2FFSA

Structure of pr10-allergen-like protein pa1206 from pseudomonas aeruginosa pao1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
151
structure length
146
Chain Sequence
MQFEHLVQVNDRTLPVLDRLQLWEGLVCRAREPQYFVVGLERFEILVDDGDRLHRRLYLPGLVVEDEVVLKAPDSAHYSIKPSAEVAGGSLDMTIEEPEPGSLFVRFAYCTRYLQPDELPYDAFVKQAYIAMDVETIATIRDRFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PA1206
publication title Structure of PR10-Allergen-Like Protein PA1206 From Pseudomonas aeruginosa PAO1
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 31
structure length 146
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08982 DUF1857 Domain of unknown function (DUF1857)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 2ffsA00
4C9IA 2KTEA 3RT0C 4A81A 2E3OA 2WQLA 3NMVA 2L9PA 3KAYA 1UW5A 4DS8A 4IGVA 4JHIA 3NMNA 3H3SA 1T17A 3OH8A 1BV1A 2K7HA 4IH2A 4B9RA 5I8FA 2Z9YA 4REHA 4A84A 4IGWA 2FFSA 4IGYA 2A1LA 4RYVA 2LPXA 3UJLA 4A87A 2FLHA 4C9CA 3E85A 2KCZA 1TW0A 3C0VA 4N0GC 1LN1A 4MA6A 4JHHA 3KB3A 4N3EA 4M9WA 3OQUA 1ICXA 3NMPA 3UQHA 2K5GA 2LEQA 1XN6A 4R7KA 4BTZA 4WVOA 4XRTA 5AMWA 2LAKA 4IH0A 1ZXFA 5I9JA 3ZVUA 4A85A 3P9VA 1LN3A 4DSBA 3NMTA 1B6FA 4DSCA 2L65A 2PSOA 1XUVA 3PUTA 4C94A 2E3NA 2Q3QA 3NJOA 2NS9A 4QIPA 3KB0A 3RT2A 4LA7A 4BKDA 4A88A 3JRSA 4Y31A 1E09A 2E3SA 3KL1A 3NEFA 4XRWA 2E3QA 3RD6A 3QN1A 3JRQB 3W9RA 4BK6A 4Z3LA 1JSSA 4JDAA 4A8UA 3UIDA 2KF2A 2VNEA 5JNNA 3Q63A 5C9YA 5BRLA 4IGXA 5E4DA 3NEGA 1IFVA 4REIA 2KEWA 1VJHA 4A8GA 5E4MA 4A80A 2REZA 4M9BA 1XDFA 2GKDA 1X53A 1XFSA 1H2OA 2E3PA 1TXCA 4IHRA 3CNWA 3Q6AA 3PU2A 2LF2A 1T27A 2E3RA 2PCSA 1FSKA 3NR4A 5JO2A 3K90A 2L8OA 4A86A 2RERA 3OJIA 2M47A 4JDLA 2LUZA 5E4BA 4MAPA 3ELIA 3GGNA 3H3RA 4PSBA 2IL5A 2QIMA 4BK7A 2Z9ZA 3TFZA 1Z94A 4REJA 4BKCA 4Q0KA 3TL1A 3H3QA 2N4BA 2E3MA 1XN5A 3Q64A 1BTVA 1EM2A 3IE5A 4GY9A 2N4AA 1KCMA 3NJ0A 3TVQA 1QMRA 3KDIA 2LE1A 3IJTA 2MOUA 2EJXA 3P51A 2NN5A 2I9YA 3W9KA 1FM4A 3K3KA 4LGBA 3TVRA 4LG5A 2QPVA 3H3TA 3NMHA 3R6PA 2RESA 2BK0A 2R55A 4A8VA 1LN2A 2M89A 3FO5A 3WG8A 2VQ5A 3KAZA 3KDJA 3NI8A 3NJ1A 1LLTA 4JHGA 5E46A 3P0LA 2LCGA 3QSZA 2LIOA 3NS2A 2LDKA 3F08A 4LGAA 4A83A 4MNSA 2D4RA 3KDHA 4FPWA 4OICA 2LGHA 5JO1A 3KLXA 3OTLA
chains in the Genus database with same CATH superfamily
3NQNA 4C9IA 2KTEA 3RT0C 4A81A 2E3OA 2WQLA 3GKEA 2L9PA 3NMVA 3KAYA 1UW5A 4DS8A 4IGVA 4JHIA 3NMNA 3H3SA 1T17A 3OH8A 1BV1A 2K7HA 4IH2A 4N47A 4B9RA 5I8FA 2Z9YA 4REHA 4A84A 4IGWA 2FFSA 4IGYA 2A1LA 4RYVA 2LPXA 3UJLA 4A87A 2FLHA 4C9CA 3E85A 2KCZA 4E6FA 1TW0A 2YH6A 3C0VA 4N0GC 1LN1A 4MA6A 3DLHA 4JHHA 3KB3A 4N3EA 4M9WA 3HO1A 3OQUA 1ICXA 3NMPA 3UQHA 2K5GA 2LEQA 1XN6A 4R7KA 4KPYA 4BTZA 4WVOA 4XRTA 5AMWA 2LAKA 4IH0A 1ZXFA 4QDDA 5I9JA 3ZVUA 4A85A 3P9VA 1LN3A 2ZYLA 4QDFA 4DSBA 3NMTA 1B6FA 4DSCA 3GTEA 2L65A 2PSOA 1XUVA 3PUTA 4C94A 2E3NA 3GTSA 2Q3QA 3NJOA 2NS9A 4QIPA 3KB0A 3RT2A 4LA7A 4BKDA 4A88A 3JRSA 4Y31A 1E09A 2E3SA 3KL1A 4N76A 3NEFA 4XRWA 2E3QA 3RD6A 3QN1A 3JRQB 3W9RA 4BK6A 4Z3LA 3HK2A 1JSSA 4JDAA 4A8UA 3UIDA 2KF2A 2VNEA 5JNNA 3Q63A 5C9YA 5BRLA 4IGXA 5E4DA 3NEGA 1IFVA 4REIA 2KEWA 1VJHA 4A8GA 5E4MA 4A80A 2REZA 4M9BA 1XDFA 2GKDA 1X53A 1XFSA 1H2OA 2E3PA 1TXCA 4IHRA 3CNWA 3Q6AA 3PU2A 2LF2A 1T27A 2E3RA 2PCSA 1FSKA 3NR4A 3GL0A 5JO2A 3K90A 2L8OA 4A86A 2RERA 3OJIA 2M47A 4NCAA 4JDLA 2LUZA 5E4BA 4MAPA 3ELIA 3GGNA 3H3RA 4JHYA 4PSBA 2IL5A 2QIMA 4BK7A 2Z9ZA 3TFZA 1Z94A 4REJA 4QCKA 4BKCA 4Q0KA 3TL1A 3H3QA 2N4BA 2E3MA 1XN5A 3Q64A 1BTVA 1EM2A 3IE5A 4GY9A 2N4AA 1KCMA 3NJ0A 3TVQA 1QMRA 3DLBA 3KDIA 3HM9A 2LE1A 3IJTA 2MOUA 3GL2A 3HJFA 3GB4A 5EKQC 2EJXA 3HXMA 4QDFB 3TGOC 4NCBA 3P51A 2NN5A 2I9YA 3W9KA 2LAFA 1FM4A 3K3KA 4LGBA 3TVRA 4LG5A 2QPVA 3H3TA 3NMHA 3F73A 3R6PA 2RESA 2BK0A 2R55A 3GOBA 4A8VA 1LN2A 2M89A 3FO5A 3WG8A 2VQ5A 3KAZA 3KDJA 3NI8A 4QDCA 3NJ1A 1LLTA 4JHGA 5E46A 3P0LA 2LCGA 3QSZA 2LIOA 3NS2A 2LDKA 3F08A 4LGAA 4A83A 3HVRA 4MNSA 2D4RA 3KDHA 4FPWA 4N41A 4OICA 2LGHA 5JO1A 3KLXA 3OTLA
chains in the Genus database with same CATH topology
3NQNA 4C9IA 2KTEA 3RT0C 4A81A 2E3OA 2WQLA 3GKEA 2L9PA 3NMVA 3KAYA 1UW5A 4DS8A 4IGVA 4JHIA 3NMNA 3H3SA 1T17A 3OH8A 1BV1A 2K7HA 4IH2A 4N47A 4B9RA 5I8FA 2Z9YA 4REHA 4A84A 4IGWA 2FFSA 4IGYA 2A1LA 4RYVA 2LPXA 3UJLA 4A87A 2FLHA 4C9CA 3E85A 2KCZA 4E6FA 1TW0A 2YH6A 3C0VA 4N0GC 1LN1A 4MA6A 3DLHA 4JHHA 3KB3A 4N3EA 4M9WA 3HO1A 3OQUA 1ICXA 3NMPA 3UQHA 2K5GA 2LEQA 1XN6A 4R7KA 4KPYA 4BTZA 4WVOA 4XRTA 5AMWA 2LAKA 4IH0A 1ZXFA 4QDDA 5I9JA 3ZVUA 4A85A 3P9VA 1LN3A 2ZYLA 4QDFA 4DSBA 3NMTA 1B6FA 4DSCA 3GTEA 2L65A 2PSOA 1XUVA 3PUTA 4C94A 2E3NA 3GTSA 2Q3QA 3NJOA 2NS9A 4QIPA 3KB0A 3RT2A 4LA7A 4BKDA 4A88A 3JRSA 4Y31A 1E09A 2E3SA 3KL1A 4N76A 3NEFA 4XRWA 2E3QA 3RD6A 3QN1A 3JRQB 3W9RA 4BK6A 4Z3LA 3HK2A 1JSSA 4JDAA 4A8UA 3UIDA 2KF2A 2VNEA 5JNNA 3Q63A 5C9YA 5BRLA 4IGXA 5E4DA 3NEGA 1IFVA 4REIA 2KEWA 1VJHA 4A8GA 5E4MA 4A80A 2REZA 4M9BA 1XDFA 2GKDA 1X53A 1XFSA 1H2OA 2E3PA 1TXCA 4IHRA 3CNWA 3Q6AA 3PU2A 2LF2A 1T27A 2E3RA 2PCSA 1FSKA 3NR4A 3GL0A 5JO2A 3K90A 2L8OA 4A86A 2RERA 3OJIA 2M47A 4NCAA 4JDLA 2LUZA 5E4BA 4MAPA 3ELIA 3GGNA 3H3RA 4JHYA 4PSBA 2IL5A 2QIMA 4BK7A 2Z9ZA 3TFZA 1Z94A 4REJA 4QCKA 4BKCA 4Q0KA 3TL1A 3H3QA 2N4BA 2E3MA 1XN5A 3Q64A 1BTVA 1EM2A 3IE5A 4GY9A 2N4AA 1KCMA 3NJ0A 3TVQA 1QMRA 3DLBA 3KDIA 3HM9A 2LE1A 3IJTA 2MOUA 3GL2A 3HJFA 3GB4A 5EKQC 2EJXA 3HXMA 4QDFB 3TGOC 4NCBA 3P51A 2NN5A 2I9YA 3W9KA 2LAFA 1FM4A 3K3KA 4LGBA 3TVRA 4LG5A 2QPVA 3H3TA 3NMHA 3F73A 3R6PA 2RESA 2BK0A 2R55A 3GOBA 4A8VA 1LN2A 2M89A 3FO5A 3WG8A 2VQ5A 3KAZA 3KDJA 3NI8A 4QDCA 3NJ1A 1LLTA 4JHGA 5E46A 3P0LA 2LCGA 3QSZA 2LIOA 3NS2A 2LDKA 3F08A 4LGAA 4A83A 3HVRA 4MNSA 2D4RA 3KDHA 4FPWA 4N41A 4OICA 2LGHA 5JO1A 3KLXA 3OTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C9I A;  2KTE A;  3RT0 C;  4A81 A;  2E3O A;  2WQL A;  3NMV A;  2L9P A;  3KAY A;  1UW5 A;  4DS8 A;  4IGV A;  4JHI A;  3NMN A;  3H3S A;  1T17 A;  3OH8 A;  1BV1 A;  2K7H A;  4IH2 A;  4B9R A;  5I8F A;  2Z9Y A;  4REH A;  4A84 A;  4IGW A;  2FFS A;  4IGY A;  2A1L A;  4RYV A;  2LPX A;  3UJL A;  4A87 A;  2FLH A;  4C9C A;  3E85 A;  2KCZ A;  1TW0 A;  3C0V A;  4N0G C;  1LN1 A;  4MA6 A;  4JHH A;  3KB3 A;  4N3E A;  4M9W A;  3OQU A;  1ICX A;  3NMP A;  3UQH A;  2K5G A;  2LEQ A;  1XN6 A;  4R7K A;  4BTZ A;  4WVO A;  4XRT A;  5AMW A;  2LAK A;  4IH0 A;  1ZXF A;  5I9J A;  3ZVU A;  4A85 A;  3P9V A;  1LN3 A;  4DSB A;  3NMT A;  1B6F A;  4DSC A;  2L65 A;  2PSO A;  1XUV A;  3PUT A;  4C94 A;  2E3N A;  2Q3Q A;  3NJO A;  2NS9 A;  4QIP A;  3KB0 A;  3RT2 A;  4LA7 A;  4BKD A;  4A88 A;  3JRS A;  4Y31 A;  1E09 A;  2E3S A;  3KL1 A;  3NEF A;  4XRW A;  2E3Q A;  3RD6 A;  3QN1 A;  3JRQ B;  3W9R A;  4BK6 A;  4Z3L A;  1JSS A;  4JDA A;  4A8U A;  3UID A;  2KF2 A;  2VNE A;  5JNN A;  3Q63 A;  5C9Y A;  5BRL A;  4IGX A;  5E4D A;  3NEG A;  1IFV A;  4REI A;  2KEW A;  1VJH A;  4A8G A;  5E4M A;  4A80 A;  2REZ A;  4M9B A;  1XDF A;  2GKD A;  1X53 A;  1XFS A;  1H2O A;  2E3P A;  1TXC A;  4IHR A;  3CNW A;  3Q6A A;  3PU2 A;  2LF2 A;  1T27 A;  2E3R A;  2PCS A;  1FSK A;  3NR4 A;  5JO2 A;  3K90 A;  2L8O A;  4A86 A;  2RER A;  3OJI A;  2M47 A;  4JDL A;  2LUZ A;  5E4B A;  4MAP A;  3ELI A;  3GGN A;  3H3R A;  4PSB A;  2IL5 A;  2QIM A;  4BK7 A;  2Z9Z A;  3TFZ A;  1Z94 A;  4REJ A;  4BKC A;  4Q0K A;  3TL1 A;  3H3Q A;  2N4B A;  2E3M A;  1XN5 A;  3Q64 A;  1BTV A;  1EM2 A;  3IE5 A;  4GY9 A;  2N4A A;  1KCM A;  3NJ0 A;  3TVQ A;  1QMR A;  3KDI A;  2LE1 A;  3IJT A;  2MOU A;  2EJX A;  3P51 A;  2NN5 A;  2I9Y A;  3W9K A;  1FM4 A;  3K3K A;  4LGB A;  3TVR A;  4LG5 A;  2QPV A;  3H3T A;  3NMH A;  3R6P A;  2RES A;  2BK0 A;  2R55 A;  4A8V A;  1LN2 A;  2M89 A;  3FO5 A;  3WG8 A;  2VQ5 A;  3KAZ A;  3KDJ A;  3NI8 A;  3NJ1 A;  1LLT A;  4JHG A;  5E46 A;  3P0L A;  2LCG A;  3QSZ A;  2LIO A;  3NS2 A;  2LDK A;  3F08 A;  4LGA A;  4A83 A;  4MNS A;  2D4R A;  3KDH A;  4FPW A;  4OIC A;  2LGH A;  5JO1 A;  3KLX A;  3OTL A; 
#chains in the Genus database with same CATH topology
 3NQN A;  4C9I A;  2KTE A;  3RT0 C;  4A81 A;  2E3O A;  2WQL A;  3GKE A;  2L9P A;  3NMV A;  3KAY A;  1UW5 A;  4DS8 A;  4IGV A;  4JHI A;  3NMN A;  3H3S A;  1T17 A;  3OH8 A;  1BV1 A;  2K7H A;  4IH2 A;  4N47 A;  4B9R A;  5I8F A;  2Z9Y A;  4REH A;  4A84 A;  4IGW A;  2FFS A;  4IGY A;  2A1L A;  4RYV A;  2LPX A;  3UJL A;  4A87 A;  2FLH A;  4C9C A;  3E85 A;  2KCZ A;  4E6F A;  1TW0 A;  2YH6 A;  3C0V A;  4N0G C;  1LN1 A;  4MA6 A;  3DLH A;  4JHH A;  3KB3 A;  4N3E A;  4M9W A;  3HO1 A;  3OQU A;  1ICX A;  3NMP A;  3UQH A;  2K5G A;  2LEQ A;  1XN6 A;  4R7K A;  4KPY A;  4BTZ A;  4WVO A;  4XRT A;  5AMW A;  2LAK A;  4IH0 A;  1ZXF A;  4QDD A;  5I9J A;  3ZVU A;  4A85 A;  3P9V A;  1LN3 A;  2ZYL A;  4QDF A;  4DSB A;  3NMT A;  1B6F A;  4DSC A;  3GTE A;  2L65 A;  2PSO A;  1XUV A;  3PUT A;  4C94 A;  2E3N A;  3GTS A;  2Q3Q A;  3NJO A;  2NS9 A;  4QIP A;  3KB0 A;  3RT2 A;  4LA7 A;  4BKD A;  4A88 A;  3JRS A;  4Y31 A;  1E09 A;  2E3S A;  3KL1 A;  4N76 A;  3NEF A;  4XRW A;  2E3Q A;  3RD6 A;  3QN1 A;  3JRQ B;  3W9R A;  4BK6 A;  4Z3L A;  3HK2 A;  1JSS A;  4JDA A;  4A8U A;  3UID A;  2KF2 A;  2VNE A;  5JNN A;  3Q63 A;  5C9Y A;  5BRL A;  4IGX A;  5E4D A;  3NEG A;  1IFV A;  4REI A;  2KEW A;  1VJH A;  4A8G A;  5E4M A;  4A80 A;  2REZ A;  4M9B A;  1XDF A;  2GKD A;  1X53 A;  1XFS A;  1H2O A;  2E3P A;  1TXC A;  4IHR A;  3CNW A;  3Q6A A;  3PU2 A;  2LF2 A;  1T27 A;  2E3R A;  2PCS A;  1FSK A;  3NR4 A;  3GL0 A;  5JO2 A;  3K90 A;  2L8O A;  4A86 A;  2RER A;  3OJI A;  2M47 A;  4NCA A;  4JDL A;  2LUZ A;  5E4B A;  4MAP A;  3ELI A;  3GGN A;  3H3R A;  4JHY A;  4PSB A;  2IL5 A;  2QIM A;  4BK7 A;  2Z9Z A;  3TFZ A;  1Z94 A;  4REJ A;  4QCK A;  4BKC A;  4Q0K A;  3TL1 A;  3H3Q A;  2N4B A;  2E3M A;  1XN5 A;  3Q64 A;  1BTV A;  1EM2 A;  3IE5 A;  4GY9 A;  2N4A A;  1KCM A;  3NJ0 A;  3TVQ A;  1QMR A;  3DLB A;  3KDI A;  3HM9 A;  2LE1 A;  3IJT A;  2MOU A;  3GL2 A;  3HJF A;  3GB4 A;  5EKQ C;  2EJX A;  3HXM A;  4QDF B;  3TGO C;  4NCB A;  3P51 A;  2NN5 A;  2I9Y A;  3W9K A;  2LAF A;  1FM4 A;  3K3K A;  4LGB A;  3TVR A;  4LG5 A;  2QPV A;  3H3T A;  3NMH A;  3F73 A;  3R6P A;  2RES A;  2BK0 A;  2R55 A;  3GOB A;  4A8V A;  1LN2 A;  2M89 A;  3FO5 A;  3WG8 A;  2VQ5 A;  3KAZ A;  3KDJ A;  3NI8 A;  4QDC A;  3NJ1 A;  1LLT A;  4JHG A;  5E46 A;  3P0L A;  2LCG A;  3QSZ A;  2LIO A;  3NS2 A;  2LDK A;  3F08 A;  4LGA A;  4A83 A;  3HVR A;  4MNS A;  2D4R A;  3KDH A;  4FPW A;  4N41 A;  4OIC A;  2LGH A;  5JO1 A;  3KLX A;  3OTL A; 
#chains in the Genus database with same CATH homology
 3NQN A;  4C9I A;  2KTE A;  3RT0 C;  4A81 A;  2E3O A;  2WQL A;  3GKE A;  2L9P A;  3NMV A;  3KAY A;  1UW5 A;  4DS8 A;  4IGV A;  4JHI A;  3NMN A;  3H3S A;  1T17 A;  3OH8 A;  1BV1 A;  2K7H A;  4IH2 A;  4N47 A;  4B9R A;  5I8F A;  2Z9Y A;  4REH A;  4A84 A;  4IGW A;  2FFS A;  4IGY A;  2A1L A;  4RYV A;  2LPX A;  3UJL A;  4A87 A;  2FLH A;  4C9C A;  3E85 A;  2KCZ A;  4E6F A;  1TW0 A;  2YH6 A;  3C0V A;  4N0G C;  1LN1 A;  4MA6 A;  3DLH A;  4JHH A;  3KB3 A;  4N3E A;  4M9W A;  3HO1 A;  3OQU A;  1ICX A;  3NMP A;  3UQH A;  2K5G A;  2LEQ A;  1XN6 A;  4R7K A;  4KPY A;  4BTZ A;  4WVO A;  4XRT A;  5AMW A;  2LAK A;  4IH0 A;  1ZXF A;  4QDD A;  5I9J A;  3ZVU A;  4A85 A;  3P9V A;  1LN3 A;  2ZYL A;  4QDF A;  4DSB A;  3NMT A;  1B6F A;  4DSC A;  3GTE A;  2L65 A;  2PSO A;  1XUV A;  3PUT A;  4C94 A;  2E3N A;  3GTS A;  2Q3Q A;  3NJO A;  2NS9 A;  4QIP A;  3KB0 A;  3RT2 A;  4LA7 A;  4BKD A;  4A88 A;  3JRS A;  4Y31 A;  1E09 A;  2E3S A;  3KL1 A;  4N76 A;  3NEF A;  4XRW A;  2E3Q A;  3RD6 A;  3QN1 A;  3JRQ B;  3W9R A;  4BK6 A;  4Z3L A;  3HK2 A;  1JSS A;  4JDA A;  4A8U A;  3UID A;  2KF2 A;  2VNE A;  5JNN A;  3Q63 A;  5C9Y A;  5BRL A;  4IGX A;  5E4D A;  3NEG A;  1IFV A;  4REI A;  2KEW A;  1VJH A;  4A8G A;  5E4M A;  4A80 A;  2REZ A;  4M9B A;  1XDF A;  2GKD A;  1X53 A;  1XFS A;  1H2O A;  2E3P A;  1TXC A;  4IHR A;  3CNW A;  3Q6A A;  3PU2 A;  2LF2 A;  1T27 A;  2E3R A;  2PCS A;  1FSK A;  3NR4 A;  3GL0 A;  5JO2 A;  3K90 A;  2L8O A;  4A86 A;  2RER A;  3OJI A;  2M47 A;  4NCA A;  4JDL A;  2LUZ A;  5E4B A;  4MAP A;  3ELI A;  3GGN A;  3H3R A;  4JHY A;  4PSB A;  2IL5 A;  2QIM A;  4BK7 A;  2Z9Z A;  3TFZ A;  1Z94 A;  4REJ A;  4QCK A;  4BKC A;  4Q0K A;  3TL1 A;  3H3Q A;  2N4B A;  2E3M A;  1XN5 A;  3Q64 A;  1BTV A;  1EM2 A;  3IE5 A;  4GY9 A;  2N4A A;  1KCM A;  3NJ0 A;  3TVQ A;  1QMR A;  3DLB A;  3KDI A;  3HM9 A;  2LE1 A;  3IJT A;  2MOU A;  3GL2 A;  3HJF A;  3GB4 A;  5EKQ C;  2EJX A;  3HXM A;  4QDF B;  3TGO C;  4NCB A;  3P51 A;  2NN5 A;  2I9Y A;  3W9K A;  2LAF A;  1FM4 A;  3K3K A;  4LGB A;  3TVR A;  4LG5 A;  2QPV A;  3H3T A;  3NMH A;  3F73 A;  3R6P A;  2RES A;  2BK0 A;  2R55 A;  3GOB A;  4A8V A;  1LN2 A;  2M89 A;  3FO5 A;  3WG8 A;  2VQ5 A;  3KAZ A;  3KDJ A;  3NI8 A;  4QDC A;  3NJ1 A;  1LLT A;  4JHG A;  5E46 A;  3P0L A;  2LCG A;  3QSZ A;  2LIO A;  3NS2 A;  2LDK A;  3F08 A;  4LGA A;  4A83 A;  3HVR A;  4MNS A;  2D4R A;  3KDH A;  4FPW A;  4N41 A;  4OIC A;  2LGH A;  5JO1 A;  3KLX A;  3OTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...