A 5FAPA 4MLLA 4OLDA 1P3PD 3AZED 1PW1A 3LY3A 4DRAA 3C1BB 1JTGA 1VQQA 3A6NC 1MWRA 3UO9A 1BSGA 3MVDC 1AOIA 4WYYA 1PYYA 4Z5TC 5FI2A 4Y0UA 1P3KC 2J8PA 1W8YA 1FR1A 3BECA 3IQAA 1MPLA 1F66A 3BLMA 5AVBA 3LEZA 4H9NB 1E3UA 3AZKC 2CV5C 1M19C 1ES3A 3EPKA 4QU3A 1TAFA 1P3BA 4JKTA 2F8NG 3C4OA 3VP0A 3REHB 2HUEB 4OQIA 3V50A 4JBFA 3RXXA 3RELD 4R3JA 3G31A 2V1ZA 3AL0C 3IP4C 1LL5A 4QLCA 1T3UA 3C7UA 2F8NB 1XGIA 5E5AB 1TDGA 3HUNA 3V39A 5B24B 3FKVA 4HBUA 3MFDA 3ZCZA 4R1GA 5JYPA 3AZJB 4NZ4A 1FSYA 4H9SC 3H0MC 4IBFA 4C75A 1YU2A 3AZIC 2A49A 5GXQD 4EUZA 5B40C 1E4DA 4IBGA 1Y54A 2F8NA 4ZJ2A 4PM5A 2XGNA 3AZHA 3V3RA 3L26A 3HBRA 4GKUA 1P3ID 5GHZA 5GT3C 3HL9A 3W98B 1E3UD 4JJNC 1B67A 1F66D 3EQUA 4X23B 1DJCA 4DDSA 3G34A 3M2JA 1MWUA 2ZM0A 3OPPA 4ZDXA 5CPIC 4Z5TB 1U35C 1XPBA 3N8LA 4Y7PA 1B6WA 3ZHHA 4JJND 3WWXA 5B32A 2H10A 4FCFA 4DQYB 3HONA 1K56A 4G91C 5E43A 3C1CD 3S22A 3N8RA 3B0CT 2XD1A 1M6KA 4XZQB 4P6BA 3UDXA 5CPKC 4OQGA 4CSRB 4ZUXD 3MGRD 2ZM2A 4FH2A 2WGIA 5GT0A 5AVBD 4Z66B 4WU8A 4NY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZO A;  1CI8 A;  3MZE A;  3Q1F A;  2Y2L A;  1HD8 A;  3BFD A;  4PMA A;  5GHX A;  3WS1 A;  1PWD A;  1ESU A;  2QZ6 A;  2ZD8 A;  1PZP A;  3IXB A;  1MY8 A;  2WKH A;  2XR0 A;  4M3K A;  2VGK A;  5CGS A;  3IHB A;  2EXB A;  3G35 A;  3QHY A;  1IEL A;  3UDI A;  1MKI A;  3MBZ A;  4WMC D;  4E6X A;  3WS5 A;  1K4F A;  4FSF A;  4YIN A;  1NXY A;  1YLP A;  2J8Y A;  2C6W B;  3GQZ A;  3HUO A;  1JWZ A;  3G4P A;  3IH9 A;  5HFO A;  1H5X A;  1DJB A;  3BYD A;  4JF4 A;  4WMC A;  4KZA A;  3ITB A;  1DY6 A;  3LO7 A;  3WS0 A;  3BLS A;  4GD6 A;  2JCH A;  1YMS A;  1KGF A;  4PM8 A;  3QNC A;  3WRZ A;  2BLS A;  5FAS A;  5DF9 A;  4R0Q A;  5FAO A;  5HX9 A;  2B5R A;  3FKW A;  3QNB A;  3PAG A;  1ONG A;  1PZO A;  1K4E A;  4Z9Q A;  2Y2Q A;  5KZH A;  1ZKJ A;  4WZ5 C;  1LI0 A;  2Z2M B;  3ZG0 A;  4PM6 A;  3LCE A;  1K55 C;  4OPZ A;  1SKF A;  3NDG A;  4OQ0 A;  2HP6 A;  1YMX A;  2WAE A;  4JXG A;  3VOY A;  3DW0 A;  4ZTK A;  1Z6F A;  1RP5 A;  2EX6 A;  4PPR A;  1K57 C;  4OOL A;  5KMW A;  5FQ9 A;  4E3I A;  4JXV A;  5CGX A;  2QMI A;  4WBG A;  5EOE A;  5F1F A;  2XF3 A;  2ZC3 B;  1J9M A;  4OLG A;  5IHV A;  3UE0 A;  3DTM A;  4IVK A;  3C4P A;  3GSG A;  4BL2 A;  2JE5 A;  3SH9 A;  2Q9N A;  2EX2 A;  4GN2 A;  3VP4 A;  1IYO A;  2XFS A;  1ES4 A;  2Y2K A;  3P09 A;  3BRM A;  1BZA A;  4GZB A;  3N6I A;  3NDE A;  4N92 A;  4YFM A;  3ZFZ A;  4EBP A;  1KE4 A;  1BT5 A;  2ZQ7 A;  1YM1 A;  1ZC2 A;  3OPR A;  4U0X A;  3GMW A;  1VM1 A;  3HLF A;  5TR7 A;  1ES2 A;  4EBL A;  5HAQ A;  2EX8 A;  2JBF A;  4DE3 A;  4DE1 A;  1FQG A;  1YLT A;  4N9L A;  3W4P A;  5J8X A;  1NY0 A;  3Q7V B;  1N9B A;  2XFT A;  1MWS A;  2PU4 A;  5EUA A;  5GLD A;  1IYP A;  1SCW A;  1W5D A;  2JC7 A;  4NK3 A;  1XX2 A;  1ONH A;  3GR2 A;  4IED A;  4PM9 A;  5AQ9 A;  2Y91 A;  4GDN A;  5TGF A;  3EQV A;  5FQJ A;  1JWV A;  1XGJ A;  1BUL A;  3VP1 A;  1XXM A;  4PM7 A;  3M6H A;  3VSL A;  1YLJ A;  5GLC A;  1W7F A;  2ZQ8 A;  3E2K A;  1GCE A;  2WYX A;  3CG5 A;  4LV0 A;  3TG9 A;  3ZVT A;  4Q8I A;  1PWG A;  3UY6 A;  4OPY A;  2WGV A;  1SDE A;  5CRF A;  2J9P A;  4LEN A;  4QJG A;  3C5A A;  4LV2 A;  3G30 A;  5FDH A;  5DVA A;  4S2I A;  5CXW A;  4ZJ1 A;  4GB7 A;  3N7W A;  3RJU A;  4CJN A;  2DNS A;  2ZC6 B;  3M2K A;  4GDB A;  5L2F A;  1FCO A;  4N1H A;  2FFY A;  4OON A;  4BD0 A;  1MBL A;  1KVL A;  4XUX A;  2DCF A;  1U60 A;  3P98 A;  4S2K A;  4WZ5 A;  3HLW A;  1ERQ A;  5CHJ A;  4KZB A;  3G32 A;  2WGW B;  1JTD A;  1YT4 A;  2P9V B;  3IXD A;  2G2U A;  5KSH A;  2ZC7 A;  4RX2 A;  2HP5 A;  4LCM A;  1PW8 A;  3UE1 A;  5HL1 A;  1H8Z A;  1EI5 A;  1JWP A;  3S4X A;  4P87 A;  3ZG7 B;  3I7J A;  4C6Y A;  3SOI A;  3JYI A;  2XQZ A;  5FQK A;  1IYQ A;  3CMZ A;  5DF8 A;  3VMA A;  2VGJ A;  5GHY A;  3OZH A;  1KVM A;  5EVI C;  3HLG A;  3M6B A;  3Q07 A;  5DTT A;  4N1X A;  4A5R A;  4BQM A;  4KQR A;  3TSG A;  1I5Q A;  1LI9 A;  2WGW A;  1KGG A;  3AGD A;  4GOG A;  5FAT A;  5FI6 A;  1ZG4 A;  3NC8 A;  1ERO A;  4B4X A;  2ZM8 A;  3Q81 A;  3PTE A;  4WEK A;  1PI5 A;  4P0M A;  4QY6 A;  1K54 C;  1FCM A;  1L0E A;  1OME A;  4FH4 A;  4O7D A;  5F1G A;  3S1Y A;  4R4S A;  3UE3 A;  1LL9 A;  2XLN A;  4DKI A;  2ZC5 B;  4DXC A;  3D4F A;  3WS2 A;  3C7V A;  2FFF B;  3ZGA B;  3IHA A;  2HDQ A;  1KGE A;  2EFU A;  1MXO A;  2ZQC A;  5FQM A;  4OP8 A;  2UWX A;  3OC2 A;  5EVI B;  1H8Y A;  3O3V A;  5GL9 A;  4X69 A;  1K25 A;  1M40 A;  5E2E A;  3IXH A;  4S2N C;  3ZVW A;  1O7E A;  4XUZ A;  4BJP A;  3FV7 A;  4C3Q A;  2ZLY A;  4S2J A;  1GA0 A;  2X01 A;  3GRJ A;  4EV4 A;  1Q2P A;  4BL3 A;  3IXG A;  4CPK A;  3SH8 A;  5HW3 A;  4E3J A;  5A92 A;  4R3B A;  1L2S A;  1BLP A;  1K6R A;  4E3O A;  5HAP A;  1C3B A;  2X02 A;  4OPQ A;  2OLU A;  4QY5 A;  3RXW A;  5CTN A;  3IT9 A;  1K55 A;  2Y2M A;  3W8K A;  5M19 A;  1S6R A;  4DE0 A;  2V2F F;  2ZC4 B;  3OCN A;  3OPL A;  2P9V A;  2Y55 A;  1L0F A;  3VP2 A;  2C5W B;  1XA1 A;  2WKE A;  2XH9 A;  1KDS A;  4GNU A;  1QME A;  4BD1 A;  2OLV A;  3MZD A;  4H8R A;  4OKP A;  1DJA A;  2P74 A;  5E2F A;  2E8I A;  3HLD A;  4OH0 A;  4U0T A;  3BM6 A;  1GHM A;  4OQH A;  4HBT A;  1CI9 A;  4S2P A;  2QPN A;  1O07 A;  5M18 A;  1NYY A;  4ZJ3 A;  1WYC A;  3MXS A;  4KZ8 A;  1SHV A;  5U47 A;  1KE0 A;  5E2H A;  2IWD A;  4ID4 A;  1YLY A;  3NY4 A;  4KZ6 A;  3MZF A;  4E3K A;  1YLW A;  1FOF A;  3IF5 A;  1FCN A;  4JLF A;  3ZNY A;  3PBO A;  4EQI A;  3PBQ A;  4LCL A;  1TDL A;  4IBX A;  2Q9M A;  3IH8 A;  4N9K A;  3ISG A;  5GLB A;  4KZ5 A;  4X53 A;  2A3U A;  3O86 A;  4KZ7 A;  1W8Q A;  2R9W A;  5DTK A;  3DWK A;  4RA7 A;  4UAA A;  5M1A A;  4E3L A;  3BEB A;  4B4Z A;  5JYO A;  1K54 A;  1TEM A;  3VP3 A;  2IWC A;  1PI4 A;  4KG5 A;  4OOY A;  1ERM A;  4Y0O A;  5CEC A;  1LHY A;  3Q7V A;  2G2W A;  3SS3 A;  4E3N A;  1ALQ A;  2OV5 A;  1L0G A;  4KZ9 A;  3A3F A;  3OCL A;  4D2O A;  1KE3 A;  2OSU A;  5EVI A;  2WAD A;  5CER A;  4EBN A;  3O88 A;  2ZQD A;  3E2L A;  4IBR A;  1NJ4 A;  1HTZ A;  1WYB A;  3PBT A;  4KQO A;  2IWB A;  3SS5 A;  4MBH A;  5G18 A;  4UA6 A;  4WEL A;  4UA9 A;  4RX3 A;  1IYS A;  2HPB A;  1XP4 A;  1K38 A;  3SH7 A;  3VFF A;  4MBF A;  4NET A;  4OP5 A;  4QB8 A;  1TVF A;  2HP9 A;  3IF6 B;  5DF7 A;  4F94 A;  3SS4 A;  4L0L A;  2XK1 A;  3V3S A;  5CGW A;  5FAQ A;  3O87 A;  5EPH A;  4WM9 A;  2WZZ A;  3UN7 A;  2BG1 A;  4MLL A;  1YLZ A;  4LV1 A;  5FAP A;  4S2N A;  2PU2 A;  4OLD A;  1MWT A;  1PW1 A;  1ZG6 A;  3LY3 A;  4KZ4 A;  4K0W A;  4X68 A;  1NZO A;  1JTG A;  1VQQ A;  3GV9 A;  4E3M A;  1MWR A;  3UO9 A;  1BSG A;  4RYE A;  3G2Y A;  5A93 A;  3CJM A;  2Y2N A;  2ZQA A;  2Y2H A;  2EFX A;  4BLM A;  1BLS A;  3HLE A;  1RCJ A;  4WYY A;  1G68 A;  1PYY A;  3BFC A;  1Q2Q A;  5FI2 A;  4Y0U A;  4ZAM A;  2H0T A;  3DWZ A;  1W8Y A;  1FR1 A;  2Y2P A;  3MXR A;  5I94 A;  4MNR A;  5A90 A;  1RGZ A;  4RVA A;  3BEC A;  3IQA A;  2V20 A;  1K56 D;  1MPL A;  3BLM A;  1YQS A;  3N8S A;  3LEZ A;  3NBL A;  1E3U A;  4HES A;  4DE2 A;  5EEC A;  1NZU A;  2DRW A;  2XDM A;  1ES3 A;  4S2O A;  4X55 A;  2Z2L B;  1IKI A;  1GA9 A;  2Y59 A;  4QU3 A;  3MKE A;  4XXR A;  1XKZ A;  4WEJ A;  4E6W A;  3W4Q A;  3ZNT A;  1BLC A;  4JKT A;  5CTM A;  2EXA A;  3GVB A;  3HRE A;  3HVF A;  1HVB A;  3NCK A;  1PIO A;  5FQI A;  3C4O A;  3VP0 A;  3UPO A;  1QMF A;  1SDN A;  1EWZ A;  4OQI A;  3V50 A;  4JBF A;  1NYM A;  2J9O A;  3FYZ A;  3RXX A;  4R3J A;  3G31 A;  2J7V A;  3A3E A;  4DDY A;  3VFH A;  2V1Z A;  1PWC A;  5EOO A;  2XEP A;  4JXW A;  5F83 A;  3IWI A;  1FR6 A;  4JF6 A;  4JPM A;  5EVI D;  3PAE A;  4KG2 A;  3AGE A;  1LL5 A;  3C7U A;  1N4O A;  1XGI A;  5FSR A;  5AQA A;  1TDG A;  3HUN A;  2HDU A;  2CC1 A;  3GTC A;  4JF5 A;  3V39 A;  3FKV A;  4FD8 A;  3IWO A;  3UPN A;  3WS4 A;  4HBU A;  3MFD A;  3ZCZ A;  4KEN B;  4R1G A;  2ZMA A;  1IKG A;  4QD4 A;  1XA7 A;  3CZD A;  5JYP A;  5CHU A;  3UNW A;  3MKF A;  3ITA A;  3V5M A;  3ZDJ A;  1FSY A;  4R23 A;  3BFF A;  5KSC A;  3WRT A;  1K57 A;  5FQQ A;  3FZC A;  4C75 A;  5AQ7 A;  2ZJ9 A;  1CEG A;  3UDF A;  4DXB A;  2A49 A;  5AQB A;  4EUZ A;  1E25 A;  5HAR A;  4MBK A;  2XD5 A;  1E4D A;  3AGF A;  3NI9 A;  3A3I A;  3NIA A;  5EVL A;  2I72 A;  1ESI A;  2Y2O A;  1CEF A;  1Y54 A;  4R4R A;  1GHI A;  5GLA A;  3BFE A;  1I2S A;  3FWL A;  4JXS A;  4ZJ2 A;  2WKI A;  4PM5 A;  2XGN A;  3B3X A;  3VSK A;  4UHU A;  3V3R A;  5DTS A;  3HBR A;  4GKU A;  5GHZ A;  4OPR A;  5FA7 A;  2R9X A;  3PBS A;  3A3D A;  2GDN A;  3HL9 A;  2WZX A;  4S2M A;  2WK0 A;  1S0W A;  3Q7Z A;  4S2L A;  1RGY A;  1E3U D;  3TOI A;  4DDS A;  5BOH A;  4U3T A;  4BEN A;  5CEB A;  1G6A A;  1KDW A;  3EQU A;  1ES5 A;  3LY4 A;  4X56 A;  1DJC A;  3PBN A;  4UA7 A;  1I2W A;  3A3J A;  3HUM A;  4KZ3 A;  1JVJ A;  4MEZ A;  5F82 A;  5HAI A;  3G34 A;  3M2J A;  3ZG8 B;  4B88 A;  1MWU A;  4DRT A;  1BUE A;  2ZM0 A;  2H0Y A;  4OOM A;  4WZ4 A;  3OPP A;  5CHM A;  4LV3 A;  4ZDX A;  3ZG9 B;  4GD8 A;  2RCX A;  4K0X A;  2Y2I A;  2X71 A;  4P85 A;  4Y0T A;  3IF6 C;  4IVI A;  2Y2G A;  1XPB A;  2WUQ A;  3N8L A;  1K6S A;  4K91 A;  4Y7P A;  4ZBE A;  3ZHH A;  3BFG A;  3WWX A;  2HDS A;  5FI7 A;  4HEF A;  3PBR A;  4KG6 A;  4X6T A;  2H10 A;  5CED A;  5TFQ A;  4FCF A;  1BTL A;  1K56 A;  1WE4 A;  2RL3 A;  2HDR A;  2PBY A;  5E43 A;  3IWQ A;  2Y4A A;  3UPP A;  1BLH A;  3S22 A;  3N8R A;  2XD1 A;  1LLB A;  1M6K A;  4P6B A;  3HLC A;  1GHP A;  3UDX A;  3N4I A;  1W79 A;  4QHC A;  5E2G A;  4OQG A;  1IEM A;  3HLB A;  4KQQ A;  4OVD A;  5A91 A;  1FSW A;  3G2Z A;  3OPH A;  4EWF A;  2H5S A;  2ZM2 A;  3Q82 A;  4FH2 A;  2WGI A;  5D3O A;  2ZQ9 A;  1L0D A;  3IF6 A;  3ZG5 A;  5EE8 A;  3VOZ A;  1NRF A;  2Y2J A;  3W4O A;  1CK3 A;  4DF6 A;  1AXB A;  2WAF A;  2EX9 A; 
#chains in the Genus database with same CATH topology
 4PMA A;  4I3J A;  5GHX A;  1HD8 A;  4G92 B;  4L9F A;  1PWD A;  2ZD8 A;  4CAY A;  3IS2 B;  2WKH A;  3IX3 A;  3L2A A;  4G3V A;  1M18 D;  3WS5 A;  4FSF A;  3MNN B;  5DNM A;  3AZF B;  3X1U B;  1NXY A;  2HIO D;  3CWF A;  2J8Y A;  3TU4 D;  5HPI A;  2XA7 S;  5HFO A;  3G4P A;  2ZY5 A;  1H5X A;  3BYD A;  3OBF A;  3BQ8 A;  4WMC A;  3ITB A;  4RQ9 A;  3REI C;  3O62 C;  1KX3 D;  3VH5 W;  1Y28 A;  2BLS A;  4MB3 A;  5FAO A;  3WD2 A;  4HJ6 A;  2NUT C;  1OGB A;  3WD1 A;  5CPI B;  1ONG A;  1K4E A;  1ZKJ A;  3MGQ C;  5B2J A;  3MNN C;  1TS8 A;  2D49 A;  4PM6 A;  1K55 C;  4ZUX B;  3MGR B;  1ID3 C;  4WUJ A;  4OQ0 A;  2HP6 A;  4ZTK A;  1TS7 A;  2EX6 A;  3X1V D;  4OOL A;  1BH8 B;  4X1M A;  5TJJ A;  4IBE A;  2QMI A;  5AV5 C;  5EOE A;  1M1A C;  1F5M A;  1CQA A;  3X1S A;  1KX3 C;  2VZW A;  2WKQ A;  3X1U A;  3C30 A;  2RTS A;  4OLG A;  3DTM A;  3CPT B;  3PXP A;  4XUJ B;  2Q9N A;  2EX2 A;  2L4R A;  3VP4 A;  1IYO A;  5B31 D;  2XFS A;  3AYW B;  1N1J B;  2Y2K A;  3AZL B;  3REH D;  4GZB A;  4EBP A;  2A24 A;  4E45 A;  3T4T A;  3KYZ A;  5TR7 A;  3OLO A;  1H0I A;  3GMW A;  3X1V A;  3HLF A;  3REK A;  4DE3 A;  4UQI S;  4N9L A;  5J8X A;  2Q0O A;  4OJO A;  5A8B A;  1MWS A;  2PU4 A;  2B02 A;  3MFX A;  3REL B;  5AV9 A;  1XX2 A;  4Z2H A;  4IED A;  2Y91 A;  3LYX A;  5TGF A;  3EQV A;  4HP4 A;  4KGC C;  3GDI A;  3VP1 A;  4PM7 A;  3L28 A;  3M6H A;  1YLJ A;  4Q8I A;  4L9G A;  2UV0 E;  3TG9 A;  3AV1 C;  3WA9 A;  1VB6 A;  4BBT A;  4Z5T D;  5B1L D;  3REH C;  2D01 A;  2BYK B;  4G92 C;  3TU4 A;  5DVA A;  1M18 A;  5B40 B;  3N7W A;  1HQ3 D;  4GDB A;  3TU4 C;  4WF0 A;  2FFY A;  1KU5 A;  3AZK D;  2D02 A;  3REH A;  4KZB A;  2VV6 A;  3UB5 P;  5B31 A;  1JTD A;  1Y4O A;  2P9V B;  3WA9 C;  4NE3 A;  2FJ7 D;  2HP5 A;  3HJK A;  5CX7 A;  1H8Z A;  1EI5 A;  4J8X A;  2YFW A;  4G91 B;  2P08 A;  3MVD B;  3LI8 A;  1NLY A;  5AV5 D;  4HOI A;  2V1A A;  5B0Z B;  3CI6 A;  3NJA A;  5HD5 A;  1KVM A;  3M6B A;  3X1V C;  5GT0 B;  3Q07 A;  5DTT A;  3AZG C;  3TSG A;  1I5Q A;  5FAT A;  1KX4 D;  3TE8 A;  2J3T C;  3NC8 A;  4R6L A;  3FDD A;  3B6F B;  1STZ A;  2ZOI A;  3QP2 A;  4WEK A;  1KX5 C;  5AVC B;  4FH4 A;  1KX3 A;  4WNN B;  4DKI A;  4WU8 D;  3ZGA B;  2HDQ A;  2ZQC A;  1MC0 A;  1L6J A;  1H3Q A;  4GHI B;  4OP8 A;  3KUY A;  3KXB C;  1D06 A;  4KQD A;  3HSH A;  4Z2G A;  5E2E A;  3VE4 A;  3WA9 B;  5GSU B;  1IOU A;  5E5A D;  4NEE D;  4C3Q A;  4R8P B;  3MGQ A;  4OJP A;  3GRJ A;  4EV4 A;  4BL3 A;  5AV6 C;  1P0Z A;  3SH8 A;  4E3J A;  5A92 A;  2P7J A;  3V9R A;  3O62 A;  1D1J A;  3WTP E;  1BH9 A;  3RXW A;  1ULY A;  3MQ0 A;  5B32 D;  1K55 A;  3REJ B;  3W8K A;  1P3G D;  3OPL A;  3L27 A;  2PR6 A;  2C5W B;  1KDS A;  4UUZ B;  2OAQ 1;  5HSQ A;  4H8R A;  5E2F A;  3RH8 B;  3KSI A;  1V9Z A;  4S2P A;  3C1C A;  2QPN A;  1O07 A;  1UGU A;  4ZJ3 A;  3B47 A;  5GXQ A;  2VJW A;  3MZF A;  2PRF A;  3S7O A;  3A1K A;  4NZ5 A;  2L5A A;  1QO6 A;  4LCL A;  4K08 A;  2Q9M A;  3IH8 A;  3T1S A;  4N9K A;  3ISG A;  4R8P D;  5B32 G;  1W8Q A;  4H9N A;  4E3L A;  5M1A A;  1KX5 A;  4I38 A;  5J4E A;  3SS3 A;  5DKL A;  2F8N D;  2W1T B;  4IBD A;  3AZG A;  5JA4 B;  4YS3 B;  3KUY C;  5I5L A;  4EBN A;  3NOU C;  5IU1 A;  3O88 A;  2QJ5 A;  3E2L A;  2ZOH A;  2QYB A;  4CLC B;  1NJ4 A;  3T12 B;  5B2I B;  1UR9 A;  2PHY A;  1HTZ A;  3PBT A;  3SS5 A;  4WEL A;  3AFA D;  4UA9 A;  4RX3 A;  1V9Y A;  5L8M A;  1K38 A;  3KSH A;  2W8S A;  4NET A;  2HP9 A;  3MGP B;  3IF6 B;  4L0L A;  3AN2 B;  5B31 C;  1ZHH B;  3NOT C;  5F99 B;  2FZ0 A;  3UN7 A;  5B32 C;  1YLZ A;  3PR6 A;  1P3F A;  2PU2 A;  3VH6 W;  4KZ4 A;  4J8X C;  4J8V B;  4X68 A;  4BWI A;  2W0N A;  5AVB B;  3G2Y A;  5GT3 A;  2EFX A;  4XT2 B;  1BLS A;  1G68 A;  1Q2Q A;  2I9V A;  4ZAM A;  3MGQ D;  3AYW A;  2H0T A;  1HLU P;  2Y2P A;  5I94 A;  1RGZ A;  4H9Q A;  2P04 A;  4KUD C;  2VV8 A;  2IA2 A;  4HJ3 A;  5AV9 C;  1YQS A;  2NZD C;  2GZA A;  3N8S A;  5B40 A;  3NBL A;  4HME A;  4LRZ E;  4HES A;  4DE2 A;  2XRO A;  2A2L A;  1NZU A;  2CV5 D;  1M19 D;  4YM6 B;  2XDM A;  4HIA A;  2PAV P;  1XKZ A;  3W4Q A;  2VKS A;  3MQQ A;  3GVB A;  3HRE A;  3NCK A;  5FQI A;  2XA7 M;  3VE3 A;  3UPO A;  3UTA B;  3L9K A;  1EWZ A;  1UWN X;  5DNN C;  1NYM A;  2HGV A;  2J9O A;  3FYZ A;  2EA9 A;  1P3B D;  3BW6 A;  3A3E A;  5AV5 A;  3AZI A;  2XEP A;  4JXW A;  4QLC B;  2V5O A;  3T4L A;  3L29 A;  1W63 M;  3WKJ A;  3W98 A;  4LD9 B;  5B0Z C;  5EVI D;  3B6G C;  4KG2 A;  1CF0 A;  4QPR A;  3AZL D;  1ID3 A;  3GTC A;  4JF5 A;  1DP8 A;  3QP4 A;  4FD8 A;  3IWO A;  3UPN A;  2ZMA A;  1IKG A;  4QD4 A;  1XA7 A;  5EM1 A;  3CZD A;  3V5M A;  3REJ A;  5KSC A;  3WRT A;  1TAF B;  2HZ5 A;  5B1L C;  1E6P A;  5AQ7 A;  3UDF A;  4DXB A;  4IHQ A;  5FL3 A;  1P3F B;  1E25 A;  5DFX A;  4MBK A;  2XD5 A;  5B2J B;  3AGF A;  4CSR A;  1CEF A;  2YKF A;  1GHI A;  3A6N B;  3WTP D;  2ZM5 A;  1YSP A;  5B1M D;  4WU9 D;  4OUI A;  3VSK A;  4ZBJ B;  4OPR A;  5FA7 A;  3AZK A;  4S2M A;  2WK0 A;  3WAA B;  5AV8 A;  1X0O A;  4MB5 A;  4LD9 D;  1OT9 A;  5BOH A;  5CEB A;  3P5J B;  3LZ1 C;  4Z2K A;  4KUO A;  3LR3 A;  4H9R A;  1ES5 A;  3LY4 A;  3PBN A;  3AFA B;  2J3T D;  3NQJ A;  1JFI B;  1I2W A;  4KZ3 A;  5B1M A;  4DRT A;  4Z5T A;  1BUE A;  4YM6 A;  1S66 L;  2H0Y A;  2PR5 A;  4AFI A;  5DJU A;  3H0L C;  4LV3 A;  1F98 A;  1P3K D;  4P85 A;  5HWT A;  2WUQ A;  4K91 A;  4ZBE A;  5DNM D;  3EPL A;  3PBR A;  4X6T A;  3SZT A;  5CED A;  1XJ2 A;  4KHA B;  3NQJ B;  1JFI A;  2GNX A;  3EGX C;  1XFN A;  5B0Z D;  1WE4 A;  1ED7 A;  5AV5 B;  1OPX A;  5IS1 A;  1MZU A;  3WKJ B;  3HLC A;  1GHP A;  4JGQ A;  4ESP A;  5GT0 D;  3AZN A;  2PYO A;  3C1B A;  3N4I A;  3WAA D;  5AV6 D;  4QHC A;  5A91 A;  1P3M A;  3WD0 A;  1KS0 A;  4MB4 A;  3Q82 A;  4H6J B;  1L0D A;  5FUG B;  3ZG5 A;  4IJG A;  1E6Z A;  1TZY D;  1M1A B;  2QJ7 A;  1HZO A;  3A0S A;  5AV9 B;  3MZE A;  2Y2L A;  3Q1F A;  4CLC A;  3LEL D;  1MY8 A;  4M3K A;  2VGK A;  1WA9 A;  4WU9 C;  3WAA C;  3UDI A;  4WMC D;  1EQZ A;  4JJN A;  1YLP A;  3EEH A;  2NQB A;  3AN2 D;  3S7Q A;  3GQZ A;  1OGG A;  3VH6 T;  1HQ3 C;  4J8V D;  1J3W A;  2HV1 A;  1DJB A;  1P3A C;  3WS0 A;  4GD6 A;  1YMS A;  4H9S A;  3QNC A;  5FAS A;  2B5R A;  3PAG A;  2FJ7 C;  4Z66 A;  2Y2Q A;  4WZ5 C;  1LI0 A;  4HGA C;  1ID3 D;  3VOY A;  4JXG A;  1S32 C;  3DW0 A;  2GX5 A;  4PPR A;  5KMW A;  3NOP C;  5FQ9 A;  2CV5 B;  1M19 B;  4J8X B;  4J8V C;  5AY8 C;  2FN2 A;  2JKG A;  4CQH A;  5F1F A;  2XF3 A;  5IHV A;  4JJN B;  4IVK A;  3GSG A;  4BL2 A;  3SH9 A;  4GN2 A;  3NHQ A;  1ES4 A;  3KWQ D;  4J8W A;  1BZA A;  3N6I A;  4YFM A;  4QLC C;  1BT5 A;  2ZQ7 A;  1YM1 A;  4U0X A;  1T18 A;  5HAQ A;  1VM1 A;  4HP9 A;  5JRG D;  4UEY A;  2JBF A;  2GJ3 A;  1FQG A;  1P3A B;  1NY0 A;  3Q7V B;  2CV5 A;  1M19 A;  1N9B A;  5EUA A;  2IO5 C;  4QNL A;  1SCW A;  1W5D A;  1UR8 A;  1OJ5 A;  2JC7 A;  5AQ9 A;  5CP6 C;  4PM9 A;  4X23 A;  3BQA A;  5FQJ A;  2W1R A;  4YS3 C;  5CPJ D;  5GLC A;  1W7F A;  3ZVT A;  3MGS B;  1GCE A;  3CG5 A;  4X23 C;  1P3I B;  1PWG A;  4OPY A;  2WGV A;  1LSV A;  5CRF A;  3KWQ C;  4OJ6 A;  2J9P A;  4HI4 A;  4QJG A;  1R4V A;  3G30 A;  4LV2 A;  4ZJ1 A;  5F69 A;  4CJN A;  3W99 D;  3LJA D;  3EPJ A;  2NQB B;  3AZE C;  4J8W C;  3AN2 C;  4OON A;  3REJ C;  3JVV A;  5LBR A;  3QP8 A;  1U60 A;  3R45 B;  1P3K A;  2ZMV A;  3B0D C;  4UUZ A;  1ERQ A;  4Q0I A;  5B0Y C;  2M7U A;  1YT4 A;  2NUP C;  1P34 D;  1EQZ B;  2ZC7 A;  5KSH A;  2K7S A;  2O0Y A;  4QWO A;  1PW8 A;  5HL1 A;  1L3L A;  2ZY3 A;  1A0K A;  2J3W A;  3W98 C;  4HH2 A;  3LZ0 C;  3ZG7 B;  5G4Z A;  1FIL A;  3AZE B;  3JYI A;  2V8C A;  5FQK A;  4P6Z M;  3UTA D;  3VMA A;  4WL9 A;  1CXW A;  3OZH A;  4XZQ D;  5EVI C;  5HWW A;  4A5R A;  4N1X A;  4KQR A;  3DTI A;  5GSU A;  1KGG A;  5FI6 A;  5B24 C;  1ERO A;  4B4X A;  3Q81 A;  2K2N A;  3PTE A;  1CK7 A;  5E5A A;  4GS9 B;  2G5H C;  1KX5 D;  4P0M A;  4Y3I A;  3LI9 A;  3E0Y A;  4O7D A;  5F1G A;  3S1Y A;  3UE3 A;  2ZC5 B;  1DP6 A;  3IHA A;  2EFU A;  1MXO A;  5B33 B;  2V8F A;  5DNM B;  2UWX A;  3AZF A;  1P3L A;  1H8Y A;  3F1P A;  3H82 A;  5L09 A;  4EER A;  1AIW A;  1M40 A;  3MGP C;  3IXH A;  4S2N C;  5EM0 A;  1O7E A;  4XUZ A;  4E04 A;  3REL A;  5HD3 A;  5F99 C;  3QP5 A;  5HW3 A;  3UTB C;  5CPJ C;  1BLP A;  1K6R A;  1ZLA D;  5J7E A;  4ETZ A;  3AZL A;  5G49 A;  3BY9 A;  2OLU A;  1F66 B;  5CTN A;  2G5I C;  5BS7 A;  3F1P B;  3H82 B;  5DFY A;  2Y2M A;  3WTP B;  3CUE C;  3C1B C;  1PRQ A;  4BD1 A;  1XA1 A;  5B2I C;  5JRG A;  2XH9 A;  3AZI D;  1QME A;  4GNU A;  3O62 D;  1TZY C;  5BNX A;  4MN5 A;  3ZQ5 A;  2E8I A;  3HLD A;  4GHI A;  1FIK A;  4U0T A;  1GHM A;  4MN6 A;  4HBT A;  1KX5 B;  4KUK A;  5M18 A;  1NYY A;  1WYC A;  3MXS A;  2IWD A;  2O99 A;  5BO0 A;  3UT9 B;  1IFQ A;  4KGC B;  2ARO C;  1PFL A;  4H6J A;  3AV2 B;  4Z2J A;  3IF5 A;  3T4O A;  1FCN A;  4JLF A;  3X1T B;  1S4S A;  2JN7 A;  1LSX A;  5GLB A;  2OAP 1;  2KX6 A;  1SKO A;  3WD4 A;  4R8P C;  3K3C A;  1F2K A;  3BEB A;  4B4Z A;  3VP3 A;  1TEM A;  4EW7 A;  3X1V B;  3AYW D;  4WN5 A;  1LHY A;  2CWE A;  1ALQ A;  4IBK A;  4EO5 B;  3C2W A;  3LIE A;  2OSU A;  2WAD A;  1P3O A;  3W97 D;  2ARO D;  5AVC C;  3FC7 A;  1H0M A;  1P3L D;  4X1L A;  5GXQ C;  3L7H A;  1WYB A;  4ZRR A;  5EV0 A;  2IWB A;  4MBH A;  2XSS A;  3C1C C;  1TVF A;  3UTB A;  3X1T A;  3KFU G;  1CJF A;  3V3S A;  3TU4 B;  4UPK A;  5F99 A;  5CGW A;  2BYK A;  1O6I A;  3ZYT A;  5GSU D;  5EPH A;  3AFA A;  4XZQ A;  3F1N A;  4S2N A;  4H9P A;  4L9E A;  3A6N D;  1ZG6 A;  1P3A D;  4ETX A;  1P3G C;  1YU4 A;  1NZO A;  3AV1 B;  3GV9 A;  4E3M A;  2RVQ D;  1VET A;  5AV6 A;  5JRG B;  5A93 A;  2Y2H A;  3AZN D;  1EAK A;  1RCJ A;  3KSY A;  5E5A C;  3DWZ A;  3MVD D;  3MXR A;  4MNR A;  5A90 A;  4KHA A;  2HIO C;  4RVA A;  2V20 A;  3B6G A;  5B0Z A;  2ARO B;  1W1V A;  4HJ4 A;  1EW0 A;  2VA0 A;  3LJA A;  3W99 A;  4EUV A;  3UME A;  5BPV A;  2DRW A;  4S2O A;  4X55 A;  1IKI A;  1GA9 A;  2Z2L B;  3W99 C;  3LJA C;  3MR0 A;  2M7V A;  3B0D B;  3MKE A;  1KX4 B;  4WEJ A;  3ZNT A;  1BLC A;  5CTM A;  1SKO B;  3MGS A;  2EXA A;  3BJN A;  3HVF A;  3H9W A;  1PIO A;  1W63 Q;  1QMF A;  1SDN A;  4GHL A;  5BNV B;  2HJ9 C;  4DDY A;  4TX8 A;  1PWC A;  5EOO A;  3LZ0 D;  1FR6 A;  4JF6 A;  3MNN D;  4JPM A;  2VEA A;  1NWZ A;  5CP6 D;  3PAE A;  4KUD A;  1N4O A;  5FSR A;  4YS3 D;  3LEL A;  3AV2 C;  3VH5 A;  5IT5 A;  4KEN B;  5MC7 A;  1TD5 A;  3ITA A;  3LR0 A;  4R23 A;  3T4J A;  3BFF A;  1HQ3 B;  5CPI D;  4I39 A;  4DN0 A;  5JA4 A;  4YS3 A;  3T1R A;  2IOU A;  1K57 A;  2O9A A;  4IJE A;  5FQQ A;  5CP6 A;  1M18 C;  1TZY B;  1CEG A;  1MKM A;  2YKH A;  3AZM A;  5AQB A;  5HAR A;  1P3O C;  3NIA A;  2I72 A;  2Y2O A;  2EWV A;  3UT9 C;  3H7W B;  3A0V A;  4R4R A;  3FWL A;  1I2S A;  2WKI A;  1Q9C A;  1LSW A;  4LLO B;  5DNN B;  4UHU A;  4LGW A;  3DAV A;  5B0Y D;  2EWW A;  1LL8 A;  4GCZ A;  2R9X A;  2GDN A;  4M6B A;  4D60 A;  1S0W A;  3LZ0 B;  4Y15 A;  3FPV A;  1RGY A;  4EEU A;  3TOI A;  4J8V A;  1W2E A;  4U3T A;  4BEN A;  1KDW A;  1P3I A;  3LIF A;  5B24 D;  5J3W A;  4UA7 A;  3A3J A;  3HUM A;  4R3A A;  1JVJ A;  5F82 A;  3V9R B;  3O62 B;  3TJZ C;  3K3D A;  4Z66 C;  2YFW B;  4WZ4 A;  1H0G A;  1M1A A;  3LJA B;  3W99 B;  2Y8H A;  5CHM A;  4CLC D;  4YWZ A;  3B6F C;  4GD8 A;  2RCX A;  2DQN C;  4K0X A;  2X71 A;  3IF6 C;  4IVI A;  3ULF A;  3MQO A;  5B2I A;  4GHA A;  4BBU A;  3BFG A;  2HDS A;  4KUD D;  4HEF A;  2HIO B;  3AV2 D;  4KG6 A;  3CAX A;  5B2J C;  3MNN A;  5TFQ A;  1P3M D;  4GLQ A;  2JKT I;  4HMC A;  2JKF A;  3WAA A;  2RL3 A;  4WU9 A;  2PYO D;  2PBY A;  1ODV A;  3R7W B;  1KX3 B;  4XT2 A;  3HCY A;  3IWQ A;  4YOF A;  3RTY A;  5CPK D;  3REI A;  2PD7 A;  3W96 A;  1LLB A;  4WNN A;  4NXG A;  4NXB A;  2YFV B;  1W79 A;  5E2G A;  4OVD A;  1FSW A;  3G2Z A;  3OPH A;  3W97 A;  1P3O D;  1WWI A;  2VGL S;  4ARZ B;  4EXO A;  2ZQ9 A;  2ZY4 A;  2OWJ A;  1JNU A;  1P3M C;  3UE6 A;  5EE8 A;  3VOZ A;  2Y2J A;  1E88 A;  1XJ6 A;  3W4O A;  1AXB A;  2WAF A;  1CI8 A;  2HF6 A;  3BFD A;  3REI B;  1ESU A;  2F8N K;  2B18 A;  5CGS A;  5HZH A;  3IHB A;  4Y2F A;  4J8U C;  3EOI A;  3QHY A;  3IBJ A;  3KXB A;  1IEL A;  4E6X A;  3MBZ A;  3IH9 A;  1JWZ A;  1VET B;  4LD9 A;  3VV4 A;  3UB7 A;  1ZLA B;  5HPF A;  3KSG A;  1ZTU A;  2E8J A;  1KGF A;  5HDC A;  4PM8 A;  1PDC A;  1A7W A;  5DF9 A;  4KGC D;  4GH9 A;  3B0B A;  3QNB A;  3TRC A;  5FEF A;  1PZO A;  3AV1 D;  3UMD A;  4Z9Q A;  4XUJ C;  5FUG A;  5KZH A;  5DKK A;  3QP1 A;  5B1M C;  4IBI A;  1GOI A;  4OPZ A;  1SKF A;  2WAE A;  3AZE A;  1P3P A;  3LZ1 A;  1RP5 A;  3VH5 T;  1N9L A;  3FPW A;  5CGX A;  2ZC3 B;  1J9M A;  3UE0 A;  4I3I A;  3C4P A;  5AJG A;  2JE5 A;  3ZFZ A;  3NDE A;  2ZY2 A;  3OPR A;  1N1J A;  4EBL A;  3AZF D;  2EX8 A;  3R4K A;  1YLT A;  3EGD C;  3W4P A;  4NYY A;  2RVQ C;  1YUE A;  1P3F D;  2XFT A;  5GLD A;  3WKJ D;  1J7M A;  1ONH A;  4H9O A;  3AV1 A;  1H3O B;  1N9O A;  2JKR I;  5KIZ A;  3W97 B;  1JWV A;  3CHW P;  1BUL A;  1KX4 C;  1P3L B;  4KGC A;  1XXM A;  2ZQ8 A;  1XJ3 A;  1BYW A;  2V0W A;  3UY6 A;  1SDE A;  3KS4 A;  2DF4 C;  2ZL1 A;  3EWK A;  3AZN B;  5AY8 A;  3R7W A;  5AV8 B;  4S2I A;  5CXW A;  4NG2 A;  4GB7 A;  3RJU A;  2DNS A;  5L2F A;  3C1B D;  4JGP A;  3K2N A;  1PZR A;  3WA9 D;  1KVL A;  4XUX A;  2DCF A;  3W2Z A;  3P98 A;  3UT9 D;  4WZ5 A;  3G32 A;  4XUJ D;  2WGW B;  3X1S C;  3IXD A;  2G2U A;  3T4S A;  4F3L B;  4LCM A;  1KX4 A;  1H3O A;  4LG2 A;  3IS2 A;  3S4X A;  3LR5 A;  3SOI A;  4ARZ A;  5GHY A;  1EQZ C;  3W96 D;  3HLG A;  4BQM A;  4AWL B;  2G7U A;  1LI9 A;  2WGW A;  4GOG A;  4Z2I A;  2ZBB A;  2VK3 A;  4EQ1 A;  4O8G A;  3AYW C;  4WV4 B;  1PI5 A;  4CLC C;  4QY6 A;  1K54 C;  4I3A A;  2V0U A;  4LPZ A;  3S7N A;  3AZH B;  1FCM A;  5AV6 B;  4R4S A;  4DXC A;  1LL9 A;  2XLN A;  1M18 B;  1BFM A;  3C7V A;  4O01 A;  1KGE A;  2PBD P;  5AVB C;  3SW1 A;  4DMZ A;  3KSF A;  3OC2 A;  3DBA A;  1K25 A;  3FKE A;  3NQU B;  1P3F C;  3ZVW A;  1YPR A;  1M1A D;  3FV7 A;  2PYO C;  3WTP A;  5CP6 B;  1Q2P A;  3D3O A;  3IXG A;  4DJ3 A;  2PDR A;  1GSX A;  1L2S A;  4E3O A;  2VQR A;  5HAP A;  1OTI A;  1C3B A;  2X02 A;  2F2A C;  2NZD D;  4FTX A;  4OPQ A;  1P3P C;  4QY5 A;  3V67 A;  4IJF A;  5KDM A;  1S6R A;  4DE0 A;  2V2F F;  2W3H A;  2W3E A;  2A24 B;  2HUE C;  5GXQ B;  2ZC4 B;  5B2I D;  3OCN A;  3VP2 A;  2WKE A;  4EU0 A;  5B0Y B;  3IX8 A;  4Z66 D;  1P97 A;  2OLV A;  3MZD A;  1VEU A;  2OOL A;  4OH0 A;  3B6F D;  5B33 A;  3REI D;  1CI9 A;  2BTF P;  2XRN A;  3LFV A;  4Z2L A;  5DNN D;  2V9A A;  4YM6 C;  4KZ8 A;  3WTP C;  1SHV A;  3X1S D;  5U47 A;  1KE0 A;  4ID4 A;  4WU8 B;  1YLY A;  3NY4 A;  4GW9 A;  1YLW A;  4ZUX A;  3MGR A;  1EQZ D;  1G28 A;  1U35 A;  5TBM B;  2BYM B;  3PBO A;  3ZNY A;  4EQI A;  2PYP A;  1TDL A;  4J8U A;  2A3U A;  3O86 A;  3DTE A;  5CPI A;  5AV8 C;  1GSW A;  3C38 A;  4YNR A;  4KZ7 A;  4NE5 A;  3T1X A;  2L0W A;  2R9W A;  3DWK A;  2J80 A;  1K54 A;  3KX0 X;  2INW A;  3T1Q B;  1TS6 A;  3Q7V A;  4E3N A;  2OV5 A;  4KZ9 A;  5AVF A;  3EEA A;  3OCL A;  4D2O A;  3W97 C;  1T19 A;  4H9Q B;  4DRB A;  5B32 B;  5B40 D;  2ZQD A;  5F68 A;  3KS8 A;  3AZJ D;  2W1T A;  5B1L A;  4WZS B;  2LY8 A;  4UA6 A;  1IYS A;  1XP4 A;  2K31 A;  1W1Y A;  1P9R A;  5B33 D;  3VFF A;  3B6F A;  4QB8 A;  5DF7 A;  4F94 A;  3MGS D;  1U35 B;  4LRY C;  5TBM A;  3SS4 A;  5GT3 D;  1P3M B;  2QWS A;  5HWV A;  3CIT A;  2WZZ A;  2BG1 A;  4LV1 A;  1GSV A;  2PT7 A;  1MWT A;  4J8U D;  3B6G D;  4K0W A;  2NQB D;  3WKJ C;  3KO6 A;  4RYE A;  3CJM A;  4Q0H A;  2Y2N A;  2ZQA A;  4BLM A;  3HLE A;  1F9I A;  3NUL A;  5DNN A;  1VEU B;  3BFC A;  3VOL A;  4Y13 A;  3UB6 A;  3F6T A;  4B9O A;  5BT1 D;  1K56 D;  3AZG B;  3AZM B;  5AV8 D;  5EEC A;  4HMD A;  2F8N H;  3LZ1 B;  2Y59 A;  2NZD A;  1YAX A;  4XXR A;  2CMN A;  4E6W A;  1VHM A;  1HVB A;  3UT9 A;  3HJI A;  1P3B C;  3LR4 A;  3KWQ B;  1XJ4 A;  3AZK B;  4NXE A;  2J7V A;  3AZM C;  3VFH A;  5K5B A;  3AZJ C;  1ACF A;  5F83 A;  3IWI A;  5AY8 D;  5CPJ B;  5C3I C;  3A1I A;  3AGE A;  5AQA A;  2IO5 B;  4BBV A;  3A0R A;  2HDU A;  2CC1 A;  3OOV A;  3WS4 A;  5EVE A;  4UQI M;  4XUJ A;  5CHU A;  5FDS A;  1AOI C;  3MSH A;  3MVD A;  3MKF A;  1P3O B;  3UNW A;  3ZDJ A;  3UTB D;  3T4Q A;  3MGS C;  1BH9 B;  3FZC A;  1SZV A;  3B33 A;  2ZJ9 A;  4MCW A;  4PKY A;  3F1O A;  3L25 A;  2KOI A;  5B31 B;  1D7E A;  2WKP A;  3NI9 A;  3A3I A;  5EVL A;  4BMW A;  1ESI A;  3EPH A;  4AWL C;  4DJ2 A;  5GLA A;  3BFE A;  4JXS A;  1P34 B;  4H9R B;  3B3X A;  3X1T D;  3WD3 A;  5DTS A;  3AZI B;  3UB9 A;  3MS6 A;  3X1U C;  4LD9 C;  5B1L B;  3A3D A;  3PBS A;  2WZX A;  1OTE A;  3Q7Z A;  1NLZ A;  4S2L A;  1E8B A;  4ME4 A;  5BT1 C;  1G6A A;  2W3G A;  4H9P B;  1G5U A;  2HIO A;  3KYE A;  3KXB B;  4HHD A;  4X56 A;  2NZD B;  4IUH A;  4MEZ A;  5HAI A;  4B88 A;  3ZG8 B;  3W96 C;  3REJ D;  4OOM A;  4HH3 A;  4WJ3 C;  3UTB B;  2FJ7 B;  3X1T C;  3ZG9 B;  2Y2I A;  4Y0T A;  2Y2G A;  1K6S A;  1UWP X;  3N3F A;  4NZ3 A;  5FI7 A;  4XZQ C;  1HTA A;  2YFV A;  3X1S B;  3RFB A;  1BTL A;  5DNM C;  3AZH D;  3W96 B;  2JSS A;  2HDR A;  3M7P A;  3VH6 A;  3C8C A;  4PAU A;  2Y4A A;  3UPP A;  1BLH A;  4MN7 A;  2Y79 A;  4NE6 A;  1AOI D;  3UTA A;  1IEM A;  3HLB A;  4KQQ A;  1P3P B;  1YKD A;  4WU8 C;  3B0C W;  5GT0 C;  4G3W A;  4NYU A;  2H5S A;  5D3O A;  3U2A A;  4EWF A;  3P01 A;  3LZ1 D;  4OJL A;  3KXB D;  3IF6 A;  4NFT A;  1NRF A;  1CK3 A;  5C3I B;  1ZLA A;  4DF6 A;  5CPK A;  2EX9 A;  3WS1 A;  1E6R A;  2QZ6 A;  1ZLA C;  4R8P A;  1PZP A;  3IXB A;  1TF1 A;  2XR0 A;  1P3I C;  2EXB A;  3NQU A;  3G35 A;  3LGO A;  1W1P A;  1MKI A;  3IBR A;  1K4F A;  3LEQ A;  4YIN A;  3KUY B;  4CAY B;  4Z1W A;  5GT3 B;  1OTB A;  2C6W B;  1Z2C B;  4MDZ A;  3HUO A;  4PKY G;  1P3G B;  4JF4 A;  4KZA A;  5HL6 A;  1OJG A;  1DY6 A;  3LO7 A;  2JKT M;  3BLS A;  2JCH A;  3WRZ A;  5CPJ A;  4R0Q A;  5HX9 A;  1E6N A;  3FKW A;  3MF0 A;  4IBB A;  3H7W A;  1P9W A;  1S32 D;  2Z2M B;  3ZG0 A;  3CLO A;  3LCE A;  2Z6C A;  5BS7 C;  3AV2 A;  2PD8 A;  3E4Q A;  3MGP A;  3NDG A;  1YMX A;  4EO5 C;  1Z6F A;  5BO0 B;  1DP9 A;  1K57 C;  4E3I A;  4JXV A;  5B2J D;  2MJ6 A;  4Y5F A;  4WBG A;  4Z2M G;  3AZG D;  4J8W B;  3AZH C;  4WU9 B;  1P34 A;  3LEL C;  1W1T A;  3P09 A;  5B24 A;  3BRM A;  4N92 A;  1Z09 A;  1KE4 A;  2ZMF A;  1ZC2 A;  4FUW A;  3P7N A;  1ES2 A;  3KUY D;  5HDS A;  4DE1 A;  1DRM A;  4OJ5 A;  5G49 B;  4QLC D;  2Z6D A;  5CPK B;  2QKP A;  2R78 A;  5AY8 B;  1IYP A;  2ZL1 B;  2RIQ A;  4NK3 A;  3REK C;  3GR2 A;  5BNV A;  3TW8 A;  2KLI A;  4GDN A;  3KYQ A;  1GPF A;  1XGJ A;  2V1B A;  2VV7 A;  3VSL A;  4HGA B;  5GSU C;  3E2K A;  4LV0 A;  2WYX A;  4J8U B;  1YU1 A;  4EES A;  3ICY A;  4X23 D;  4LEN A;  3C5A A;  3AN2 A;  5FDH A;  4NZ1 A;  3LZ0 A;  1P3G A;  4CLC E;  2VGL M;  4Q0J A;  3REK B;  1T1B A;  4J8X D;  3M2K A;  2ZC6 B;  4IBC A;  5L10 A;  1FCO A;  3B6G B;  4N1H A;  3S7P A;  4BD0 A;  1MBL A;  4PHT A;  1P34 C;  4Z2M H;  3DTK A;  4S2K A;  3KWQ A;  5B0Y A;  4J8W D;  3HLW A;  5CHJ A;  3E4O A;  4M4X A;  4RX2 A;  3D72 A;  3UE1 A;  1OTA A;  5CHL B;  1JWP A;  1BH8 A;  1N9N A;  1S1Z A;  4P87 A;  1S4R A;  3I7J A;  3MGQ B;  4C6Y A;  5B1M B;  3AZM D;  3AZJ A;  3AFA C;  2XQZ A;  1IYQ A;  4P6Z S;  3CMZ A;  5DF8 A;  3MXQ A;  2VGJ A;  1WWS A;  1E15 A;  1F66 C;  1OT6 A;  3AGD A;  3MQL A;  2BYM A;  4KUD B;  1ZG4 A;  2ZM8 A;  3PHY A;  4HQA A;  4WLA A;  3LEL B;  1YU3 A;  1L0E A;  1OME A;  5F5Y A;  2BAS A;  5HDD A;  3D4F A;  3WS2 A;  2FFF B;  3A6N A;  5FQM A;  5AVC A;  5F6A A;  3MGP D;  3REK D;  1U35 D;  1H8P A;  5EVI B;  3UB8 A;  3O3V A;  5GL9 A;  1S32 A;  4X69 A;  3U4L P;  1P3B B;  5EFW A;  4G3K A;  4BJP A;  5F99 D;  2W3F A;  2ZLY A;  3BY8 A;  4S2J A;  5KDM B;  2O9C A;  1GA0 A;  2X01 A;  4IBJ A;  4II7 A;  3X1U D;  2W3D A;  2FJ7 A;  3WX7 A;  3G6O A;  4NXF A;  4CPK A;  4ZBJ C;  4R3B A;  1YU0 A;  5G4Y A;  1TZY A;  1P3A A;  4LRX C;  5JRG C;  3E4P A;  3LIB A;  4LFU A;  2ARO A;  4NKP A;  1HQ3 A;  3IT9 A;  5M19 A;  3UTA C;  2NQB C;  2P9V A;  1L0F A;  1AOI B;  2Y55 A;  3EG5 B;  3O5Y A;  3D9Y A;  4OKP A;  1DJA A;  2P74 A;  3MJQ A;  1OTD A;  3H0R C;  3BM6 A;  1F1E A;  4OQH A;  4B93 A;  5BNX B;  4JGO A;  4YM6 D;  5E2H A;  3CUE A;  1AWI A;  5AV9 D;  4KZ6 A;  4E3K A;  1FOF A;  3AZL C;  3LUQ A;  3PBQ A;  4IBX A;  4KZ5 A;  4X53 A;  1T1C A;  2PYO B;  5DTK A;  4RA7 A;  4UAA A;  4H9O B;  3AZN C;  3B42 A;  5JYO A;  3C1C B;  4E44 A;  2IWC A;  1PI4 A;  3REL C;  4HNB A;  4KG5 A;  4OOY A;  1ERM A;  4Y0O A;  5CEC A;  5B31 G;  4HY8 A;  2G2W A;  1L0G A;  4R70 A;  3A3F A;  4X25 A;  1P3L C;  3R45 A;  1S32 B;  1P3K B;  1KE3 A;  3AZF C;  3W98 D;  5EVI A;  4ZUX C;  3MGR C;  1ID3 B;  5CER A;  1NRJ A;  4Y17 A;  5DJT A;  4IBR A;  4MMN A;  4KQO A;  5AVC D;  1K0K A;  1KOU A;  5G18 A;  2AVX A;  2OWH A;  2HPB A;  5B33 C;  3SH7 A;  1G6O A;  4MBF A;  4OP5 A;  2B95 A;  2XK1 A;  1GXD A;  4EEP A;  5FAQ A;  3O87 A;  2KDK A;  4WM9 A;  5AVE A;  5FAP A;  4MLL A;  2VLG A;  4OLD A;  1P3P D;  3JVU A;  3AZE D;  1PW1 A;  3LY3 A;  3T50 A;  4DRA A;  3C1B B;  2PYR A;  1JTG A;  1VQQ A;  3A6N C;  1MWR A;  3UO9 A;  1BSG A;  3MVD C;  5FEG A;  1AOI A;  1TS0 A;  4WYY A;  1PYY A;  4Z5T C;  5FI2 A;  4Y0U A;  1P3K C;  2J8P A;  1W8Y A;  1FR1 A;  2H28 A;  3LID A;  3BEC A;  3IQA A;  1PNE A;  2HJE A;  3FG8 A;  1MPL A;  1F66 A;  3BLM A;  5AVB A;  3LEZ A;  4H9N B;  1E3U A;  3CPT A;  3AZK C;  2CV5 C;  1M19 C;  1ES3 A;  2JKR M;  3EPK A;  4QU3 A;  5L07 A;  2ACG A;  2WKR A;  4I5S A;  1TAF A;  1P3B A;  4IUK A;  2FH5 A;  4JKT A;  2F8N G;  3C4O A;  2JHE A;  3VP0 A;  3REH B;  2HUE B;  4OQI A;  3V50 A;  4JBF A;  1S1Y A;  3E98 A;  2O9B A;  3RXX A;  3REL D;  4O0P A;  4R3J A;  3G31 A;  1YSQ A;  3GEC A;  2V1Z A;  3NEC A;  3AL0 C;  3JPU A;  3IP4 C;  1LL5 A;  4QLC A;  1T3U A;  3C7U A;  2F8N B;  1XGI A;  2DMW A;  5E5A B;  1TDG A;  3HUN A;  1H8M A;  5B24 B;  3FKV A;  3IX4 A;  3V39 A;  4HBU A;  3MFD A;  3ZCZ A;  4R1G A;  5JYP A;  3AZJ B;  4NZ4 A;  1FSY A;  4H9S C;  3H0M C;  4IBF A;  5C5K A;  4C75 A;  2QHK A;  1YU2 A;  3AZI C;  2A49 A;  5GXQ D;  4EUZ A;  3QP6 A;  5B40 C;  1E4D A;  4IBG A;  1Y54 A;  2F8N A;  4ZJ2 A;  4PM5 A;  2XGN A;  4EET B;  3AZH A;  3V3R A;  3L26 A;  3BWL A;  3HBR A;  4GKU A;  1P3I D;  5GHZ A;  4R38 A;  5GT3 C;  3HL9 A;  3W98 B;  1E3U D;  4JJN C;  4GJ4 A;  1B67 A;  1F66 D;  4GS9 A;  3EQU A;  4X23 B;  1DJC A;  3LIA A;  4DDS A;  3G34 A;  3M2J A;  4JGR A;  1MWU A;  2VX8 A;  2ZM0 A;  2L1M A;  2LB9 A;  3MMH A;  2LB5 A;  3PYP A;  3OPP A;  4ZDX A;  5CPI C;  1S67 L;  4Z5T B;  4F3L A;  2W27 A;  1U35 C;  1XPB A;  1XFQ A;  3N8L A;  4Y7P A;  1B6W A;  3ZHH A;  4JJN D;  3WWX A;  5B32 A;  2H10 A;  1T1A A;  4FCF A;  4DQY B;  3HON A;  1K56 A;  4FOF A;  4G91 C;  5E43 A;  1LT0 A;  3C1C D;  3S22 A;  3N8R A;  3B0C T;  2XD1 A;  1M6K A;  4XZQ B;  3F1N B;  4P6B A;  3UDX A;  5CPK C;  4OQG A;  4CSR B;  4ZUX D;  3MGR D;  2ZM2 A;  4FH2 A;  2WGI A;  2M1C A;  3F1O B;  5GT0 A;  5AVB D;  4Z66 B;  3T4K A;  4WU8 A;  3LIC A;  4NY2 A; 
#chains in the Genus database with same CATH homology
 4PMA A;  5GHX A;  1HD8 A;  4G92 B;  1PWD A;  2ZD8 A;  4CAY A;  2WKH A;  3L2A A;  1M18 D;  3WS5 A;  4FSF A;  3MNN B;  5DNM A;  3AZF B;  3X1U B;  1NXY A;  2HIO D;  2J8Y A;  3TU4 D;  5HFO A;  3G4P A;  2ZY5 A;  1H5X A;  3BYD A;  4WMC A;  3ITB A;  3REI C;  3O62 C;  1KX3 D;  3VH5 W;  2BLS A;  5FAO A;  5CPI B;  1ONG A;  1K4E A;  1ZKJ A;  3MGQ C;  5B2J A;  3MNN C;  4PM6 A;  1K55 C;  4ZUX B;  3MGR B;  1ID3 C;  4OQ0 A;  2HP6 A;  4ZTK A;  2EX6 A;  3X1V D;  4OOL A;  1BH8 B;  4IBE A;  2QMI A;  5AV5 C;  5EOE A;  1M1A C;  4OLG A;  3X1S A;  1KX3 C;  3X1U A;  3DTM A;  4XUJ B;  2Q9N A;  2EX2 A;  3VP4 A;  1IYO A;  5B31 D;  2XFS A;  3AYW B;  1N1J B;  2Y2K A;  3AZL B;  3REH D;  4GZB A;  4EBP A;  4E45 A;  5TR7 A;  3GMW A;  3X1V A;  3HLF A;  3REK A;  4DE3 A;  4N9L A;  5J8X A;  4OJO A;  1MWS A;  2PU4 A;  3REL B;  5AV9 A;  1XX2 A;  4IED A;  2Y91 A;  5TGF A;  3EQV A;  4KGC C;  3VP1 A;  4PM7 A;  3L28 A;  3M6H A;  1YLJ A;  4Q8I A;  3TG9 A;  3AV1 C;  3WA9 A;  4Z5T D;  5B1L D;  3REH C;  2BYK B;  4G92 C;  3TU4 A;  5DVA A;  1M18 A;  5B40 B;  3N7W A;  1HQ3 D;  4GDB A;  3TU4 C;  2FFY A;  1KU5 A;  3AZK D;  3REH A;  4KZB A;  5B31 A;  1JTD A;  2P9V B;  3WA9 C;  4NE3 A;  2FJ7 D;  2HP5 A;  1H8Z A;  1EI5 A;  4J8X A;  2YFW A;  4G91 B;  3MVD B;  5AV5 D;  5B0Z B;  1KVM A;  3M6B A;  3X1V C;  5GT0 B;  3Q07 A;  5DTT A;  3AZG C;  3TSG A;  1I5Q A;  5FAT A;  1KX4 D;  3NC8 A;  3FDD A;  3B6F B;  4WEK A;  1KX5 C;  5AVC B;  4FH4 A;  1KX3 A;  4WNN B;  4DKI A;  4WU8 D;  3ZGA B;  2HDQ A;  2ZQC A;  4OP8 A;  3KUY A;  3KXB C;  3HSH A;  5E2E A;  3WA9 B;  5GSU B;  5E5A D;  4C3Q A;  4R8P B;  3MGQ A;  4OJP A;  3GRJ A;  4EV4 A;  4BL3 A;  5AV6 C;  3SH8 A;  4E3J A;  5A92 A;  3V9R A;  3O62 A;  3WTP E;  1BH9 A;  3RXW A;  1ULY A;  5B32 D;  1K55 A;  3REJ B;  3W8K A;  1P3G D;  3OPL A;  3L27 A;  2C5W B;  1KDS A;  4UUZ B;  4H8R A;  5E2F A;  4S2P A;  3C1C A;  2QPN A;  1O07 A;  4ZJ3 A;  5GXQ A;  3MZF A;  3A1K A;  4NZ5 A;  2L5A A;  4LCL A;  2Q9M A;  3IH8 A;  4N9K A;  3ISG A;  4R8P D;  5B32 G;  1W8Q A;  4H9N A;  4E3L A;  5M1A A;  1KX5 A;  3SS3 A;  2F8N D;  4IBD A;  3AZG A;  5JA4 B;  4YS3 B;  3KUY C;  4EBN A;  3O88 A;  3E2L A;  1NJ4 A;  5B2I B;  1HTZ A;  3PBT A;  3SS5 A;  4WEL A;  3AFA D;  4UA9 A;  4RX3 A;  1K38 A;  2W8S A;  4NET A;  2HP9 A;  3MGP B;  3IF6 B;  4L0L A;  3AN2 B;  5B31 C;  5F99 B;  3UN7 A;  5B32 C;  1YLZ A;  1P3F A;  2PU2 A;  3VH6 W;  4KZ4 A;  4J8X C;  4J8V B;  4X68 A;  5AVB B;  3G2Y A;  5GT3 A;  2EFX A;  1BLS A;  1G68 A;  1Q2Q A;  4ZAM A;  3MGQ D;  3AYW A;  2H0T A;  2Y2P A;  5I94 A;  1RGZ A;  4H9Q A;  4KUD C;  5AV9 C;  1YQS A;  2NZD C;  3N8S A;  5B40 A;  3NBL A;  4HES A;  4DE2 A;  2CV5 D;  1M19 D;  1NZU A;  4YM6 B;  2XDM A;  1XKZ A;  3W4Q A;  3GVB A;  3HRE A;  3NCK A;  5FQI A;  3UPO A;  3UTA B;  1EWZ A;  5DNN C;  1NYM A;  2J9O A;  3FYZ A;  1P3B D;  3A3E A;  5AV5 A;  3AZI A;  2XEP A;  4JXW A;  4QLC B;  3L29 A;  3WKJ A;  3W98 A;  4LD9 B;  5B0Z C;  5EVI D;  3B6G C;  4KG2 A;  3AZL D;  1ID3 A;  3GTC A;  4JF5 A;  4FD8 A;  3IWO A;  3UPN A;  2ZMA A;  1IKG A;  4QD4 A;  1XA7 A;  3CZD A;  3V5M A;  3REJ A;  5KSC A;  3WRT A;  1TAF B;  5B1L C;  5AQ7 A;  3UDF A;  4DXB A;  1P3F B;  1E25 A;  4MBK A;  2XD5 A;  5B2J B;  3AGF A;  4CSR A;  1CEF A;  1GHI A;  3A6N B;  3WTP D;  2ZM5 A;  5B1M D;  4WU9 D;  4OUI A;  3VSK A;  4ZBJ B;  4OPR A;  5FA7 A;  3AZK A;  4S2M A;  2WK0 A;  3WAA B;  5AV8 A;  4LD9 D;  5BOH A;  5CEB A;  3P5J B;  3LZ1 C;  4H9R A;  1ES5 A;  3LY4 A;  3PBN A;  3AFA B;  3NQJ A;  1JFI B;  1I2W A;  4KZ3 A;  5B1M A;  4DRT A;  4Z5T A;  1BUE A;  4YM6 A;  2H0Y A;  3H0L C;  4LV3 A;  1P3K D;  4P85 A;  2WUQ A;  4K91 A;  4ZBE A;  5DNM D;  3EPL A;  3PBR A;  4X6T A;  5CED A;  4KHA B;  3NQJ B;  1JFI A;  5B0Z D;  1WE4 A;  5AV5 B;  3WKJ B;  3HLC A;  1GHP A;  5GT0 D;  3AZN A;  2PYO A;  3C1B A;  3N4I A;  3WAA D;  5AV6 D;  4QHC A;  5A91 A;  1P3M A;  3Q82 A;  1L0D A;  5FUG B;  3ZG5 A;  1TZY D;  1M1A B;  1HZO A;  5AV9 B;  3MZE A;  2Y2L A;  3Q1F A;  3LEL D;  1MY8 A;  4M3K A;  2VGK A;  4WU9 C;  3WAA C;  3UDI A;  4WMC D;  1EQZ A;  4JJN A;  1YLP A;  2NQB A;  3AN2 D;  3GQZ A;  3VH6 T;  1HQ3 C;  4J8V D;  1DJB A;  1P3A C;  3WS0 A;  4GD6 A;  1YMS A;  4H9S A;  3QNC A;  5FAS A;  2B5R A;  3PAG A;  2FJ7 C;  4Z66 A;  2Y2Q A;  4WZ5 C;  1LI0 A;  4HGA C;  1ID3 D;  3VOY A;  4JXG A;  1S32 C;  3DW0 A;  4PPR A;  5KMW A;  5FQ9 A;  2CV5 B;  1M19 B;  4J8X B;  4J8V C;  5AY8 C;  5F1F A;  2XF3 A;  5IHV A;  4JJN B;  4IVK A;  3GSG A;  4BL2 A;  3SH9 A;  4GN2 A;  1ES4 A;  3KWQ D;  4J8W A;  1BZA A;  3N6I A;  4YFM A;  4QLC C;  1BT5 A;  2ZQ7 A;  1YM1 A;  4U0X A;  5HAQ A;  1VM1 A;  5JRG D;  2JBF A;  1FQG A;  1P3A B;  1NY0 A;  3Q7V B;  2CV5 A;  1M19 A;  1N9B A;  5EUA A;  2IO5 C;  4QNL A;  1SCW A;  1W5D A;  2JC7 A;  5AQ9 A;  5CP6 C;  4PM9 A;  4X23 A;  5FQJ A;  4YS3 C;  5CPJ D;  5GLC A;  1W7F A;  3ZVT A;  3MGS B;  1GCE A;  3CG5 A;  4X23 C;  1P3I B;  1PWG A;  4OPY A;  2WGV A;  5CRF A;  3KWQ C;  4OJ6 A;  2J9P A;  4QJG A;  1R4V A;  3G30 A;  4LV2 A;  4ZJ1 A;  4CJN A;  3W99 D;  3LJA D;  3EPJ A;  2NQB B;  3AZE C;  4J8W C;  3AN2 C;  4OON A;  3REJ C;  1U60 A;  3R45 B;  1P3K A;  3B0D C;  4UUZ A;  1ERQ A;  5B0Y C;  1YT4 A;  1P34 D;  1EQZ B;  2ZC7 A;  5KSH A;  1PW8 A;  5HL1 A;  2ZY3 A;  3W98 C;  3LZ0 C;  3ZG7 B;  3AZE B;  3JYI A;  5FQK A;  3UTA D;  3VMA A;  3OZH A;  4XZQ D;  5EVI C;  4A5R A;  4N1X A;  4KQR A;  5GSU A;  1KGG A;  5FI6 A;  5B24 C;  1ERO A;  4B4X A;  3Q81 A;  3PTE A;  5E5A A;  2G5H C;  1KX5 D;  4P0M A;  4O7D A;  5F1G A;  3S1Y A;  3UE3 A;  2ZC5 B;  3IHA A;  2EFU A;  1MXO A;  5B33 B;  5DNM B;  2UWX A;  3AZF A;  1P3L A;  1H8Y A;  1M40 A;  3MGP C;  3IXH A;  4S2N C;  1O7E A;  4XUZ A;  3REL A;  5F99 C;  5HW3 A;  3UTB C;  5CPJ C;  1BLP A;  1K6R A;  1ZLA D;  3AZL A;  5G49 A;  2OLU A;  1F66 B;  5CTN A;  2G5I C;  5BS7 A;  2Y2M A;  3WTP B;  3C1B C;  4BD1 A;  4GNU A;  1XA1 A;  5B2I C;  5JRG A;  3AZI D;  1QME A;  2XH9 A;  3O62 D;  1TZY C;  5BNX A;  2E8I A;  3HLD A;  4U0T A;  1GHM A;  4HBT A;  1KX5 B;  5M18 A;  1NYY A;  1WYC A;  3MXS A;  2IWD A;  5BO0 A;  3UT9 B;  4KGC B;  2ARO C;  3AV2 B;  3IF5 A;  1FCN A;  4JLF A;  3X1T B;  5GLB A;  4R8P C;  3BEB A;  4B4Z A;  3VP3 A;  1TEM A;  3X1V B;  3AYW D;  1LHY A;  2CWE A;  1ALQ A;  4IBK A;  4EO5 B;  2OSU A;  2WAD A;  1P3O A;  3W97 D;  2ARO D;  5AVC C;  1P3L D;  5GXQ C;  1WYB A;  2IWB A;  4MBH A;  3C1C C;  1TVF A;  3UTB A;  3X1T A;  3KFU G;  3V3S A;  3TU4 B;  4UPK A;  5F99 A;  5CGW A;  2BYK A;  5GSU D;  5EPH A;  3AFA A;  4XZQ A;  4S2N A;  4H9P A;  3A6N D;  1ZG6 A;  1P3A D;  1P3G C;  1YU4 A;  1NZO A;  3AV1 B;  3GV9 A;  4E3M A;  2RVQ D;  5AV6 A;  5JRG B;  5A93 A;  2Y2H A;  3AZN D;  1RCJ A;  3KSY A;  5E5A C;  3DWZ A;  3MVD D;  3MXR A;  4MNR A;  5A90 A;  4KHA A;  2HIO C;  4RVA A;  3B6G A;  2V20 A;  5B0Z A;  2ARO B;  3LJA A;  3W99 A;  5BPV A;  2DRW A;  4S2O A;  4X55 A;  1IKI A;  1GA9 A;  2Z2L B;  3W99 C;  3LJA C;  3B0D B;  3MKE A;  1KX4 B;  4WEJ A;  3ZNT A;  1BLC A;  5CTM A;  3MGS A;  2EXA A;  3HVF A;  1PIO A;  1QMF A;  1SDN A;  4GHL A;  5BNV B;  4DDY A;  1PWC A;  5EOO A;  3LZ0 D;  1FR6 A;  4JPM A;  3MNN D;  4JF6 A;  5CP6 D;  3PAE A;  4KUD A;  1N4O A;  5FSR A;  4YS3 D;  3LEL A;  3AV2 C;  3VH5 A;  4KEN B;  3ITA A;  4R23 A;  3BFF A;  1HQ3 B;  5CPI D;  5JA4 A;  4YS3 A;  2IOU A;  1K57 A;  5FQQ A;  4IJE A;  5CP6 A;  1M18 C;  1TZY B;  1CEG A;  3AZM A;  5AQB A;  5HAR A;  1P3O C;  3NIA A;  2I72 A;  2Y2O A;  3UT9 C;  4R4R A;  3FWL A;  1I2S A;  2WKI A;  1Q9C A;  5DNN B;  4UHU A;  5B0Y D;  2R9X A;  2GDN A;  4M6B A;  1S0W A;  3LZ0 B;  1RGY A;  3TOI A;  4J8V A;  1W2E A;  4U3T A;  4BEN A;  1KDW A;  1P3I A;  5B24 D;  4UA7 A;  3A3J A;  3HUM A;  5F82 A;  1JVJ A;  3V9R B;  3O62 B;  4Z66 C;  2YFW B;  4WZ4 A;  1M1A A;  3LJA B;  3W99 B;  5CHM A;  3B6F C;  4GD8 A;  2RCX A;  2DQN C;  4K0X A;  2X71 A;  3IF6 C;  4IVI A;  5B2I A;  4GHA A;  3BFG A;  2HDS A;  4KUD D;  4HEF A;  2HIO B;  3AV2 D;  4KG6 A;  5B2J C;  3MNN A;  5TFQ A;  1P3M D;  3WAA A;  2RL3 A;  4WU9 A;  2PYO D;  2PBY A;  1KX3 B;  3IWQ A;  5CPK D;  3REI A;  3W96 A;  1LLB A;  4WNN A;  2YFV B;  1W79 A;  5E2G A;  4OVD A;  1FSW A;  3G2Z A;  3OPH A;  3W97 A;  1P3O D;  1WWI A;  2ZQ9 A;  2ZY4 A;  1P3M C;  5EE8 A;  3VOZ A;  2Y2J A;  3W4O A;  1AXB A;  2WAF A;  1CI8 A;  3BFD A;  3REI B;  1ESU A;  2F8N K;  5CGS A;  3IHB A;  4J8U C;  3QHY A;  3KXB A;  1IEL A;  4E6X A;  3MBZ A;  3IH9 A;  1JWZ A;  4LD9 A;  1ZLA B;  1KGF A;  4PM8 A;  1A7W A;  5DF9 A;  4KGC D;  4GH9 A;  3B0B A;  3QNB A;  1PZO A;  3AV1 D;  4Z9Q A;  4XUJ C;  5FUG A;  5KZH A;  5B1M C;  4IBI A;  4OPZ A;  1SKF A;  2WAE A;  3AZE A;  1P3P A;  3LZ1 A;  1RP5 A;  3VH5 T;  5CGX A;  2ZC3 B;  1J9M A;  3UE0 A;  3C4P A;  2JE5 A;  3ZFZ A;  3NDE A;  2ZY2 A;  3OPR A;  1N1J A;  4EBL A;  3AZF D;  2EX8 A;  1YLT A;  3W4P A;  4NYY A;  2RVQ C;  1YUE A;  1P3F D;  2XFT A;  5GLD A;  3WKJ D;  1ONH A;  4H9O A;  3AV1 A;  1H3O B;  3W97 B;  1JWV A;  1BUL A;  1KX4 C;  1P3L B;  4KGC A;  1XXM A;  2ZQ8 A;  3UY6 A;  1SDE A;  3KS4 A;  2DF4 C;  3AZN B;  5AY8 A;  5AV8 B;  4S2I A;  5CXW A;  4GB7 A;  3RJU A;  2DNS A;  5L2F A;  3C1B D;  1PZR A;  3WA9 D;  1KVL A;  4XUX A;  2DCF A;  3P98 A;  3UT9 D;  4WZ5 A;  3G32 A;  2WGW B;  4XUJ D;  3X1S C;  3IXD A;  2G2U A;  4LCM A;  1KX4 A;  1H3O A;  4LG2 A;  3S4X A;  3SOI A;  5GHY A;  1EQZ C;  3W96 D;  3HLG A;  4BQM A;  4AWL B;  1LI9 A;  2WGW A;  4GOG A;  3AYW C;  4WV4 B;  1PI5 A;  4QY6 A;  1K54 C;  3AZH B;  1FCM A;  5AV6 B;  4R4S A;  4DXC A;  1LL9 A;  2XLN A;  1M18 B;  1BFM A;  3C7V A;  1KGE A;  5AVB C;  3OC2 A;  1K25 A;  3FKE A;  3NQU B;  1P3F C;  3ZVW A;  1M1A D;  3FV7 A;  2PYO C;  3WTP A;  5CP6 B;  1Q2P A;  3IXG A;  1L2S A;  4E3O A;  2VQR A;  5HAP A;  1C3B A;  2X02 A;  2F2A C;  2NZD D;  4OPQ A;  1P3P C;  4QY5 A;  4IJF A;  5KDM A;  1S6R A;  4DE0 A;  2V2F F;  2ZC4 B;  3OCN A;  2HUE C;  5GXQ B;  3VP2 A;  5B2I D;  2WKE A;  5B0Y B;  4Z66 D;  2OLV A;  3MZD A;  4OH0 A;  3B6F D;  5B33 A;  3REI D;  1CI9 A;  5DNN D;  4YM6 C;  4KZ8 A;  3WTP C;  1SHV A;  3X1S D;  5U47 A;  1KE0 A;  4ID4 A;  4WU8 B;  1YLY A;  3NY4 A;  1YLW A;  4ZUX A;  3MGR A;  1EQZ D;  1U35 A;  3ZNY A;  2BYM B;  3PBO A;  4EQI A;  1TDL A;  4J8U A;  2A3U A;  3O86 A;  5CPI A;  5AV8 C;  4KZ7 A;  4NE5 A;  2R9W A;  3DWK A;  1K54 A;  3Q7V A;  4E3N A;  2OV5 A;  4KZ9 A;  3OCL A;  4D2O A;  3W97 C;  4H9Q B;  4DRB A;  5B32 B;  5B40 D;  2ZQD A;  3KS8 A;  3AZJ D;  5B1L A;  4WZS B;  2LY8 A;  4UA6 A;  1IYS A;  1XP4 A;  3VFF A;  5B33 D;  3B6F A;  4QB8 A;  5DF7 A;  4F94 A;  3MGS D;  1U35 B;  3SS4 A;  5GT3 D;  1P3M B;  2WZZ A;  2BG1 A;  4LV1 A;  1MWT A;  4J8U D;  3B6G D;  4K0W A;  2NQB D;  3WKJ C;  4RYE A;  3CJM A;  2Y2N A;  2ZQA A;  4BLM A;  3HLE A;  5DNN A;  3BFC A;  3F6T A;  5BT1 D;  1K56 D;  3AZG B;  3AZM B;  5AV8 D;  5EEC A;  2F8N H;  3LZ1 B;  2Y59 A;  2NZD A;  4XXR A;  4E6W A;  1HVB A;  3UT9 A;  1P3B C;  3KWQ B;  3AZK B;  2J7V A;  3AZM C;  3VFH A;  3AZJ C;  5F83 A;  3IWI A;  5AY8 D;  5CPJ B;  5C3I C;  3A1I A;  3AGE A;  5AQA A;  2IO5 B;  2HDU A;  2CC1 A;  3WS4 A;  4XUJ A;  5CHU A;  1AOI C;  3MVD A;  3MKF A;  1P3O B;  3UNW A;  3ZDJ A;  3UTB D;  3MGS C;  1BH9 B;  3FZC A;  2ZJ9 A;  3L25 A;  5B31 B;  3NI9 A;  3A3I A;  5EVL A;  1ESI A;  3EPH A;  4AWL C;  5GLA A;  3BFE A;  4JXS A;  1P34 B;  4H9R B;  3B3X A;  3X1T D;  5DTS A;  3AZI B;  3X1U C;  4LD9 C;  5B1L B;  3A3D A;  3PBS A;  2WZX A;  3Q7Z A;  4S2L A;  5BT1 C;  1G6A A;  4H9P B;  2HIO A;  3KXB B;  4X56 A;  2NZD B;  4MEZ A;  5HAI A;  4B88 A;  3ZG8 B;  3W96 C;  3REJ D;  4OOM A;  4WJ3 C;  3UTB B;  2FJ7 B;  3X1T C;  3ZG9 B;  2Y2I A;  4Y0T A;  2Y2G A;  1K6S A;  3N3F A;  4NZ3 A;  5FI7 A;  4XZQ C;  1HTA A;  2YFV A;  3X1S B;  1BTL A;  5DNM C;  3AZH D;  3W96 B;  2JSS A;  2HDR A;  3VH6 A;  2Y4A A;  3UPP A;  1BLH A;  4NE6 A;  1AOI D;  3UTA A;  1IEM A;  3HLB A;  4KQQ A;  1P3P B;  4WU8 C;  3B0C W;  5GT0 C;  4EWF A;  4NYU A;  2H5S A;  5D3O A;  3LZ1 D;  4OJL A;  3KXB D;  3IF6 A;  4NFT A;  1NRF A;  1CK3 A;  5C3I B;  1ZLA A;  4DF6 A;  5CPK A;  2EX9 A;  3WS1 A;  2QZ6 A;  1ZLA C;  4R8P A;  1PZP A;  3IXB A;  2XR0 A;  1P3I C;  2EXB A;  3NQU A;  3G35 A;  1MKI A;  1K4F A;  4YIN A;  3KUY B;  4CAY B;  5GT3 B;  2C6W B;  1Z2C B;  3HUO A;  1P3G B;  4JF4 A;  4KZA A;  1DY6 A;  3LO7 A;  3BLS A;  2JCH A;  3WRZ A;  5CPJ A;  4R0Q A;  5HX9 A;  3FKW A;  4IBB A;  1S32 D;  2Z2M B;  3ZG0 A;  3LCE A;  5BS7 C;  3AV2 A;  3MGP A;  3NDG A;  1YMX A;  4EO5 C;  1Z6F A;  5BO0 B;  1K57 C;  4E3I A;  4JXV A;  5B2J D;  4WBG A;  4Z2M G;  3AZG D;  4J8W B;  3AZH C;  4WU9 B;  1P34 A;  3LEL C;  3P09 A;  5B24 A;  3BRM A;  4N92 A;  1KE4 A;  1ZC2 A;  1ES2 A;  3KUY D;  4DE1 A;  4OJ5 A;  5G49 B;  4QLC D;  5CPK B;  5AY8 B;  1IYP A;  2RIQ A;  4NK3 A;  3REK C;  3GR2 A;  5BNV A;  4GDN A;  1XGJ A;  3VSL A;  4HGA B;  5GSU C;  3E2K A;  4LV0 A;  2WYX A;  4J8U B;  1YU1 A;  4X23 D;  4LEN A;  3C5A A;  3AN2 A;  5FDH A;  4NZ1 A;  3LZ0 A;  1P3G A;  3REK B;  4J8X D;  3M2K A;  2ZC6 B;  4IBC A;  1FCO A;  3B6G B;  4N1H A;  4BD0 A;  1MBL A;  1P34 C;  4Z2M H;  4S2K A;  3KWQ A;  5B0Y A;  4J8W D;  3HLW A;  5CHJ A;  4RX2 A;  3UE1 A;  5CHL B;  1JWP A;  1BH8 A;  4P87 A;  3I7J A;  3MGQ B;  4C6Y A;  5B1M B;  3AZM D;  3AZJ A;  3AFA C;  2XQZ A;  1IYQ A;  3CMZ A;  5DF8 A;  2VGJ A;  1WWS A;  1F66 C;  3AGD A;  2BYM A;  4KUD B;  1ZG4 A;  2ZM8 A;  3LEL B;  1YU3 A;  1L0E A;  1OME A;  3D4F A;  3WS2 A;  2FFF B;  3A6N A;  5FQM A;  5AVC A;  3MGP D;  3REK D;  1U35 D;  5EVI B;  3O3V A;  5GL9 A;  1S32 A;  4X69 A;  1P3B B;  4BJP A;  5F99 D;  2ZLY A;  4S2J A;  5KDM B;  1GA0 A;  2X01 A;  4IBJ A;  3X1U D;  2FJ7 A;  3WX7 A;  4CPK A;  4ZBJ C;  4R3B A;  1YU0 A;  1TZY A;  1P3A A;  5JRG C;  2ARO A;  1HQ3 A;  3IT9 A;  5M19 A;  3UTA C;  2NQB C;  2P9V A;  2Y55 A;  1AOI B;  1L0F A;  3EG5 B;  4OKP A;  1DJA A;  2P74 A;  3H0R C;  3BM6 A;  1F1E A;  4OQH A;  5BNX B;  4YM6 D;  5E2H A;  5AV9 D;  4KZ6 A;  4E3K A;  1FOF A;  3AZL C;  3PBQ A;  4IBX A;  4KZ5 A;  4X53 A;  2PYO B;  5DTK A;  4RA7 A;  4UAA A;  4H9O B;  3AZN C;  5JYO A;  3C1C B;  4E44 A;  2IWC A;  1PI4 A;  3REL C;  4KG5 A;  4OOY A;  1ERM A;  4Y0O A;  5CEC A;  5B31 G;  2G2W A;  1L0G A;  3A3F A;  1P3L C;  3R45 A;  1S32 B;  1P3K B;  1KE3 A;  3AZF C;  3W98 D;  5EVI A;  4ZUX C;  3MGR C;  1ID3 B;  5CER A;  4IBR A;  4KQO A;  5AVC D;  5G18 A;  2HPB A;  5B33 C;  3SH7 A;  4MBF A;  4OP5 A;  2XK1 A;  5FAQ A;  3O87 A;  4WM9 A;  5FAP A;  4MLL A;  4OLD A;  1P3P D;  3AZE D;  1PW1 A;  3LY3 A;  4DRA A;  3C1B B;  1JTG A;  1VQQ A;  3A6N C;  1MWR A;  3UO9 A;  1BSG A;  3MVD C;  1AOI A;  4WYY A;  1PYY A;  4Z5T C;  5FI2 A;  4Y0U A;  1P3K C;  2J8P A;  1W8Y A;  1FR1 A;  3BEC A;  3IQA A;  1MPL A;  1F66 A;  3BLM A;  5AVB A;  3LEZ A;  4H9N B;  1E3U A;  3AZK C;  2CV5 C;  1M19 C;  1ES3 A;  3EPK A;  4QU3 A;  1TAF A;  1P3B A;  4JKT A;  2F8N G;  3C4O A;  3VP0 A;  3REH B;  2HUE B;  4OQI A;  3V50 A;  4JBF A;  3RXX A;  3REL D;  4R3J A;  3G31 A;  2V1Z A;  3AL0 C;  3IP4 C;  1LL5 A;  4QLC A;  1T3U A;  3C7U A;  2F8N B;  1XGI A;  5E5A B;  1TDG A;  3HUN A;  3V39 A;  5B24 B;  3FKV A;  4HBU A;  3MFD A;  3ZCZ A;  4R1G A;  5JYP A;  3AZJ B;  4NZ4 A;  1FSY A;  4H9S C;  3H0M C;  4IBF A;  4C75 A;  1YU2 A;  3AZI C;  2A49 A;  5GXQ D;  4EUZ A;  5B40 C;  1E4D A;  4IBG A;  1Y54 A;  2F8N A;  4ZJ2 A;  4PM5 A;  2XGN A;  3AZH A;  3V3R A;  3L26 A;  3HBR A;  4GKU A;  1P3I D;  5GHZ A;  5GT3 C;  3HL9 A;  3W98 B;  1E3U D;  4JJN C;  1B67 A;  1F66 D;  3EQU A;  4X23 B;  1DJC A;  4DDS A;  3G34 A;  3M2J A;  1MWU A;  2ZM0 A;  3OPP A;  4ZDX A;  5CPI C;  4Z5T B;  1U35 C;  1XPB A;  3N8L A;  4Y7P A;  1B6W A;  3ZHH A;  4JJN D;  3WWX A;  5B32 A;  2H10 A;  4FCF A;  4DQY B;  3HON A;  1K56 A;  4G91 C;  5E43 A;  3C1C D;  3S22 A;  3N8R A;  3B0C T;  2XD1 A;  1M6K A;  4XZQ B;  4P6B A;  3UDX A;  5CPK C;  4OQG A;  4CSR B;  4ZUX D;  3MGR D;  2ZM2 A;  4FH2 A;  2WGI A;  5GT0 A;  5AVB D;  4Z66 B;  4WU8 A;  4NY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...