2FFVA

Human ppgalnact-2 complexed with manganese and udp
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
499
structure length
489
Chain Sequence
DALKVRWPDFNQEAYVGGPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polypeptide N-acetylgalactosaminyltransferase 2
publication title Dynamic Association between the Catalytic and Lectin Domains of Human UDP-GalNAc:Polypeptide {alpha}-N-Acetylgalactosaminyltransferase-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 158
structure length 489
sequence length 499
chains with identical sequence B
ec nomenclature ec 2.4.1.41: Polypeptide N-acetylgalactosaminyltransferase.
pdb deposition date 2005-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2ffvA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2ffvA01
3CAHA 3FJFA 2HWMA 3JUTA 2MLLB 2NXVA 2PGYA 2WRYA 1S0FA 1DJSB 3SXCA 4I8MA 3ZC9A 2P73A 2ESUA 3WO3A 1FGGA 4QO3A 1G97A 1QQKA 4R7PA 5CMJA 3V0AB 3FJIA 1BFBA 4LO8B 1HCEA 1HM8A 4ZLBB 3OGZA 4YOLA 5C3AA 1INIA 5C8RA 1ISWA 2QKXA 1MP4A 1VGUA 2VSIA 3TQDA 4X39A 3UD8A 3C9ZA 1JYLA 5C4EA 4I3NA 1G9DA 4Z9WB 4I96A 4ZFUB 3NBCA 1ZJ2A 2X2TA 2VXLA 4FRHA 3CA6A 1WBCA 3NJ5A 3ST8A 3SXDA 3O3QA 3CKNA 5FZUA 2JCJA 1G82A 1NKHB 2L5XA 4KT7A 2FGFA 3N0KA 4ZFYB 5C47A 3O44A 5CQPA 3V8ZA 5L6VA 2OI6A 1AVUA 4NANA 2KH2A 2ZQOA 3I29B 1NZKA 1J0SA 4ZFWB 1G2VA 1JQZA 2APCA 3Q7XA 2JCKA 1DZCA 4HG6A 4JD0A 3V0AA 2QH5A 4Y7TA 5EG6C 1YP3A 3SNVA 2E4MC 2GZBA 3PG0A 3D8VA 4KNRA 2OEGA 3ZGFA 3CU0A 1Z0HA 2NYYA 3I2XA 4J2SA 2FYBA 2FYCB 1BASA 2XWNA 5CQNX 4LO1C 3CQAA 4Y62A 3BAUA 1Z2VA 2P6WA 2YESA 4JAWA 4I4QA 2JCLA 4B5BA 1L2HA 4JRAA 1WSZA 1JT3A 2GGOA 4AYJA 3PUBA 1GQ9A 5C1GA 4EEOA 1E5KA 4I4YA 1BARA 3R2WA 3T7NA 5BP5A 5F90A 2AFGA 3OH3A 4L41C 2V0KA 4D11A 1IRAX 1BFCA 1ISVA 2QYIB 4KBBA 1LZ7A 4J23B 1TIEA 3CA3A 1QGQA 3ILAA 1KWSA 1YP2A 3R3IA 3GUEA 4JP0A 2K8RA 4GP3A 3IOHA 1GGPB 1TTUA 2D24A 5BXCA 2YQSA 2D0JA 4Q9PA 1IINA 2ZU9A 3CA5A 1NF5B 4FRLA 1ON8A 2W0VA 3FJCA 2RJ9A 4ASJA 1ISXA 1PUMB 5E24E 1ZDFA 5F8YA 2YQCA 3V0LA 5CMIA 4J2XA 4G3SA 3WINA 1V84A 4OEEA 1G23A 1K4VA 4CJCA 5IDTA 1PUUB 3A21A 4HJJA 4QBCA 3ZX7A 3BRKX 3H6RB 4USPA 1ONKB 2WGZA 4H04A 1QWJA 2CU2A 4A7YA 4Y9XA 3UJ0A 4ECMA 2I1BA 1JV1A 3E25A 4HO0A 3IOIA 3SXAA 3VEQA 1JV3A 3OAMA 5IFYA 2ZR1B 4I4UA 2IWTB 2ZU8A 4KEJA 3HL3A 1G9BA 3AH2A 4EFPA 4EKXB 2LIEA 2A8WA 3CA1A 1HM0A 5C4FA 3HBWA 4B3UA 4JQ0A 3O3PA 4HO5A 3T7MA 2A8UA 2KI6B 1V82A 1R81A 2QGIA 3I0KA 4I4OA 1KNMA 2D22A 2VSEA 1H4CA 3U2XA 1V6VA 1DIWA 1GQCA 1TZFA 1MP5A 3U0XA 5IDSA 1IHKA 3CKVA 2D7IA 1BFGA 4QBVA 1FMZA 3OGGA 4CJMA 1VCLA 3RTJB 1R7UA 3VWCA 2Z86A 1N4KA 4I7IA 2F2FC 3USRA 4ASYA 3WO4A 4I37A 4ZBVB 3H6RA 3UD9A 1IIMA 4D11C 2Y6PA 5JMCA 4P02A 4I1BA 5DVHA 3OGFA 3IM7A 3QVBA 1FO8A 4XFTA 3O4CA 1ZCTA 3WMVA 3BRGC 1HKNA 4KEKA 1S0GA 3FJ9A 2E3DA 1HV9A 5FV9A 1FR8A 1S0LA 3LLPA 1ISZA 2KKIA 1FZWA 1NWGB 2VS3A 2X60A 5BXRA 3FWWA 4P6AA 2BO8A 1DZDA 3CU1B 2FFVA 3HSMA 1D0HA 1RY7A 3WA1A 4A7ZA 1S0BA 2Z87A 3FOQA 4F83A 5EJZA 2FDBM 2AESA 4IRQA 3FGMA 3AKIA 1QG8A 1BLAA 5F8SA 1H7FA 1LL2A 2YC5A 1V6XA 3V8YA 3TC2A 4P0JA 1LZ0A 4X3AA 4LO1A 2WVMA 1BFFA 4FVVA 4J2KA 2QN4A 4I0YA 5BQUA 2WVKA 3R4SA 5FTSA 1R7XA 5AJNA 2RJ4A 3I0FA 3ZGGA 1R7YA 4OW4A 2XWLA 3SX8A 3IAGC 3V0QA 3HMYA 4XFUA 1FWVA 2NP0A 5JLVA 4GOYA 1T4QA 1QGSA 1H7GA 1ZI5A 4B2XA 3POLA 1YP4A 3CGXA 3SX3A 2AH9A 3HALA 1LVWA 1NHEB 3T7OA 5EIYA 4EE5A 3N9WA 3PKQA 1VICA 3LTQA 4I4VA 2AQZA 3Q7YA 4B4BA 3SX5A 4LO0C 1R7TA 1ILR1 1FV2A 3N7LA 3BA4A 2K43A 3I0HA 4FRQA 1PZTA 5HS2A 5FZZA 3ZLLA 1FV3A 2Y9FA 3BAVA 5FU8A 1S0EA 4B4MA 3EF2A 3MALA 3U0YA 2RITA 2D43A 3OH1A 2X2SA 2Y9XE 3F1YA 4G9MA 4HO6A 4Y7VA 5AJPA 4QALA 1YYNA 1IILA 4OWJA 2Y7AA 4IZXA 2XMHA 1H3MA 1S4OA 1ZJ3A 2DRZA 2RJ5A 1VZTA 3CKJA 4G3QA 3VUOA 2OI7A 1M16A 3IOJA 4DEPA 1G95A 2P72A 5DDVA 3WO2A 1EPWA 4IRPA 1O23B 5L6SA 4J18A 2MC2A 3V79C 5DDTA 1F31A 3RMYA 3F62B 4C2SA 4FREA 2VU9A 1ZCVA 4G1RA 1CVSA 2RQ9A 3A07A 2NM1A 2RJ8A 3A22A 5C3DA 1VPAA 3RMWA 1HWNB 1WT1A 2ZU7A 3SXGA 1W77A 3MPPG 5BQUC 2X5SA 4OUJA 5D62A 1ZI3A 2RJ0A 2BEAA 3T8SA 3EE5A 1RZOB 3IIRA 2F8XC 2AM4A 1ISYA 2VSAA 4LO7B 2HW9A 2VSHA 3ZXGA 4KC2A 4QC4A 3Q4SA 1HJLA 4D0ZA 4KXOA 1DQOA 4LW6A 2XOAA 2VFZA 2D20A 2F2FA 4Y6NA 5BXSA 5DUYA 4YS8A 3FUQA 2HZ9A 1IT0A 2ZQNA 4XFSA 5EJ1A 4L4HA 3BRDA 5DSSB 1T9FA 1PC8B 3RTIB 2VXMA 3I0CA 4FRDA 4NAKA 3ZF8A 4I4RA 31BIA 1V83A 1ZCYA 3F1CA 4HO2A 1DQGA 2IHOA 2Y9WC 2X65A 3V0OA 3CA0A 3D98A 2P39A 3O4AA 2I5EA 4KPZA 1ZI4A 4KEIA 1P63A 3V0MA 2J3PA 3D7WB 1K5UA 3QYDA 3VT0A 4Q91A 1S4NA 1EVTA 2VXRA 4GAIA 4P00A 3BX1C 2Y4JA 4DECA 1TFMB 3AJ6A 1G9CA 1AVAC 2Q3NB 2O1GA 4I2SA 3ZC8A 3N7JA 1LZIA 2KI4A 3Q80A 4F34A 1AVXB 1H7QA 1HIBA 1TW1A 2AM5A 4DE7A 2XWMA 3AH4A 1BA7A 1YXWA 7I1BA 3S8JA 2RJ1A 1SS9A 4B42A 4EE3A 4HOCA 1DFQA 1H5SB 1YTOA 3AKFA 2RG9B 1FXOA 1O0RA 2Y9GA 4JKQA 3Q7WA 4I4XA 4HO4A 1JLYA 5FZYA 5BXPA 1Z90A 2FYAA 5CMFX 1EZIA 4FRPA 3NGWA 3OJMA 2VXTI 4KC3A 4ENDA 3PHZA 1XZZA 4I6IA 1H4EA 1LL0A 2RIYA 4QD2B 3KIAA 4UEGA 1HWOB 1LZJA 4H9WA 1H5TB 4IHZA 4G6JA 5G00A 3BAOA 4LO0A 4ZA3B 1W3FA 2VUAA 1FO9A 2VS5A 2W0WA 3V90A 3E26A 4GP0A 1MD6A 2KLLA 2V0IA 2MZBA 2I7BA 1HM9A 1G8OA 3P6IA 2DS0A 1AF9A 2RSTA 1H5RB 1ZCUA 4KC4A 1FWUA 4BQHA 5C49A 1V6UA 1VGTA 2D44A 2OEFA 3D5NA 1FR9A 3RSJA 2RIZA 1R82A 1II4A 1Q1UA 2UX8A 1WD3A 1WT2A 2YQJA 3V91A 4XKIA 5FYEA 1Q04A 4ZGRB 2Q4JA 1GA8A 4ISRA 1FMMS 2NZ9A 5BVPI 1GWWA 2BO4A 2O1HA 5C4BA 2BFHA 5CMHA 3VSZA 1G0RA 5FU0A 2WEEA 3USQA 5C38A 3I0JA 4AN7B 2LIQA 1H5TA 2WAWA 2VS4A 4KQLA 4LO7C 2V0JA 2PGVA 4M4KA 5DZUA 2AGDA 2RJ6A 4M2BA 4Y7FA 3BA5A 2PA4A 3BAQA 3O4BA 3VT2A 2VD4A 1H5RA 3TZTA 1V6WA 41BIA 1R7VA 4AYLA 1ITBA 4HA2A 4LO3C 1JVGA 5CQOA 2NTDA 1JYKA 3OJVA 1RG8A 3BCVA 4R6UB 5C4DA 5FUHA 4P0LA 3UD7A 4I4PA 5FNXA 4EB2B 2GGQA 4FCEA 2ERMA 3AZWA 3JUJA 1EYLA 1ON6A 2OI5A 2D7RA 4JISA 3I0LA 1NUNA 1O7OA 4FCUA 4FRAA 1FQ9A 2X5ZA 4B4GA 1TWMA 5HPZA 3Q7UA 3RMVA 1YBIA 1MP3A 2R9KB 4NALA 4IYBA 4USOA 2O1FA 1SZ6B 4OEFA 2DPWA 3JUKA 1HJJA 1O7QA 4EEGA 1G9RA 3JRRA 3U2VA 4ZKTB 1S0DA 4IZEA 2Y4MA 4KPXA 8I1BA 1A8DA 3OH0A 2Z48A 4J2YA 3I0GA 2YCMA 4MYBA 4EFRA 2GO2A 1TVYA 1VGZA 4M2AA 3VSFA 3AH1A 1H5SC 5F8WA 1AXMA 4XWIA 4CVHA 3AZVA 5I1FA 3H6SE 1W57A 1BLDA 1GWVA 3P6JA 1R8OA 1TWEA 2E8BA 2V0HA 4FRMA 4KNXA 4KRVA 5CQMX 2M49A 3B9UA 4ISQA 1HWPB 5C48A 4DCKC 4AN6A 3KMVA 4EEMA 1XZ6A 4QD2C 5GAQA 3IM5A 4G6MA 3HOMA 3I0IX 4G3PA 3BADA 2XMEA 1OQMB 3BB2A 1SR4C 4GAFA 4QKRA 4WBCA 5CMGX 4Y6UA 4TLPA 4NAIA 3JTJA 4I4SA 1FRWA 1ZDGA 2ET2A 1GX4A 1ZJ0A 1ZJPA 1CE7B 4Y7UA 1PWAA 1UPSA 4D48A 4X37A 1IJTA 1Z4SA 1FG5N 2AE7A 4M28A 21BIA 4B2WA 1WT0A 4HO8A 4CJBA 3FJHA 4D0TA 3PNNA 2K4AB 3OBRA 4LO2A 3AKHA 4FROA 4Y64A 4MNDA 3P53A 2Z49A 3NBNA 4EFQA 1XYFA 4PC4A 3O4DA 1OMXA 3U2TA 1W3GA 2MIBA 5FNWA 5AJOA 4JPZA 1M2TB 3O49A 3K8DA 1OMZA 1JT4A 1VZUA 3PMEA 3LW6A 5JQQA 3BTAA 3RSBA 5BOWA 2JCOA 1MC3A 1XG6A 1MC9A 1I1EA 4P0KA 3V0BB 1FN0A 3AKGA 3I0EA 5J49A 3NBDA 2RIXA 1K5VA 4G9NA 1R8NA 3K1XA 5B2HA 1H7LA 1RMLA 3DUVA 3H6QA 1FWYA 3OBTA 3FJKA 3WMUA 3RMXA 3CA4A 4IONA 4BMAA 5C3BA 2HWAA 3FJAA 2AM3A 3DJ4A 5CQLX 1DFCA 1TOOA 3AJ5A 3I2AA 4HO3A 1ZJOA 3VT1A 2AAIB 4KC1A 1G93A 4Q9GA 1ZI1A 2BO6A 2I5KA 1DLLA 4LO3A 5I1BA 4AC3A 1WT3A 4AAWA 3NBEA 5C1LA 3FJEA 1QXMA 4K6RA 3HN1A 4I1EA 4EVWA 3O4OA 3K8EA 4FGFA 4DENA 3FJDA 3R4UA 4CJ8A 3FJJA 1WBAA 2Y4KA 3V0BA 4ZDQA 4E1KA 4GBPA 4QKSA 3S8KA 1H7HA 3F1RA 1QQLA 4A7KA 1FOAA 1H4DA 3BAGA 1JVDA 2P23A 4Y63A 2DREA 3PKPA 2FY7A 4LO2C 1W3AA 2NVHA 5EHAA 1E0OA 1NQIB 1H5SD 1ZJ1A 1EV2A 6I1BA 1I52A 1R80A 5FTVA 3FJ8A 2YC3A 1YF8B 2VLCA 3BRFA 1FGAA 1W55A 5C36A 2BEBA 2D1ZA 1EYRA 3SX7A 1LL3A 4GOVA 1TP0A 1VM8A 1JY0A 4G87A 3UDAA 3CRIA 1H5SA 3FUOA 2DRYA 3U2WA 4IQPA 1S0CA 5D63A 1Q03A 5EC5A 4EEEB 1FGXA 1JT7A 2D23A 2YUGA 4IY9A 1G1LA 1TW5A 3ZXDA 2RJ7A 3OC9A 5C1HA 1G9AA 3W9TA 1JLXA 1YROB 3CRGA 2FFUA 3CKOA 4OEGA 1ZHJA 1GX0A 3I0DA 2AXMA 1ZIZA 2WBCA 2V0LA 4Z8SB 2FYDB 4HR6C 3UJ4A 1WVCA 1SR4A 2YQHA 1G3LA 3SPTA 4HO9A 4EEAA 5BP5C 4EE4A 4HCQA 2PX7A 4L4IA 4DDZA 2AECA 3CKQA 1INJA 3V0NA 3CRHA 1H7TA 4II0A 1VGWA 9ILBA 3IM6A 3A23A 4OWKA 2WE9A 3O5WB 1I1BA 5D61A 2WVLA 3V0PA 1HWMB 4ZOTA 1AVWB 1VH1A 4Y7GA 4X38A 3ZLKA 5C4CA 1AFCA 3QR5A 2ICYA 1S4PA 3N7KA 4FRBA 3N7MA 2FO1A 1HCDA 1H7EA 3SXEA 3OJ2A 1JTCA 3BAHA 1OQLB 4FQWA 2E4MA 4ARWA 3DK5A 3WINC 3E8LC 3BA7A 1XHBA 4IY8A 3OH2A 4LW3A 2BO7A 2ICXA 1PZZA 4JKXB 4D8HA 1VZXA 3U2UA 1JT5A 1NMMB 3FFZA 3OH4A 4OWLA 3SXBA 1FXJA 1IRPA 3FJBA 1ABRB 2UUSA 2Q9XA 1IOBA 1WD4A 5BXTA 1VH3A 2Y4LA 3POKA 1PZYB 3OKRA
chains in the Genus database with same CATH superfamily
3CAHA 3FJFA 4O6MA 2HWMA 3JUTA 2MLLB 2NXVA 2PGYA 2WRYA 1S0FA 1DJSB 3SXCA 4I8MA 3ZC9A 2P73A 4O6NA 2ESUA 3WO3A 1FGGA 4QO3A 1G97A 1QQKA 4R7PA 5CMJA 3V0AB 4H75A 3FJIA 1BFBA 4LO8B 1HCEA 1HM8A 4ZLBB 3OGZA 4YOLA 5C3AA 1INIA 5C8RA 1ISWA 2QKXA 1MP4A 1VGUA 2VSIA 3TQDA 4X39A 3UD8A 3C9ZA 1JYLA 5C4EA 4I3NA 1G9DA 4Z9WB 4I96A 4ZFUB 3NBCA 1ZJ2A 2X2TA 2VXLA 4FRHA 3CA6A 1WBCA 3NJ5A 3ST8A 3SXDA 3O3QA 3CKNA 5FZUA 2JCJA 1G82A 1NKHB 2L5XA 4KT7A 2FGFA 3N0KA 4ZFYB 5C47A 3O44A 5CQPA 3V8ZA 5L6VA 2OI6A 1AVUA 4NANA 2KH2A 2ZQOA 3I29B 1NZKA 1J0SA 4ZFWB 1G2VA 1JQZA 2APCA 3Q7XA 2JCKA 1DZCA 4HG6A 4JD0A 3V0AA 2QH5A 4Y7TA 5EG6C 1YP3A 3SNVA 2E4MC 2GZBA 3PG0A 3D8VA 4KNRA 2OEGA 3ZGFA 3CU0A 1Z0HA 2NYYA 3I2XA 4J2SA 2FYBA 2FYCB 1BASA 2XWNA 5CQNX 4LO1C 3CQAA 4Y62A 3BAUA 1Z2VA 5D91A 2P6WA 2YESA 4JAWA 4I4QA 2JCLA 2NS2A 1L2HA 4B5BA 4JRAA 1WSZA 1JT3A 2GGOA 4AYJA 3PUBA 1GQ9A 5C1GA 4EEOA 1E5KA 4I4YA 1BARA 2C0NA 3R2WA 3T7NA 5BP5A 5F90A 2AFGA 3OH3A 4L41C 2V0KA 4D11A 1IRAX 1BFCA 1ISVA 2QYIB 4KBBA 1LZ7A 4J23B 1TIEA 3CA3A 1QGQA 3ILAA 1KWSA 1YP2A 3R3IA 3GUEA 4JP0A 2K8RA 4GP3A 3IOHA 1GGPB 1TTUA 2D24A 5BXCA 2YQSA 2D0JA 4Q9PA 1IINA 2ZU9A 3CA5A 1NF5B 4FRLA 1ON8A 2W0VA 3FJCA 2RJ9A 4ASJA 1ISXA 1PUMB 5E24E 1ZDFA 5F8YA 2YQCA 3V0LA 5CMIA 4J2XA 4G3SA 3WINA 1V84A 4OEEA 1G23A 4MZHA 1K4VA 4CJCA 5IDTA 1PUUB 3A21A 4HJJA 4QBCA 3ZX7A 3BRKX 3H6RB 4USPA 1ONKB 2WGZA 4H04A 1QWJA 2CU2A 4A7YA 4Y9XA 3UJ0A 4ECMA 2I1BA 1JV1A 3E25A 4HO0A 3IOIA 3SXAA 3VEQA 1JV3A 3OAMA 5IFYA 2ZR1B 4I4UA 2IWTB 2ZU8A 4KEJA 3HL3A 1G9BA 3AH2A 4EFPA 4EKXB 2LIEA 2A8WA 3CA1A 1HM0A 5C4FA 3HBWA 4B3UA 4JQ0A 3O3PA 4HO5A 3T7MA 2A8UA 2KI6B 1V82A 1R81A 2QGIA 3I0KA 4I4OA 1KNMA 2D22A 2VSEA 1H4CA 3U2XA 1V6VA 1DIWA 1GQCA 1TZFA 1MP5A 3U0XA 5IDSA 1IHKA 3CKVA 2D7IA 1BFGA 4QBVA 1FMZA 3OGGA 4CJMA 1VCLA 3RTJB 1R7UA 3VWCA 2Z86A 1N4KA 4I7IA 2F2FC 3USRA 4ASYA 3WO4A 4I37A 4ZBVB 3H6RA 3UD9A 1IIMA 4D11C 2Y6PA 5JMCA 4P02A 4I1BA 5DVHA 3OGFA 3IM7A 3QVBA 1FO8A 4XFTA 3O4CA 1ZCTA 3WMVA 3BRGC 1HKNA 4KEKA 1S0GA 3FJ9A 2E3DA 2J0BA 1HV9A 5FV9A 1FR8A 1S0LA 3LLPA 1ISZA 2KKIA 1FZWA 1NWGB 2VS3A 2X60A 5BXRA 3FWWA 4P6AA 2BO8A 1DZDA 3CU1B 2FFVA 3HSMA 1D0HA 1RY7A 3WA1A 4A7ZA 1S0BA 2Z87A 3FOQA 4F83A 5EJZA 2FDBM 2AESA 4IRQA 3FGMA 3AKIA 1QG8A 1BLAA 5F8SA 1H7FA 1LL2A 2YC5A 1V6XA 3V8YA 3TC2A 4P0JA 1LZ0A 4X3AA 4LO1A 2WVMA 1BFFA 4FVVA 4J2KA 2QN4A 4I0YA 5BQUA 2WVKA 3R4SA 5FTSA 1R7XA 5AJNA 2RJ4A 3I0FA 3ZGGA 1R7YA 4OW4A 2XWLA 3SX8A 3IAGC 3V0QA 3HMYA 4XFUA 1FWVA 2NP0A 5JLVA 4GOYA 1T4QA 1QGSA 1H7GA 1ZI5A 4B2XA 3POLA 1YP4A 3CGXA 3SX3A 2AH9A 3HALA 1LVWA 1NHEB 3T7OA 5EIYA 4EE5A 3N9WA 3PKQA 1VICA 3LTQA 4I4VA 2AQZA 3Q7YA 4B4BA 3SX5A 4LO0C 1R7TA 1ILR1 1FV2A 3N7LA 3BA4A 2K43A 3I0HA 4FRQA 1PZTA 5HS2A 5FZZA 3ZLLA 1FV3A 2Y9FA 3BAVA 5FU8A 1S0EA 4B4MA 3EF2A 3MALA 3U0YA 2RITA 2D43A 3OH1A 2X2SA 2Y9XE 3F1YA 4G9MA 4HO6A 4Y7VA 5AJPA 4QALA 1YYNA 1IILA 4OWJA 2VK9A 2Y7AA 4IZXA 2XMHA 1H3MA 1S4OA 1ZJ3A 2DRZA 2RJ5A 1VZTA 3CKJA 4G3QA 3VUOA 2OI7A 1M16A 3IOJA 4DEPA 1G95A 2P72A 5DDVA 3WO2A 1EPWA 4IRPA 1O23B 5L6SA 4J18A 2MC2A 3V79C 5DDTA 1F31A 3RMYA 3F62B 4C2SA 4FREA 2VU9A 1ZCVA 4G1RA 1CVSA 2RQ9A 3A07A 2NM1A 2RJ8A 3A22A 5C3DA 1VPAA 3RMWA 1HWNB 1WT1A 2ZU7A 3SXGA 1W77A 3MPPG 5BQUC 2X5SA 4OUJA 5D62A 1ZI3A 2RJ0A 2BEAA 3T8SA 3EE5A 1RZOB 3IIRA 2F8XC 2AM4A 1ISYA 2VSAA 4LO7B 2HW9A 2VSHA 3ZXGA 4KC2A 4QC4A 3Q4SA 1HJLA 4MZFB 4D0ZA 4KXOA 1DQOA 4LW6A 2XOAA 2VFZA 2D20A 2F2FA 4Y6NA 5BXSA 5DUYA 4YS8A 3FUQA 2HZ9A 1IT0A 2ZQNA 4XFSA 5EJ1A 4L4HA 3BRDA 5DSSB 1T9FA 1PC8B 3RTIB 2VXMA 3I0CA 4FRDA 4NAKA 3ZF8A 4I4RA 31BIA 1V83A 1ZCYA 3F1CA 4HO2A 1DQGA 2IHOA 2Y9WC 2X65A 3V0OA 3CA0A 3D98A 2P39A 3O4AA 2I5EA 4KPZA 1ZI4A 4KEIA 1P63A 3V0MA 2J3PA 3D7WB 1K5UA 3QYDA 3VT0A 4Q91A 1S4NA 1EVTA 2VXRA 4GAIA 4P00A 3BX1C 2Y4JA 4DECA 1TFMB 3AJ6A 1G9CA 1AVAC 2Q3NB 2O1GA 4I2SA 3ZC8A 3N7JA 1LZIA 2KI4A 3Q80A 4F34A 1AVXB 1H7QA 1HIBA 1TW1A 2AM5A 4DE7A 2XWMA 3AH4A 1BA7A 1YXWA 7I1BA 3S8JA 2RJ1A 1SS9A 4B42A 4EE3A 4HOCA 1DFQA 1H5SB 1YTOA 3AKFA 2RG9B 1FXOA 1O0RA 2Y9GA 4JKQA 3Q7WA 4I4XA 4HO4A 1JLYA 5FZYA 5BXPA 1Z90A 2FYAA 5CMFX 1EZIA 4FRPA 3NGWA 3OJMA 2VXTI 4KC3A 4ENDA 3PHZA 1XZZA 4I6IA 1H4EA 1LL0A 2RIYA 4QD2B 3KIAA 4UEGA 1HWOB 1LZJA 4H9WA 1H5TB 4IHZA 4G6JA 5G00A 3BAOA 4LO0A 4ZA3B 1W3FA 2VUAA 1FO9A 2VS5A 2W0WA 3V90A 3E26A 4GP0A 1MD6A 2KLLA 2V0IA 2MZBA 2I7BA 1HM9A 1G8OA 3P6IA 2DS0A 1AF9A 2RSTA 1H5RB 1ZCUA 4KC4A 1FWUA 4BQHA 5C49A 1V6UA 1VGTA 2D44A 2OEFA 3D5NA 1FR9A 3RSJA 2RIZA 1R82A 1II4A 1Q1UA 2UX8A 1WD3A 1WT2A 2YQJA 3V91A 4XKIA 5FYEA 1Q04A 4ZGRB 2Q4JA 1GA8A 4ISRA 1FMMS 2NZ9A 5BVPI 1GWWA 2BO4A 2O1HA 5C4BA 2BFHA 5CMHA 3VSZA 1G0RA 5FU0A 2WEEA 2J0AA 3USQA 5C38A 3I0JA 4AN7B 2LIQA 1H5TA 2WAWA 2VS4A 4KQLA 4LO7C 2V0JA 2PGVA 4M4KA 5DZUA 2AGDA 2RJ6A 4M2BA 4Y7FA 3BA5A 2PA4A 3BAQA 3O4BA 3VT2A 2VD4A 1H5RA 3TZTA 1V6WA 41BIA 1R7VA 4AYLA 1ITBA 4HA2A 4LO3C 1JVGA 5CQOA 2NTDA 1JYKA 3OJVA 1RG8A 3BCVA 4R6UB 4MIXA 5C4DA 5FUHA 4P0LA 3UD7A 4I4PA 5FNXA 4EB2B 2GGQA 4FCEA 2ERMA 3AZWA 3JUJA 1EYLA 1ON6A 2OI5A 4FIYA 2D7RA 4JISA 3I0LA 1NUNA 1O7OA 4FCUA 4FRAA 1FQ9A 2X5ZA 4B4GA 1TWMA 5HPZA 3Q7UA 3RMVA 1YBIA 1MP3A 2R9KB 4NALA 4IYBA 4USOA 2O1FA 1SZ6B 4OEFA 2DPWA 3JUKA 1HJJA 1O7QA 4EEGA 1G9RA 3JRRA 3U2VA 4ZKTB 1S0DA 4IZEA 2Y4MA 4KPXA 8I1BA 1A8DA 3OH0A 2Z48A 4J2YA 3I0GA 2YCMA 4MYBA 4EFRA 2GO2A 1TVYA 1VGZA 4M2AA 3VSFA 3AH1A 1H5SC 5F8WA 1AXMA 4XWIA 4CVHA 3AZVA 5I1FA 3H6SE 1W57A 4FIXA 1BLDA 1GWVA 3P6JA 1R8OA 1TWEA 2E8BA 2V0HA 4FRMA 4KNXA 4KRVA 5CQMX 2M49A 3B9UA 4ISQA 1HWPB 5C48A 4DCKC 4AN6A 3KMVA 4EEMA 1XZ6A 4QD2C 5GAQA 3IM5A 4G6MA 3HOMA 3I0IX 4G3PA 3BADA 2XMEA 1OQMB 3BB2A 1SR4C 4GAFA 4QKRA 4WBCA 5CMGX 4Y6UA 4TLPA 4NAIA 3JTJA 4I4SA 1FRWA 1ZDGA 2ET2A 1GX4A 1ZJ0A 1ZJPA 1CE7B 4Y7UA 1PWAA 1UPSA 4D48A 4X37A 1IJTA 1Z4SA 1FG5N 2AE7A 4M28A 21BIA 4B2WA 1WT0A 4HO8A 4CJBA 3FJHA 4D0TA 3PNNA 2K4AB 3OBRA 4LO2A 3AKHA 4FROA 4Y64A 4MNDA 3P53A 2Z49A 3NBNA 4EFQA 1XYFA 4PC4A 3O4DA 1OMXA 3U2TA 1W3GA 2MIBA 5FNWA 5AJOA 4JPZA 1M2TB 3O49A 3K8DA 1OMZA 1JT4A 1VZUA 3PMEA 3LW6A 5JQQA 3BTAA 3RSBA 5BOWA 2JCOA 1MC3A 1XG6A 1MC9A 1I1EA 4P0KA 3V0BB 1FN0A 3AKGA 3I0EA 5J49A 3NBDA 2RIXA 1K5VA 4G9NA 1R8NA 3K1XA 5B2HA 4MZGB 1H7LA 1RMLA 3DUVA 3H6QA 1FWYA 3OBTA 3FJKA 3WMUA 3RMXA 3CA4A 4IONA 4BMAA 5C3BA 2HWAA 3FJAA 2AM3A 3DJ4A 5CQLX 1DFCA 1TOOA 3AJ5A 3I2AA 4HO3A 1ZJOA 3VT1A 2AAIB 5D92A 4KC1A 1G93A 4Q9GA 1ZI1A 2BO6A 2I5KA 1DLLA 4LO3A 5I1BA 4AC3A 1WT3A 4AAWA 3NBEA 5C1LA 3FJEA 1QXMA 4K6RA 3HN1A 4I1EA 4EVWA 3O4OA 3K8EA 4FGFA 4DENA 3FJDA 3R4UA 4CJ8A 3FJJA 1WBAA 2Y4KA 3V0BA 4ZDQA 4E1KA 4GBPA 4QKSA 3S8KA 1H7HA 3F1RA 1QQLA 4A7KA 1FOAA 1H4DA 3BAGA 1JVDA 2P23A 4Y63A 2DREA 3PKPA 2FY7A 4LO2C 1W3AA 2NVHA 5EHAA 1E0OA 1NQIB 1H5SD 1ZJ1A 1EV2A 6I1BA 1I52A 1R80A 5FTVA 3FJ8A 2YC3A 1YF8B 2VLCA 3BRFA 1FGAA 1W55A 5C36A 2BEBA 2D1ZA 1EYRA 3SX7A 1LL3A 4GOVA 1TP0A 1VM8A 1JY0A 4G87A 3UDAA 3CRIA 1H5SA 3FUOA 2DRYA 3U2WA 4IQPA 1S0CA 5D63A 1Q03A 5EC5A 4EEEB 1FGXA 1JT7A 2D23A 2YUGA 4IY9A 1G1LA 1TW5A 3ZXDA 2RJ7A 3OC9A 4Q7CA 1G9AA 5C1HA 3W9TA 1JLXA 1YROB 3CRGA 2FFUA 3CKOA 4OEGA 1ZHJA 1GX0A 3I0DA 2AXMA 1ZIZA 2WBCA 2V0LA 4Z8SB 2FYDB 4HR6C 3UJ4A 1WVCA 1SR4A 2YQHA 1G3LA 3SPTA 4HO9A 4EEAA 4UY4A 5BP5C 4EE4A 4HCQA 2PX7A 4L4IA 4DDZA 2AECA 3CKQA 1INJA 3V0NA 3CRHA 1H7TA 4II0A 1VGWA 9ILBA 3IM6A 3A23A 4OWKA 2WE9A 3O5WB 1I1BA 5D61A 2WVLA 3V0PA 1HWMB 4ZOTA 1AVWB 1VH1A 4Y7GA 4X38A 3ZLKA 5C4CA 1AFCA 3QR5A 2ICYA 1S4PA 3N7KA 4FRBA 3N7MA 2FO1A 1HCDA 1H7EA 3SXEA 3OJ2A 1JTCA 3BAHA 1OQLB 4FQWA 2E4MA 4ARWA 3DK5A 3WINC 3E8LC 3BA7A 1XHBA 4IY8A 3OH2A 4LW3A 2BO7A 2ICXA 1PZZA 4JKXB 4D8HA 1VZXA 3U2UA 1JT5A 1NMMB 3FFZA 3OH4A 4OWLA 3SXBA 1FXJA 1IRPA 3FJBA 1ABRB 2UUSA 2Q9XA 1IOBA 1WD4A 5BXTA 1VH3A 2Y4LA 3POKA 1PZYB 3OKRA
chains in the Genus database with same CATH topology
3CAHA 3FJFA 4O6MA 2HWMA 3JUTA 2MLLB 2NXVA 2PGYA 2WRYA 1S0FA 1DJSB 3SXCA 4I8MA 3ZC9A 2P73A 4O6NA 2ESUA 3WO3A 1FGGA 4QO3A 1G97A 1QQKA 4R7PA 5CMJA 3V0AB 4H75A 3FJIA 1BFBA 4LO8B 1HCEA 1HM8A 4ZLBB 3OGZA 4YOLA 5C3AA 1INIA 5C8RA 1ISWA 2QKXA 1MP4A 1VGUA 2VSIA 3TQDA 4X39A 3UD8A 3C9ZA 1JYLA 5C4EA 4I3NA 1G9DA 4Z9WB 4I96A 4ZFUB 3NBCA 1ZJ2A 2X2TA 2VXLA 4FRHA 3CA6A 1WBCA 3NJ5A 3ST8A 3SXDA 3O3QA 3CKNA 5FZUA 2JCJA 1G82A 1NKHB 2L5XA 4KT7A 2FGFA 3N0KA 4ZFYB 5C47A 3O44A 5CQPA 3V8ZA 5L6VA 2OI6A 1AVUA 4NANA 2KH2A 2ZQOA 3I29B 1NZKA 1J0SA 4ZFWB 1G2VA 1JQZA 2APCA 3Q7XA 2JCKA 1DZCA 4HG6A 4JD0A 3V0AA 2QH5A 4Y7TA 5EG6C 1YP3A 3SNVA 2E4MC 2GZBA 3PG0A 3D8VA 4KNRA 2OEGA 3ZGFA 3CU0A 1Z0HA 2NYYA 3I2XA 4J2SA 2FYBA 2FYCB 1BASA 2XWNA 5CQNX 4LO1C 3CQAA 4Y62A 3BAUA 1Z2VA 5D91A 2P6WA 2YESA 4JAWA 4I4QA 2JCLA 2NS2A 1L2HA 4B5BA 4JRAA 1WSZA 1JT3A 2GGOA 4AYJA 3PUBA 1GQ9A 5C1GA 4EEOA 1E5KA 4I4YA 1BARA 2C0NA 3R2WA 3T7NA 5BP5A 5F90A 2AFGA 3OH3A 4L41C 2V0KA 4D11A 1IRAX 1BFCA 1ISVA 2QYIB 4KBBA 1LZ7A 4J23B 1TIEA 3CA3A 1QGQA 3ILAA 1KWSA 1YP2A 3R3IA 3GUEA 4JP0A 2K8RA 4GP3A 3IOHA 1GGPB 1TTUA 2D24A 5BXCA 2YQSA 2D0JA 4Q9PA 1IINA 2ZU9A 3CA5A 1NF5B 4FRLA 1ON8A 2W0VA 3FJCA 2RJ9A 4ASJA 1ISXA 1PUMB 5E24E 1ZDFA 5F8YA 2YQCA 3V0LA 5CMIA 4J2XA 4G3SA 3WINA 1V84A 4OEEA 1G23A 4MZHA 1K4VA 4CJCA 5IDTA 1PUUB 3A21A 4HJJA 4QBCA 3ZX7A 3BRKX 3H6RB 4USPA 1ONKB 2WGZA 4H04A 1QWJA 2CU2A 4A7YA 4Y9XA 3UJ0A 4ECMA 2I1BA 1JV1A 3E25A 4HO0A 3IOIA 3SXAA 3VEQA 1JV3A 3OAMA 5IFYA 2ZR1B 4I4UA 2IWTB 2ZU8A 4KEJA 3HL3A 1G9BA 3AH2A 4EFPA 4EKXB 2LIEA 2A8WA 3CA1A 1HM0A 5C4FA 3HBWA 4B3UA 4JQ0A 3O3PA 4HO5A 3T7MA 2A8UA 2KI6B 1V82A 1R81A 2QGIA 3I0KA 4I4OA 1KNMA 2D22A 2VSEA 1H4CA 3U2XA 1V6VA 1DIWA 1GQCA 1TZFA 1MP5A 3U0XA 5IDSA 1IHKA 3CKVA 2D7IA 1BFGA 4QBVA 1FMZA 3OGGA 4CJMA 1VCLA 3RTJB 1R7UA 3VWCA 2Z86A 1N4KA 4I7IA 2F2FC 3USRA 4ASYA 3WO4A 4I37A 4ZBVB 3H6RA 3UD9A 1IIMA 4D11C 2Y6PA 5JMCA 4P02A 4I1BA 5DVHA 3OGFA 3IM7A 3QVBA 1FO8A 4XFTA 3O4CA 1ZCTA 3WMVA 3BRGC 1HKNA 4KEKA 1S0GA 3FJ9A 2E3DA 2J0BA 1HV9A 5FV9A 1FR8A 1S0LA 3LLPA 1ISZA 2KKIA 1FZWA 1NWGB 2VS3A 2X60A 5BXRA 3FWWA 4P6AA 2BO8A 1DZDA 3CU1B 2FFVA 3HSMA 1D0HA 1RY7A 3WA1A 4A7ZA 1S0BA 2Z87A 3FOQA 4F83A 5EJZA 2FDBM 2AESA 4IRQA 3FGMA 3AKIA 1QG8A 1BLAA 5F8SA 1H7FA 1LL2A 2YC5A 1V6XA 3V8YA 3TC2A 4P0JA 1LZ0A 4X3AA 4LO1A 2WVMA 1BFFA 4FVVA 4J2KA 2QN4A 4I0YA 5BQUA 2WVKA 3R4SA 5FTSA 1R7XA 5AJNA 2RJ4A 3I0FA 3ZGGA 1R7YA 4OW4A 2XWLA 3SX8A 3IAGC 3V0QA 3HMYA 4XFUA 1FWVA 2NP0A 5JLVA 4GOYA 1T4QA 1QGSA 1H7GA 1ZI5A 4B2XA 3POLA 1YP4A 3CGXA 3SX3A 2AH9A 3HALA 1LVWA 1NHEB 3T7OA 5EIYA 4EE5A 3N9WA 3PKQA 1VICA 3LTQA 4I4VA 2AQZA 3Q7YA 4B4BA 3SX5A 4LO0C 1R7TA 1ILR1 1FV2A 3N7LA 3BA4A 2K43A 3I0HA 4FRQA 1PZTA 5HS2A 5FZZA 3ZLLA 1FV3A 2Y9FA 3BAVA 5FU8A 1S0EA 4B4MA 3EF2A 3MALA 3U0YA 2RITA 2D43A 3OH1A 2X2SA 2Y9XE 3F1YA 4G9MA 4HO6A 4Y7VA 5AJPA 4QALA 1YYNA 1IILA 4OWJA 2VK9A 2Y7AA 4IZXA 2XMHA 1H3MA 1S4OA 1ZJ3A 2DRZA 2RJ5A 1VZTA 3CKJA 4G3QA 3VUOA 2OI7A 1M16A 3IOJA 4DEPA 1G95A 2P72A 5DDVA 3WO2A 1EPWA 4IRPA 1O23B 5L6SA 4J18A 2MC2A 3V79C 5DDTA 1F31A 3RMYA 3F62B 4C2SA 4FREA 2VU9A 1ZCVA 4G1RA 1CVSA 2RQ9A 3A07A 2NM1A 2RJ8A 3A22A 5C3DA 1VPAA 3RMWA 1HWNB 1WT1A 2ZU7A 3SXGA 1W77A 3MPPG 5BQUC 2X5SA 4OUJA 5D62A 1ZI3A 2RJ0A 2BEAA 3T8SA 3EE5A 1RZOB 3IIRA 2F8XC 2AM4A 1ISYA 2VSAA 4LO7B 2HW9A 2VSHA 3ZXGA 4KC2A 4QC4A 3Q4SA 1HJLA 4MZFB 4D0ZA 4KXOA 1DQOA 4LW6A 2XOAA 2VFZA 2D20A 2F2FA 4Y6NA 5BXSA 5DUYA 4YS8A 3FUQA 2HZ9A 1IT0A 2ZQNA 4XFSA 5EJ1A 4L4HA 3BRDA 5DSSB 1T9FA 1PC8B 3RTIB 2VXMA 3I0CA 4FRDA 4NAKA 3ZF8A 4I4RA 31BIA 1V83A 1ZCYA 3F1CA 4HO2A 1DQGA 2IHOA 2Y9WC 2X65A 3V0OA 3CA0A 3D98A 2P39A 3O4AA 2I5EA 4KPZA 1ZI4A 4KEIA 1P63A 3V0MA 2J3PA 3D7WB 1K5UA 3QYDA 3VT0A 4Q91A 1S4NA 1EVTA 2VXRA 4GAIA 4P00A 3BX1C 2Y4JA 4DECA 1TFMB 3AJ6A 1G9CA 1AVAC 2Q3NB 2O1GA 4I2SA 3ZC8A 3N7JA 1LZIA 2KI4A 3Q80A 4F34A 1AVXB 1H7QA 1HIBA 1TW1A 2AM5A 4DE7A 2XWMA 3AH4A 1BA7A 1YXWA 7I1BA 3S8JA 2RJ1A 1SS9A 4B42A 4EE3A 4HOCA 1DFQA 1H5SB 1YTOA 3AKFA 2RG9B 1FXOA 1O0RA 2Y9GA 4JKQA 3Q7WA 4I4XA 4HO4A 1JLYA 5FZYA 5BXPA 1Z90A 2FYAA 5CMFX 1EZIA 4FRPA 3NGWA 3OJMA 2VXTI 4KC3A 4ENDA 3PHZA 1XZZA 4I6IA 1H4EA 1LL0A 2RIYA 4QD2B 3KIAA 4UEGA 1HWOB 1LZJA 4H9WA 1H5TB 4IHZA 4G6JA 5G00A 3BAOA 4LO0A 4ZA3B 1W3FA 2VUAA 1FO9A 2VS5A 2W0WA 3V90A 3E26A 4GP0A 1MD6A 2KLLA 2V0IA 2MZBA 2I7BA 1HM9A 1G8OA 3P6IA 2DS0A 1AF9A 2RSTA 1H5RB 1ZCUA 4KC4A 1FWUA 4BQHA 5C49A 1V6UA 1VGTA 2D44A 2OEFA 3D5NA 1FR9A 3RSJA 2RIZA 1R82A 1II4A 1Q1UA 2UX8A 1WD3A 1WT2A 2YQJA 3V91A 4XKIA 5FYEA 1Q04A 4ZGRB 2Q4JA 1GA8A 4ISRA 1FMMS 2NZ9A 5BVPI 1GWWA 2BO4A 2O1HA 5C4BA 2BFHA 5CMHA 3VSZA 1G0RA 5FU0A 2WEEA 2J0AA 3USQA 5C38A 3I0JA 4AN7B 2LIQA 1H5TA 2WAWA 2VS4A 4KQLA 4LO7C 2V0JA 2PGVA 4M4KA 5DZUA 2AGDA 2RJ6A 4M2BA 4Y7FA 3BA5A 2PA4A 3BAQA 3O4BA 3VT2A 2VD4A 1H5RA 3TZTA 1V6WA 41BIA 1R7VA 4AYLA 1ITBA 4HA2A 4LO3C 1JVGA 5CQOA 2NTDA 1JYKA 3OJVA 1RG8A 3BCVA 4R6UB 4MIXA 5C4DA 5FUHA 4P0LA 3UD7A 4I4PA 5FNXA 4EB2B 2GGQA 4FCEA 2ERMA 3AZWA 3JUJA 1EYLA 1ON6A 2OI5A 4FIYA 2D7RA 4JISA 3I0LA 1NUNA 1O7OA 4FCUA 4FRAA 1FQ9A 2X5ZA 4B4GA 1TWMA 5HPZA 3Q7UA 3RMVA 1YBIA 1MP3A 2R9KB 4NALA 4IYBA 4USOA 2O1FA 1SZ6B 4OEFA 2DPWA 3JUKA 1HJJA 1O7QA 4EEGA 1G9RA 3JRRA 3U2VA 4ZKTB 1S0DA 4IZEA 2Y4MA 4KPXA 8I1BA 1A8DA 3OH0A 2Z48A 4J2YA 3I0GA 2YCMA 4MYBA 4EFRA 2GO2A 1TVYA 1VGZA 4M2AA 3VSFA 3AH1A 1H5SC 5F8WA 1AXMA 4XWIA 4CVHA 3AZVA 5I1FA 3H6SE 1W57A 4FIXA 1BLDA 1GWVA 3P6JA 1R8OA 1TWEA 2E8BA 2V0HA 4FRMA 4KNXA 4KRVA 5CQMX 2M49A 3B9UA 4ISQA 1HWPB 5C48A 4DCKC 4AN6A 3KMVA 4EEMA 1XZ6A 4QD2C 5GAQA 3IM5A 4G6MA 3HOMA 3I0IX 4G3PA 3BADA 2XMEA 1OQMB 3BB2A 1SR4C 4GAFA 4QKRA 4WBCA 5CMGX 4Y6UA 4TLPA 4NAIA 3JTJA 4I4SA 1FRWA 1ZDGA 2ET2A 1GX4A 1ZJ0A 1ZJPA 1CE7B 4Y7UA 1PWAA 1UPSA 4D48A 4X37A 1IJTA 1Z4SA 1FG5N 2AE7A 4M28A 21BIA 4B2WA 1WT0A 4HO8A 4CJBA 3FJHA 4D0TA 3PNNA 2K4AB 3OBRA 4LO2A 3AKHA 4FROA 4Y64A 4MNDA 3P53A 2Z49A 3NBNA 4EFQA 1XYFA 4PC4A 3O4DA 1OMXA 3U2TA 1W3GA 2MIBA 5FNWA 5AJOA 4JPZA 1M2TB 3O49A 3K8DA 1OMZA 1JT4A 1VZUA 3PMEA 3LW6A 5JQQA 3BTAA 3RSBA 5BOWA 2JCOA 1MC3A 1XG6A 1MC9A 1I1EA 4P0KA 3V0BB 1FN0A 3AKGA 3I0EA 5J49A 3NBDA 2RIXA 1K5VA 4G9NA 1R8NA 3K1XA 5B2HA 4MZGB 1H7LA 1RMLA 3DUVA 3H6QA 1FWYA 3OBTA 3FJKA 3WMUA 3RMXA 3CA4A 4IONA 4BMAA 5C3BA 2HWAA 3FJAA 2AM3A 3DJ4A 5CQLX 1DFCA 1TOOA 3AJ5A 3I2AA 4HO3A 1ZJOA 3VT1A 2AAIB 5D92A 4KC1A 1G93A 4Q9GA 1ZI1A 2BO6A 2I5KA 1DLLA 4LO3A 5I1BA 4AC3A 1WT3A 4AAWA 3NBEA 5C1LA 3FJEA 1QXMA 4K6RA 3HN1A 4I1EA 4EVWA 3O4OA 3K8EA 4FGFA 4DENA 3FJDA 3R4UA 4CJ8A 3FJJA 1WBAA 2Y4KA 3V0BA 4ZDQA 4E1KA 4GBPA 4QKSA 3S8KA 1H7HA 3F1RA 1QQLA 4A7KA 1FOAA 1H4DA 3BAGA 1JVDA 2P23A 4Y63A 2DREA 3PKPA 2FY7A 4LO2C 1W3AA 2NVHA 5EHAA 1E0OA 1NQIB 1H5SD 1ZJ1A 1EV2A 6I1BA 1I52A 1R80A 5FTVA 3FJ8A 2YC3A 1YF8B 2VLCA 3BRFA 1FGAA 1W55A 5C36A 2BEBA 2D1ZA 1EYRA 3SX7A 1LL3A 4GOVA 1TP0A 1VM8A 1JY0A 4G87A 3UDAA 3CRIA 1H5SA 3FUOA 2DRYA 3U2WA 4IQPA 1S0CA 5D63A 1Q03A 5EC5A 4EEEB 1FGXA 1JT7A 2D23A 2YUGA 4IY9A 1G1LA 1TW5A 3ZXDA 2RJ7A 3OC9A 4Q7CA 1G9AA 5C1HA 3W9TA 1JLXA 1YROB 3CRGA 2FFUA 3CKOA 4OEGA 1ZHJA 1GX0A 3I0DA 2AXMA 1ZIZA 2WBCA 2V0LA 4Z8SB 2FYDB 4HR6C 3UJ4A 1WVCA 1SR4A 2YQHA 1G3LA 3SPTA 4HO9A 4EEAA 4UY4A 5BP5C 4EE4A 4HCQA 2PX7A 4L4IA 4DDZA 2AECA 3CKQA 1INJA 3V0NA 3CRHA 1H7TA 4II0A 1VGWA 9ILBA 3IM6A 3A23A 4OWKA 2WE9A 3O5WB 1I1BA 5D61A 2WVLA 3V0PA 1HWMB 4ZOTA 1AVWB 1VH1A 4Y7GA 4X38A 3ZLKA 5C4CA 1AFCA 3QR5A 2ICYA 1S4PA 3N7KA 4FRBA 3N7MA 2FO1A 1HCDA 1H7EA 3SXEA 3OJ2A 1JTCA 3BAHA 1OQLB 4FQWA 2E4MA 4ARWA 3DK5A 3WINC 3E8LC 3BA7A 1XHBA 4IY8A 3OH2A 4LW3A 2BO7A 2ICXA 1PZZA 4JKXB 4D8HA 1VZXA 3U2UA 1JT5A 1NMMB 3FFZA 3OH4A 4OWLA 3SXBA 1FXJA 1IRPA 3FJBA 1ABRB 2UUSA 2Q9XA 1IOBA 1WD4A 5BXTA 1VH3A 2Y4LA 3POKA 1PZYB 3OKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAH A;  3FJF A;  2HWM A;  3JUT A;  2MLL B;  2NXV A;  2PGY A;  2WRY A;  1S0F A;  1DJS B;  3SXC A;  4I8M A;  3ZC9 A;  2P73 A;  2ESU A;  3WO3 A;  1FGG A;  4QO3 A;  1G97 A;  1QQK A;  4R7P A;  5CMJ A;  3V0A B;  3FJI A;  1BFB A;  4LO8 B;  1HCE A;  1HM8 A;  4ZLB B;  3OGZ A;  4YOL A;  5C3A A;  1INI A;  5C8R A;  1ISW A;  2QKX A;  1MP4 A;  1VGU A;  2VSI A;  3TQD A;  4X39 A;  3UD8 A;  3C9Z A;  1JYL A;  5C4E A;  4I3N A;  1G9D A;  4Z9W B;  4I96 A;  4ZFU B;  3NBC A;  1ZJ2 A;  2X2T A;  2VXL A;  4FRH A;  3CA6 A;  1WBC A;  3NJ5 A;  3ST8 A;  3SXD A;  3O3Q A;  3CKN A;  5FZU A;  2JCJ A;  1G82 A;  1NKH B;  2L5X A;  4KT7 A;  2FGF A;  3N0K A;  4ZFY B;  5C47 A;  3O44 A;  5CQP A;  3V8Z A;  5L6V A;  2OI6 A;  1AVU A;  4NAN A;  2KH2 A;  2ZQO A;  3I29 B;  1NZK A;  1J0S A;  4ZFW B;  1G2V A;  1JQZ A;  2APC A;  3Q7X A;  2JCK A;  1DZC A;  4HG6 A;  4JD0 A;  3V0A A;  2QH5 A;  4Y7T A;  5EG6 C;  1YP3 A;  3SNV A;  2E4M C;  2GZB A;  3PG0 A;  3D8V A;  4KNR A;  2OEG A;  3ZGF A;  3CU0 A;  1Z0H A;  2NYY A;  3I2X A;  4J2S A;  2FYB A;  2FYC B;  1BAS A;  2XWN A;  5CQN X;  4LO1 C;  3CQA A;  4Y62 A;  3BAU A;  1Z2V A;  2P6W A;  2YES A;  4JAW A;  4I4Q A;  2JCL A;  4B5B A;  1L2H A;  4JRA A;  1WSZ A;  1JT3 A;  2GGO A;  4AYJ A;  3PUB A;  1GQ9 A;  5C1G A;  4EEO A;  1E5K A;  4I4Y A;  1BAR A;  3R2W A;  3T7N A;  5BP5 A;  5F90 A;  2AFG A;  3OH3 A;  4L41 C;  2V0K A;  4D11 A;  1IRA X;  1BFC A;  1ISV A;  2QYI B;  4KBB A;  1LZ7 A;  4J23 B;  1TIE A;  3CA3 A;  1QGQ A;  3ILA A;  1KWS A;  1YP2 A;  3R3I A;  3GUE A;  4JP0 A;  2K8R A;  4GP3 A;  3IOH A;  1GGP B;  1TTU A;  2D24 A;  5BXC A;  2YQS A;  2D0J A;  4Q9P A;  1IIN A;  2ZU9 A;  3CA5 A;  1NF5 B;  4FRL A;  1ON8 A;  2W0V A;  3FJC A;  2RJ9 A;  4ASJ A;  1ISX A;  1PUM B;  5E24 E;  1ZDF A;  5F8Y A;  2YQC A;  3V0L A;  5CMI A;  4J2X A;  4G3S A;  3WIN A;  1V84 A;  4OEE A;  1G23 A;  1K4V A;  4CJC A;  5IDT A;  1PUU B;  3A21 A;  4HJJ A;  4QBC A;  3ZX7 A;  3BRK X;  3H6R B;  4USP A;  1ONK B;  2WGZ A;  4H04 A;  1QWJ A;  2CU2 A;  4A7Y A;  4Y9X A;  3UJ0 A;  4ECM A;  2I1B A;  1JV1 A;  3E25 A;  4HO0 A;  3IOI A;  3SXA A;  3VEQ A;  1JV3 A;  3OAM A;  5IFY A;  2ZR1 B;  4I4U A;  2IWT B;  2ZU8 A;  4KEJ A;  3HL3 A;  1G9B A;  3AH2 A;  4EFP A;  4EKX B;  2LIE A;  2A8W A;  3CA1 A;  1HM0 A;  5C4F A;  3HBW A;  4B3U A;  4JQ0 A;  3O3P A;  4HO5 A;  3T7M A;  2A8U A;  2KI6 B;  1V82 A;  1R81 A;  2QGI A;  3I0K A;  4I4O A;  1KNM A;  2D22 A;  2VSE A;  1H4C A;  3U2X A;  1V6V A;  1DIW A;  1GQC A;  1TZF A;  1MP5 A;  3U0X A;  5IDS A;  1IHK A;  3CKV A;  2D7I A;  1BFG A;  4QBV A;  1FMZ A;  3OGG A;  4CJM A;  1VCL A;  3RTJ B;  1R7U A;  3VWC A;  2Z86 A;  1N4K A;  4I7I A;  2F2F C;  3USR A;  4ASY A;  3WO4 A;  4I37 A;  4ZBV B;  3H6R A;  3UD9 A;  1IIM A;  4D11 C;  2Y6P A;  5JMC A;  4P02 A;  4I1B A;  5DVH A;  3OGF A;  3IM7 A;  3QVB A;  1FO8 A;  4XFT A;  3O4C A;  1ZCT A;  3WMV A;  3BRG C;  1HKN A;  4KEK A;  1S0G A;  3FJ9 A;  2E3D A;  1HV9 A;  5FV9 A;  1FR8 A;  1S0L A;  3LLP A;  1ISZ A;  2KKI A;  1FZW A;  1NWG B;  2VS3 A;  2X60 A;  5BXR A;  3FWW A;  4P6A A;  2BO8 A;  1DZD A;  3CU1 B;  2FFV A;  3HSM A;  1D0H A;  1RY7 A;  3WA1 A;  4A7Z A;  1S0B A;  2Z87 A;  3FOQ A;  4F83 A;  5EJZ A;  2FDB M;  2AES A;  4IRQ A;  3FGM A;  3AKI A;  1QG8 A;  1BLA A;  5F8S A;  1H7F A;  1LL2 A;  2YC5 A;  1V6X A;  3V8Y A;  3TC2 A;  4P0J A;  1LZ0 A;  4X3A A;  4LO1 A;  2WVM A;  1BFF A;  4FVV A;  4J2K A;  2QN4 A;  4I0Y A;  5BQU A;  2WVK A;  3R4S A;  5FTS A;  1R7X A;  5AJN A;  2RJ4 A;  3I0F A;  3ZGG A;  1R7Y A;  4OW4 A;  2XWL A;  3SX8 A;  3IAG C;  3V0Q A;  3HMY A;  4XFU A;  1FWV A;  2NP0 A;  5JLV A;  4GOY A;  1T4Q A;  1QGS A;  1H7G A;  1ZI5 A;  4B2X A;  3POL A;  1YP4 A;  3CGX A;  3SX3 A;  2AH9 A;  3HAL A;  1LVW A;  1NHE B;  3T7O A;  5EIY A;  4EE5 A;  3N9W A;  3PKQ A;  1VIC A;  3LTQ A;  4I4V A;  2AQZ A;  3Q7Y A;  4B4B A;  3SX5 A;  4LO0 C;  1R7T A;  1ILR 1;  1FV2 A;  3N7L A;  3BA4 A;  2K43 A;  3I0H A;  4FRQ A;  1PZT A;  5HS2 A;  5FZZ A;  3ZLL A;  1FV3 A;  2Y9F A;  3BAV A;  5FU8 A;  1S0E A;  4B4M A;  3EF2 A;  3MAL A;  3U0Y A;  2RIT A;  2D43 A;  3OH1 A;  2X2S A;  2Y9X E;  3F1Y A;  4G9M A;  4HO6 A;  4Y7V A;  5AJP A;  4QAL A;  1YYN A;  1IIL A;  4OWJ A;  2Y7A A;  4IZX A;  2XMH A;  1H3M A;  1S4O A;  1ZJ3 A;  2DRZ A;  2RJ5 A;  1VZT A;  3CKJ A;  4G3Q A;  3VUO A;  2OI7 A;  1M16 A;  3IOJ A;  4DEP A;  1G95 A;  2P72 A;  5DDV A;  3WO2 A;  1EPW A;  4IRP A;  1O23 B;  5L6S A;  4J18 A;  2MC2 A;  3V79 C;  5DDT A;  1F31 A;  3RMY A;  3F62 B;  4C2S A;  4FRE A;  2VU9 A;  1ZCV A;  4G1R A;  1CVS A;  2RQ9 A;  3A07 A;  2NM1 A;  2RJ8 A;  3A22 A;  5C3D A;  1VPA A;  3RMW A;  1HWN B;  1WT1 A;  2ZU7 A;  3SXG A;  1W77 A;  3MPP G;  5BQU C;  2X5S A;  4OUJ A;  5D62 A;  1ZI3 A;  2RJ0 A;  2BEA A;  3T8S A;  3EE5 A;  1RZO B;  3IIR A;  2F8X C;  2AM4 A;  1ISY A;  2VSA A;  4LO7 B;  2HW9 A;  2VSH A;  3ZXG A;  4KC2 A;  4QC4 A;  3Q4S A;  1HJL A;  4D0Z A;  4KXO A;  1DQO A;  4LW6 A;  2XOA A;  2VFZ A;  2D20 A;  2F2F A;  4Y6N A;  5BXS A;  5DUY A;  4YS8 A;  3FUQ A;  2HZ9 A;  1IT0 A;  2ZQN A;  4XFS A;  5EJ1 A;  4L4H A;  3BRD A;  5DSS B;  1T9F A;  1PC8 B;  3RTI B;  2VXM A;  3I0C A;  4FRD A;  4NAK A;  3ZF8 A;  4I4R A;  31BI A;  1V83 A;  1ZCY A;  3F1C A;  4HO2 A;  1DQG A;  2IHO A;  2Y9W C;  2X65 A;  3V0O A;  3CA0 A;  3D98 A;  2P39 A;  3O4A A;  2I5E A;  4KPZ A;  1ZI4 A;  4KEI A;  1P63 A;  3V0M A;  2J3P A;  3D7W B;  1K5U A;  3QYD A;  3VT0 A;  4Q91 A;  1S4N A;  1EVT A;  2VXR A;  4GAI A;  4P00 A;  3BX1 C;  2Y4J A;  4DEC A;  1TFM B;  3AJ6 A;  1G9C A;  1AVA C;  2Q3N B;  2O1G A;  4I2S A;  3ZC8 A;  3N7J A;  1LZI A;  2KI4 A;  3Q80 A;  4F34 A;  1AVX B;  1H7Q A;  1HIB A;  1TW1 A;  2AM5 A;  4DE7 A;  2XWM A;  3AH4 A;  1BA7 A;  1YXW A;  7I1B A;  3S8J A;  2RJ1 A;  1SS9 A;  4B42 A;  4EE3 A;  4HOC A;  1DFQ A;  1H5S B;  1YTO A;  3AKF A;  2RG9 B;  1FXO A;  1O0R A;  2Y9G A;  4JKQ A;  3Q7W A;  4I4X A;  4HO4 A;  1JLY A;  5FZY A;  5BXP A;  1Z90 A;  2FYA A;  5CMF X;  1EZI A;  4FRP A;  3NGW A;  3OJM A;  2VXT I;  4KC3 A;  4END A;  3PHZ A;  1XZZ A;  4I6I A;  1H4E A;  1LL0 A;  2RIY A;  4QD2 B;  3KIA A;  4UEG A;  1HWO B;  1LZJ A;  4H9W A;  1H5T B;  4IHZ A;  4G6J A;  5G00 A;  3BAO A;  4LO0 A;  4ZA3 B;  1W3F A;  2VUA A;  1FO9 A;  2VS5 A;  2W0W A;  3V90 A;  3E26 A;  4GP0 A;  1MD6 A;  2KLL A;  2V0I A;  2MZB A;  2I7B A;  1HM9 A;  1G8O A;  3P6I A;  2DS0 A;  1AF9 A;  2RST A;  1H5R B;  1ZCU A;  4KC4 A;  1FWU A;  4BQH A;  5C49 A;  1V6U A;  1VGT A;  2D44 A;  2OEF A;  3D5N A;  1FR9 A;  3RSJ A;  2RIZ A;  1R82 A;  1II4 A;  1Q1U A;  2UX8 A;  1WD3 A;  1WT2 A;  2YQJ A;  3V91 A;  4XKI A;  5FYE A;  1Q04 A;  4ZGR B;  2Q4J A;  1GA8 A;  4ISR A;  1FMM S;  2NZ9 A;  5BVP I;  1GWW A;  2BO4 A;  2O1H A;  5C4B A;  2BFH A;  5CMH A;  3VSZ A;  1G0R A;  5FU0 A;  2WEE A;  3USQ A;  5C38 A;  3I0J A;  4AN7 B;  2LIQ A;  1H5T A;  2WAW A;  2VS4 A;  4KQL A;  4LO7 C;  2V0J A;  2PGV A;  4M4K A;  5DZU A;  2AGD A;  2RJ6 A;  4M2B A;  4Y7F A;  3BA5 A;  2PA4 A;  3BAQ A;  3O4B A;  3VT2 A;  2VD4 A;  1H5R A;  3TZT A;  1V6W A;  41BI A;  1R7V A;  4AYL A;  1ITB A;  4HA2 A;  4LO3 C;  1JVG A;  5CQO A;  2NTD A;  1JYK A;  3OJV A;  1RG8 A;  3BCV A;  4R6U B;  5C4D A;  5FUH A;  4P0L A;  3UD7 A;  4I4P A;  5FNX A;  4EB2 B;  2GGQ A;  4FCE A;  2ERM A;  3AZW A;  3JUJ A;  1EYL A;  1ON6 A;  2OI5 A;  2D7R A;  4JIS A;  3I0L A;  1NUN A;  1O7O A;  4FCU A;  4FRA A;  1FQ9 A;  2X5Z A;  4B4G A;  1TWM A;  5HPZ A;  3Q7U A;  3RMV A;  1YBI A;  1MP3 A;  2R9K B;  4NAL A;  4IYB A;  4USO A;  2O1F A;  1SZ6 B;  4OEF A;  2DPW A;  3JUK A;  1HJJ A;  1O7Q A;  4EEG A;  1G9R A;  3JRR A;  3U2V A;  4ZKT B;  1S0D A;  4IZE A;  2Y4M A;  4KPX A;  8I1B A;  1A8D A;  3OH0 A;  2Z48 A;  4J2Y A;  3I0G A;  2YCM A;  4MYB A;  4EFR A;  2GO2 A;  1TVY A;  1VGZ A;  4M2A A;  3VSF A;  3AH1 A;  1H5S C;  5F8W A;  1AXM A;  4XWI A;  4CVH A;  3AZV A;  5I1F A;  3H6S E;  1W57 A;  1BLD A;  1GWV A;  3P6J A;  1R8O A;  1TWE A;  2E8B A;  2V0H A;  4FRM A;  4KNX A;  4KRV A;  5CQM X;  2M49 A;  3B9U A;  4ISQ A;  1HWP B;  5C48 A;  4DCK C;  4AN6 A;  3KMV A;  4EEM A;  1XZ6 A;  4QD2 C;  5GAQ A;  3IM5 A;  4G6M A;  3HOM A;  3I0I X;  4G3P A;  3BAD A;  2XME A;  1OQM B;  3BB2 A;  1SR4 C;  4GAF A;  4QKR A;  4WBC A;  5CMG X;  4Y6U A;  4TLP A;  4NAI A;  3JTJ A;  4I4S A;  1FRW A;  1ZDG A;  2ET2 A;  1GX4 A;  1ZJ0 A;  1ZJP A;  1CE7 B;  4Y7U A;  1PWA A;  1UPS A;  4D48 A;  4X37 A;  1IJT A;  1Z4S A;  1FG5 N;  2AE7 A;  4M28 A;  21BI A;  4B2W A;  1WT0 A;  4HO8 A;  4CJB A;  3FJH A;  4D0T A;  3PNN A;  2K4A B;  3OBR A;  4LO2 A;  3AKH A;  4FRO A;  4Y64 A;  4MND A;  3P53 A;  2Z49 A;  3NBN A;  4EFQ A;  1XYF A;  4PC4 A;  3O4D A;  1OMX A;  3U2T A;  1W3G A;  2MIB A;  5FNW A;  5AJO A;  4JPZ A;  1M2T B;  3O49 A;  3K8D A;  1OMZ A;  1JT4 A;  1VZU A;  3PME A;  3LW6 A;  5JQQ A;  3BTA A;  3RSB A;  5BOW A;  2JCO A;  1MC3 A;  1XG6 A;  1MC9 A;  1I1E A;  4P0K A;  3V0B B;  1FN0 A;  3AKG A;  3I0E A;  5J49 A;  3NBD A;  2RIX A;  1K5V A;  4G9N A;  1R8N A;  3K1X A;  5B2H A;  1H7L A;  1RML A;  3DUV A;  3H6Q A;  1FWY A;  3OBT A;  3FJK A;  3WMU A;  3RMX A;  3CA4 A;  4ION A;  4BMA A;  5C3B A;  2HWA A;  3FJA A;  2AM3 A;  3DJ4 A;  5CQL X;  1DFC A;  1TOO A;  3AJ5 A;  3I2A A;  4HO3 A;  1ZJO A;  3VT1 A;  2AAI B;  4KC1 A;  1G93 A;  4Q9G A;  1ZI1 A;  2BO6 A;  2I5K A;  1DLL A;  4LO3 A;  5I1B A;  4AC3 A;  1WT3 A;  4AAW A;  3NBE A;  5C1L A;  3FJE A;  1QXM A;  4K6R A;  3HN1 A;  4I1E A;  4EVW A;  3O4O A;  3K8E A;  4FGF A;  4DEN A;  3FJD A;  3R4U A;  4CJ8 A;  3FJJ A;  1WBA A;  2Y4K A;  3V0B A;  4ZDQ A;  4E1K A;  4GBP A;  4QKS A;  3S8K A;  1H7H A;  3F1R A;  1QQL A;  4A7K A;  1FOA A;  1H4D A;  3BAG A;  1JVD A;  2P23 A;  4Y63 A;  2DRE A;  3PKP A;  2FY7 A;  4LO2 C;  1W3A A;  2NVH A;  5EHA A;  1E0O A;  1NQI B;  1H5S D;  1ZJ1 A;  1EV2 A;  6I1B A;  1I52 A;  1R80 A;  5FTV A;  3FJ8 A;  2YC3 A;  1YF8 B;  2VLC A;  3BRF A;  1FGA A;  1W55 A;  5C36 A;  2BEB A;  2D1Z A;  1EYR A;  3SX7 A;  1LL3 A;  4GOV A;  1TP0 A;  1VM8 A;  1JY0 A;  4G87 A;  3UDA A;  3CRI A;  1H5S A;  3FUO A;  2DRY A;  3U2W A;  4IQP A;  1S0C A;  5D63 A;  1Q03 A;  5EC5 A;  4EEE B;  1FGX A;  1JT7 A;  2D23 A;  2YUG A;  4IY9 A;  1G1L A;  1TW5 A;  3ZXD A;  2RJ7 A;  3OC9 A;  5C1H A;  1G9A A;  3W9T A;  1JLX A;  1YRO B;  3CRG A;  2FFU A;  3CKO A;  4OEG A;  1ZHJ A;  1GX0 A;  3I0D A;  2AXM A;  1ZIZ A;  2WBC A;  2V0L A;  4Z8S B;  2FYD B;  4HR6 C;  3UJ4 A;  1WVC A;  1SR4 A;  2YQH A;  1G3L A;  3SPT A;  4HO9 A;  4EEA A;  5BP5 C;  4EE4 A;  4HCQ A;  2PX7 A;  4L4I A;  4DDZ A;  2AEC A;  3CKQ A;  1INJ A;  3V0N A;  3CRH A;  1H7T A;  4II0 A;  1VGW A;  9ILB A;  3IM6 A;  3A23 A;  4OWK A;  2WE9 A;  3O5W B;  1I1B A;  5D61 A;  2WVL A;  3V0P A;  1HWM B;  4ZOT A;  1AVW B;  1VH1 A;  4Y7G A;  4X38 A;  3ZLK A;  5C4C A;  1AFC A;  3QR5 A;  2ICY A;  1S4P A;  3N7K A;  4FRB A;  3N7M A;  2FO1 A;  1HCD A;  1H7E A;  3SXE A;  3OJ2 A;  1JTC A;  3BAH A;  1OQL B;  4FQW A;  2E4M A;  4ARW A;  3DK5 A;  3WIN C;  3E8L C;  3BA7 A;  1XHB A;  4IY8 A;  3OH2 A;  4LW3 A;  2BO7 A;  2ICX A;  1PZZ A;  4JKX B;  4D8H A;  1VZX A;  3U2U A;  1JT5 A;  1NMM B;  3FFZ A;  3OH4 A;  4OWL A;  3SXB A;  1FXJ A;  1IRP A;  3FJB A;  1ABR B;  2UUS A;  2Q9X A;  1IOB A;  1WD4 A;  5BXT A;  1VH3 A;  2Y4L A;  3POK A;  1PZY B;  3OKR A; 
#chains in the Genus database with same CATH topology
 3CAH A;  3FJF A;  4O6M A;  2HWM A;  3JUT A;  2MLL B;  2NXV A;  2PGY A;  2WRY A;  1S0F A;  1DJS B;  3SXC A;  4I8M A;  3ZC9 A;  2P73 A;  4O6N A;  2ESU A;  3WO3 A;  1FGG A;  4QO3 A;  1G97 A;  1QQK A;  4R7P A;  5CMJ A;  3V0A B;  4H75 A;  3FJI A;  1BFB A;  4LO8 B;  1HCE A;  1HM8 A;  4ZLB B;  3OGZ A;  4YOL A;  5C3A A;  1INI A;  5C8R A;  1ISW A;  2QKX A;  1MP4 A;  1VGU A;  2VSI A;  3TQD A;  4X39 A;  3UD8 A;  3C9Z A;  1JYL A;  5C4E A;  4I3N A;  1G9D A;  4Z9W B;  4I96 A;  4ZFU B;  3NBC A;  1ZJ2 A;  2X2T A;  2VXL A;  4FRH A;  3CA6 A;  1WBC A;  3NJ5 A;  3ST8 A;  3SXD A;  3O3Q A;  3CKN A;  5FZU A;  2JCJ A;  1G82 A;  1NKH B;  2L5X A;  4KT7 A;  2FGF A;  3N0K A;  4ZFY B;  5C47 A;  3O44 A;  5CQP A;  3V8Z A;  5L6V A;  2OI6 A;  1AVU A;  4NAN A;  2KH2 A;  2ZQO A;  3I29 B;  1NZK A;  1J0S A;  4ZFW B;  1G2V A;  1JQZ A;  2APC A;  3Q7X A;  2JCK A;  1DZC A;  4HG6 A;  4JD0 A;  3V0A A;  2QH5 A;  4Y7T A;  5EG6 C;  1YP3 A;  3SNV A;  2E4M C;  2GZB A;  3PG0 A;  3D8V A;  4KNR A;  2OEG A;  3ZGF A;  3CU0 A;  1Z0H A;  2NYY A;  3I2X A;  4J2S A;  2FYB A;  2FYC B;  1BAS A;  2XWN A;  5CQN X;  4LO1 C;  3CQA A;  4Y62 A;  3BAU A;  1Z2V A;  5D91 A;  2P6W A;  2YES A;  4JAW A;  4I4Q A;  2JCL A;  2NS2 A;  1L2H A;  4B5B A;  4JRA A;  1WSZ A;  1JT3 A;  2GGO A;  4AYJ A;  3PUB A;  1GQ9 A;  5C1G A;  4EEO A;  1E5K A;  4I4Y A;  1BAR A;  2C0N A;  3R2W A;  3T7N A;  5BP5 A;  5F90 A;  2AFG A;  3OH3 A;  4L41 C;  2V0K A;  4D11 A;  1IRA X;  1BFC A;  1ISV A;  2QYI B;  4KBB A;  1LZ7 A;  4J23 B;  1TIE A;  3CA3 A;  1QGQ A;  3ILA A;  1KWS A;  1YP2 A;  3R3I A;  3GUE A;  4JP0 A;  2K8R A;  4GP3 A;  3IOH A;  1GGP B;  1TTU A;  2D24 A;  5BXC A;  2YQS A;  2D0J A;  4Q9P A;  1IIN A;  2ZU9 A;  3CA5 A;  1NF5 B;  4FRL A;  1ON8 A;  2W0V A;  3FJC A;  2RJ9 A;  4ASJ A;  1ISX A;  1PUM B;  5E24 E;  1ZDF A;  5F8Y A;  2YQC A;  3V0L A;  5CMI A;  4J2X A;  4G3S A;  3WIN A;  1V84 A;  4OEE A;  1G23 A;  4MZH A;  1K4V A;  4CJC A;  5IDT A;  1PUU B;  3A21 A;  4HJJ A;  4QBC A;  3ZX7 A;  3BRK X;  3H6R B;  4USP A;  1ONK B;  2WGZ A;  4H04 A;  1QWJ A;  2CU2 A;  4A7Y A;  4Y9X A;  3UJ0 A;  4ECM A;  2I1B A;  1JV1 A;  3E25 A;  4HO0 A;  3IOI A;  3SXA A;  3VEQ A;  1JV3 A;  3OAM A;  5IFY A;  2ZR1 B;  4I4U A;  2IWT B;  2ZU8 A;  4KEJ A;  3HL3 A;  1G9B A;  3AH2 A;  4EFP A;  4EKX B;  2LIE A;  2A8W A;  3CA1 A;  1HM0 A;  5C4F A;  3HBW A;  4B3U A;  4JQ0 A;  3O3P A;  4HO5 A;  3T7M A;  2A8U A;  2KI6 B;  1V82 A;  1R81 A;  2QGI A;  3I0K A;  4I4O A;  1KNM A;  2D22 A;  2VSE A;  1H4C A;  3U2X A;  1V6V A;  1DIW A;  1GQC A;  1TZF A;  1MP5 A;  3U0X A;  5IDS A;  1IHK A;  3CKV A;  2D7I A;  1BFG A;  4QBV A;  1FMZ A;  3OGG A;  4CJM A;  1VCL A;  3RTJ B;  1R7U A;  3VWC A;  2Z86 A;  1N4K A;  4I7I A;  2F2F C;  3USR A;  4ASY A;  3WO4 A;  4I37 A;  4ZBV B;  3H6R A;  3UD9 A;  1IIM A;  4D11 C;  2Y6P A;  5JMC A;  4P02 A;  4I1B A;  5DVH A;  3OGF A;  3IM7 A;  3QVB A;  1FO8 A;  4XFT A;  3O4C A;  1ZCT A;  3WMV A;  3BRG C;  1HKN A;  4KEK A;  1S0G A;  3FJ9 A;  2E3D A;  2J0B A;  1HV9 A;  5FV9 A;  1FR8 A;  1S0L A;  3LLP A;  1ISZ A;  2KKI A;  1FZW A;  1NWG B;  2VS3 A;  2X60 A;  5BXR A;  3FWW A;  4P6A A;  2BO8 A;  1DZD A;  3CU1 B;  2FFV A;  3HSM A;  1D0H A;  1RY7 A;  3WA1 A;  4A7Z A;  1S0B A;  2Z87 A;  3FOQ A;  4F83 A;  5EJZ A;  2FDB M;  2AES A;  4IRQ A;  3FGM A;  3AKI A;  1QG8 A;  1BLA A;  5F8S A;  1H7F A;  1LL2 A;  2YC5 A;  1V6X A;  3V8Y A;  3TC2 A;  4P0J A;  1LZ0 A;  4X3A A;  4LO1 A;  2WVM A;  1BFF A;  4FVV A;  4J2K A;  2QN4 A;  4I0Y A;  5BQU A;  2WVK A;  3R4S A;  5FTS A;  1R7X A;  5AJN A;  2RJ4 A;  3I0F A;  3ZGG A;  1R7Y A;  4OW4 A;  2XWL A;  3SX8 A;  3IAG C;  3V0Q A;  3HMY A;  4XFU A;  1FWV A;  2NP0 A;  5JLV A;  4GOY A;  1T4Q A;  1QGS A;  1H7G A;  1ZI5 A;  4B2X A;  3POL A;  1YP4 A;  3CGX A;  3SX3 A;  2AH9 A;  3HAL A;  1LVW A;  1NHE B;  3T7O A;  5EIY A;  4EE5 A;  3N9W A;  3PKQ A;  1VIC A;  3LTQ A;  4I4V A;  2AQZ A;  3Q7Y A;  4B4B A;  3SX5 A;  4LO0 C;  1R7T A;  1ILR 1;  1FV2 A;  3N7L A;  3BA4 A;  2K43 A;  3I0H A;  4FRQ A;  1PZT A;  5HS2 A;  5FZZ A;  3ZLL A;  1FV3 A;  2Y9F A;  3BAV A;  5FU8 A;  1S0E A;  4B4M A;  3EF2 A;  3MAL A;  3U0Y A;  2RIT A;  2D43 A;  3OH1 A;  2X2S A;  2Y9X E;  3F1Y A;  4G9M A;  4HO6 A;  4Y7V A;  5AJP A;  4QAL A;  1YYN A;  1IIL A;  4OWJ A;  2VK9 A;  2Y7A A;  4IZX A;  2XMH A;  1H3M A;  1S4O A;  1ZJ3 A;  2DRZ A;  2RJ5 A;  1VZT A;  3CKJ A;  4G3Q A;  3VUO A;  2OI7 A;  1M16 A;  3IOJ A;  4DEP A;  1G95 A;  2P72 A;  5DDV A;  3WO2 A;  1EPW A;  4IRP A;  1O23 B;  5L6S A;  4J18 A;  2MC2 A;  3V79 C;  5DDT A;  1F31 A;  3RMY A;  3F62 B;  4C2S A;  4FRE A;  2VU9 A;  1ZCV A;  4G1R A;  1CVS A;  2RQ9 A;  3A07 A;  2NM1 A;  2RJ8 A;  3A22 A;  5C3D A;  1VPA A;  3RMW A;  1HWN B;  1WT1 A;  2ZU7 A;  3SXG A;  1W77 A;  3MPP G;  5BQU C;  2X5S A;  4OUJ A;  5D62 A;  1ZI3 A;  2RJ0 A;  2BEA A;  3T8S A;  3EE5 A;  1RZO B;  3IIR A;  2F8X C;  2AM4 A;  1ISY A;  2VSA A;  4LO7 B;  2HW9 A;  2VSH A;  3ZXG A;  4KC2 A;  4QC4 A;  3Q4S A;  1HJL A;  4MZF B;  4D0Z A;  4KXO A;  1DQO A;  4LW6 A;  2XOA A;  2VFZ A;  2D20 A;  2F2F A;  4Y6N A;  5BXS A;  5DUY A;  4YS8 A;  3FUQ A;  2HZ9 A;  1IT0 A;  2ZQN A;  4XFS A;  5EJ1 A;  4L4H A;  3BRD A;  5DSS B;  1T9F A;  1PC8 B;  3RTI B;  2VXM A;  3I0C A;  4FRD A;  4NAK A;  3ZF8 A;  4I4R A;  31BI A;  1V83 A;  1ZCY A;  3F1C A;  4HO2 A;  1DQG A;  2IHO A;  2Y9W C;  2X65 A;  3V0O A;  3CA0 A;  3D98 A;  2P39 A;  3O4A A;  2I5E A;  4KPZ A;  1ZI4 A;  4KEI A;  1P63 A;  3V0M A;  2J3P A;  3D7W B;  1K5U A;  3QYD A;  3VT0 A;  4Q91 A;  1S4N A;  1EVT A;  2VXR A;  4GAI A;  4P00 A;  3BX1 C;  2Y4J A;  4DEC A;  1TFM B;  3AJ6 A;  1G9C A;  1AVA C;  2Q3N B;  2O1G A;  4I2S A;  3ZC8 A;  3N7J A;  1LZI A;  2KI4 A;  3Q80 A;  4F34 A;  1AVX B;  1H7Q A;  1HIB A;  1TW1 A;  2AM5 A;  4DE7 A;  2XWM A;  3AH4 A;  1BA7 A;  1YXW A;  7I1B A;  3S8J A;  2RJ1 A;  1SS9 A;  4B42 A;  4EE3 A;  4HOC A;  1DFQ A;  1H5S B;  1YTO A;  3AKF A;  2RG9 B;  1FXO A;  1O0R A;  2Y9G A;  4JKQ A;  3Q7W A;  4I4X A;  4HO4 A;  1JLY A;  5FZY A;  5BXP A;  1Z90 A;  2FYA A;  5CMF X;  1EZI A;  4FRP A;  3NGW A;  3OJM A;  2VXT I;  4KC3 A;  4END A;  3PHZ A;  1XZZ A;  4I6I A;  1H4E A;  1LL0 A;  2RIY A;  4QD2 B;  3KIA A;  4UEG A;  1HWO B;  1LZJ A;  4H9W A;  1H5T B;  4IHZ A;  4G6J A;  5G00 A;  3BAO A;  4LO0 A;  4ZA3 B;  1W3F A;  2VUA A;  1FO9 A;  2VS5 A;  2W0W A;  3V90 A;  3E26 A;  4GP0 A;  1MD6 A;  2KLL A;  2V0I A;  2MZB A;  2I7B A;  1HM9 A;  1G8O A;  3P6I A;  2DS0 A;  1AF9 A;  2RST A;  1H5R B;  1ZCU A;  4KC4 A;  1FWU A;  4BQH A;  5C49 A;  1V6U A;  1VGT A;  2D44 A;  2OEF A;  3D5N A;  1FR9 A;  3RSJ A;  2RIZ A;  1R82 A;  1II4 A;  1Q1U A;  2UX8 A;  1WD3 A;  1WT2 A;  2YQJ A;  3V91 A;  4XKI A;  5FYE A;  1Q04 A;  4ZGR B;  2Q4J A;  1GA8 A;  4ISR A;  1FMM S;  2NZ9 A;  5BVP I;  1GWW A;  2BO4 A;  2O1H A;  5C4B A;  2BFH A;  5CMH A;  3VSZ A;  1G0R A;  5FU0 A;  2WEE A;  2J0A A;  3USQ A;  5C38 A;  3I0J A;  4AN7 B;  2LIQ A;  1H5T A;  2WAW A;  2VS4 A;  4KQL A;  4LO7 C;  2V0J A;  2PGV A;  4M4K A;  5DZU A;  2AGD A;  2RJ6 A;  4M2B A;  4Y7F A;  3BA5 A;  2PA4 A;  3BAQ A;  3O4B A;  3VT2 A;  2VD4 A;  1H5R A;  3TZT A;  1V6W A;  41BI A;  1R7V A;  4AYL A;  1ITB A;  4HA2 A;  4LO3 C;  1JVG A;  5CQO A;  2NTD A;  1JYK A;  3OJV A;  1RG8 A;  3BCV A;  4R6U B;  4MIX A;  5C4D A;  5FUH A;  4P0L A;  3UD7 A;  4I4P A;  5FNX A;  4EB2 B;  2GGQ A;  4FCE A;  2ERM A;  3AZW A;  3JUJ A;  1EYL A;  1ON6 A;  2OI5 A;  4FIY A;  2D7R A;  4JIS A;  3I0L A;  1NUN A;  1O7O A;  4FCU A;  4FRA A;  1FQ9 A;  2X5Z A;  4B4G A;  1TWM A;  5HPZ A;  3Q7U A;  3RMV A;  1YBI A;  1MP3 A;  2R9K B;  4NAL A;  4IYB A;  4USO A;  2O1F A;  1SZ6 B;  4OEF A;  2DPW A;  3JUK A;  1HJJ A;  1O7Q A;  4EEG A;  1G9R A;  3JRR A;  3U2V A;  4ZKT B;  1S0D A;  4IZE A;  2Y4M A;  4KPX A;  8I1B A;  1A8D A;  3OH0 A;  2Z48 A;  4J2Y A;  3I0G A;  2YCM A;  4MYB A;  4EFR A;  2GO2 A;  1TVY A;  1VGZ A;  4M2A A;  3VSF A;  3AH1 A;  1H5S C;  5F8W A;  1AXM A;  4XWI A;  4CVH A;  3AZV A;  5I1F A;  3H6S E;  1W57 A;  4FIX A;  1BLD A;  1GWV A;  3P6J A;  1R8O A;  1TWE A;  2E8B A;  2V0H A;  4FRM A;  4KNX A;  4KRV A;  5CQM X;  2M49 A;  3B9U A;  4ISQ A;  1HWP B;  5C48 A;  4DCK C;  4AN6 A;  3KMV A;  4EEM A;  1XZ6 A;  4QD2 C;  5GAQ A;  3IM5 A;  4G6M A;  3HOM A;  3I0I X;  4G3P A;  3BAD A;  2XME A;  1OQM B;  3BB2 A;  1SR4 C;  4GAF A;  4QKR A;  4WBC A;  5CMG X;  4Y6U A;  4TLP A;  4NAI A;  3JTJ A;  4I4S A;  1FRW A;  1ZDG A;  2ET2 A;  1GX4 A;  1ZJ0 A;  1ZJP A;  1CE7 B;  4Y7U A;  1PWA A;  1UPS A;  4D48 A;  4X37 A;  1IJT A;  1Z4S A;  1FG5 N;  2AE7 A;  4M28 A;  21BI A;  4B2W A;  1WT0 A;  4HO8 A;  4CJB A;  3FJH A;  4D0T A;  3PNN A;  2K4A B;  3OBR A;  4LO2 A;  3AKH A;  4FRO A;  4Y64 A;  4MND A;  3P53 A;  2Z49 A;  3NBN A;  4EFQ A;  1XYF A;  4PC4 A;  3O4D A;  1OMX A;  3U2T A;  1W3G A;  2MIB A;  5FNW A;  5AJO A;  4JPZ A;  1M2T B;  3O49 A;  3K8D A;  1OMZ A;  1JT4 A;  1VZU A;  3PME A;  3LW6 A;  5JQQ A;  3BTA A;  3RSB A;  5BOW A;  2JCO A;  1MC3 A;  1XG6 A;  1MC9 A;  1I1E A;  4P0K A;  3V0B B;  1FN0 A;  3AKG A;  3I0E A;  5J49 A;  3NBD A;  2RIX A;  1K5V A;  4G9N A;  1R8N A;  3K1X A;  5B2H A;  4MZG B;  1H7L A;  1RML A;  3DUV A;  3H6Q A;  1FWY A;  3OBT A;  3FJK A;  3WMU A;  3RMX A;  3CA4 A;  4ION A;  4BMA A;  5C3B A;  2HWA A;  3FJA A;  2AM3 A;  3DJ4 A;  5CQL X;  1DFC A;  1TOO A;  3AJ5 A;  3I2A A;  4HO3 A;  1ZJO A;  3VT1 A;  2AAI B;  5D92 A;  4KC1 A;  1G93 A;  4Q9G A;  1ZI1 A;  2BO6 A;  2I5K A;  1DLL A;  4LO3 A;  5I1B A;  4AC3 A;  1WT3 A;  4AAW A;  3NBE A;  5C1L A;  3FJE A;  1QXM A;  4K6R A;  3HN1 A;  4I1E A;  4EVW A;  3O4O A;  3K8E A;  4FGF A;  4DEN A;  3FJD A;  3R4U A;  4CJ8 A;  3FJJ A;  1WBA A;  2Y4K A;  3V0B A;  4ZDQ A;  4E1K A;  4GBP A;  4QKS A;  3S8K A;  1H7H A;  3F1R A;  1QQL A;  4A7K A;  1FOA A;  1H4D A;  3BAG A;  1JVD A;  2P23 A;  4Y63 A;  2DRE A;  3PKP A;  2FY7 A;  4LO2 C;  1W3A A;  2NVH A;  5EHA A;  1E0O A;  1NQI B;  1H5S D;  1ZJ1 A;  1EV2 A;  6I1B A;  1I52 A;  1R80 A;  5FTV A;  3FJ8 A;  2YC3 A;  1YF8 B;  2VLC A;  3BRF A;  1FGA A;  1W55 A;  5C36 A;  2BEB A;  2D1Z A;  1EYR A;  3SX7 A;  1LL3 A;  4GOV A;  1TP0 A;  1VM8 A;  1JY0 A;  4G87 A;  3UDA A;  3CRI A;  1H5S A;  3FUO A;  2DRY A;  3U2W A;  4IQP A;  1S0C A;  5D63 A;  1Q03 A;  5EC5 A;  4EEE B;  1FGX A;  1JT7 A;  2D23 A;  2YUG A;  4IY9 A;  1G1L A;  1TW5 A;  3ZXD A;  2RJ7 A;  3OC9 A;  4Q7C A;  1G9A A;  5C1H A;  3W9T A;  1JLX A;  1YRO B;  3CRG A;  2FFU A;  3CKO A;  4OEG A;  1ZHJ A;  1GX0 A;  3I0D A;  2AXM A;  1ZIZ A;  2WBC A;  2V0L A;  4Z8S B;  2FYD B;  4HR6 C;  3UJ4 A;  1WVC A;  1SR4 A;  2YQH A;  1G3L A;  3SPT A;  4HO9 A;  4EEA A;  4UY4 A;  5BP5 C;  4EE4 A;  4HCQ A;  2PX7 A;  4L4I A;  4DDZ A;  2AEC A;  3CKQ A;  1INJ A;  3V0N A;  3CRH A;  1H7T A;  4II0 A;  1VGW A;  9ILB A;  3IM6 A;  3A23 A;  4OWK A;  2WE9 A;  3O5W B;  1I1B A;  5D61 A;  2WVL A;  3V0P A;  1HWM B;  4ZOT A;  1AVW B;  1VH1 A;  4Y7G A;  4X38 A;  3ZLK A;  5C4C A;  1AFC A;  3QR5 A;  2ICY A;  1S4P A;  3N7K A;  4FRB A;  3N7M A;  2FO1 A;  1HCD A;  1H7E A;  3SXE A;  3OJ2 A;  1JTC A;  3BAH A;  1OQL B;  4FQW A;  2E4M A;  4ARW A;  3DK5 A;  3WIN C;  3E8L C;  3BA7 A;  1XHB A;  4IY8 A;  3OH2 A;  4LW3 A;  2BO7 A;  2ICX A;  1PZZ A;  4JKX B;  4D8H A;  1VZX A;  3U2U A;  1JT5 A;  1NMM B;  3FFZ A;  3OH4 A;  4OWL A;  3SXB A;  1FXJ A;  1IRP A;  3FJB A;  1ABR B;  2UUS A;  2Q9X A;  1IOB A;  1WD4 A;  5BXT A;  1VH3 A;  2Y4L A;  3POK A;  1PZY B;  3OKR A; 
#chains in the Genus database with same CATH homology
 3CAH A;  3FJF A;  4O6M A;  2HWM A;  3JUT A;  2MLL B;  2NXV A;  2PGY A;  2WRY A;  1S0F A;  1DJS B;  3SXC A;  4I8M A;  3ZC9 A;  2P73 A;  4O6N A;  2ESU A;  3WO3 A;  1FGG A;  4QO3 A;  1G97 A;  1QQK A;  4R7P A;  5CMJ A;  3V0A B;  4H75 A;  3FJI A;  1BFB A;  4LO8 B;  1HCE A;  1HM8 A;  4ZLB B;  3OGZ A;  4YOL A;  5C3A A;  1INI A;  5C8R A;  1ISW A;  2QKX A;  1MP4 A;  1VGU A;  2VSI A;  3TQD A;  4X39 A;  3UD8 A;  3C9Z A;  1JYL A;  5C4E A;  4I3N A;  1G9D A;  4Z9W B;  4I96 A;  4ZFU B;  3NBC A;  1ZJ2 A;  2X2T A;  2VXL A;  4FRH A;  3CA6 A;  1WBC A;  3NJ5 A;  3ST8 A;  3SXD A;  3O3Q A;  3CKN A;  5FZU A;  2JCJ A;  1G82 A;  1NKH B;  2L5X A;  4KT7 A;  2FGF A;  3N0K A;  4ZFY B;  5C47 A;  3O44 A;  5CQP A;  3V8Z A;  5L6V A;  2OI6 A;  1AVU A;  4NAN A;  2KH2 A;  2ZQO A;  3I29 B;  1NZK A;  1J0S A;  4ZFW B;  1G2V A;  1JQZ A;  2APC A;  3Q7X A;  2JCK A;  1DZC A;  4HG6 A;  4JD0 A;  3V0A A;  2QH5 A;  4Y7T A;  5EG6 C;  1YP3 A;  3SNV A;  2E4M C;  2GZB A;  3PG0 A;  3D8V A;  4KNR A;  2OEG A;  3ZGF A;  3CU0 A;  1Z0H A;  2NYY A;  3I2X A;  4J2S A;  2FYB A;  2FYC B;  1BAS A;  2XWN A;  5CQN X;  4LO1 C;  3CQA A;  4Y62 A;  3BAU A;  1Z2V A;  5D91 A;  2P6W A;  2YES A;  4JAW A;  4I4Q A;  2JCL A;  2NS2 A;  1L2H A;  4B5B A;  4JRA A;  1WSZ A;  1JT3 A;  2GGO A;  4AYJ A;  3PUB A;  1GQ9 A;  5C1G A;  4EEO A;  1E5K A;  4I4Y A;  1BAR A;  2C0N A;  3R2W A;  3T7N A;  5BP5 A;  5F90 A;  2AFG A;  3OH3 A;  4L41 C;  2V0K A;  4D11 A;  1IRA X;  1BFC A;  1ISV A;  2QYI B;  4KBB A;  1LZ7 A;  4J23 B;  1TIE A;  3CA3 A;  1QGQ A;  3ILA A;  1KWS A;  1YP2 A;  3R3I A;  3GUE A;  4JP0 A;  2K8R A;  4GP3 A;  3IOH A;  1GGP B;  1TTU A;  2D24 A;  5BXC A;  2YQS A;  2D0J A;  4Q9P A;  1IIN A;  2ZU9 A;  3CA5 A;  1NF5 B;  4FRL A;  1ON8 A;  2W0V A;  3FJC A;  2RJ9 A;  4ASJ A;  1ISX A;  1PUM B;  5E24 E;  1ZDF A;  5F8Y A;  2YQC A;  3V0L A;  5CMI A;  4J2X A;  4G3S A;  3WIN A;  1V84 A;  4OEE A;  1G23 A;  4MZH A;  1K4V A;  4CJC A;  5IDT A;  1PUU B;  3A21 A;  4HJJ A;  4QBC A;  3ZX7 A;  3BRK X;  3H6R B;  4USP A;  1ONK B;  2WGZ A;  4H04 A;  1QWJ A;  2CU2 A;  4A7Y A;  4Y9X A;  3UJ0 A;  4ECM A;  2I1B A;  1JV1 A;  3E25 A;  4HO0 A;  3IOI A;  3SXA A;  3VEQ A;  1JV3 A;  3OAM A;  5IFY A;  2ZR1 B;  4I4U A;  2IWT B;  2ZU8 A;  4KEJ A;  3HL3 A;  1G9B A;  3AH2 A;  4EFP A;  4EKX B;  2LIE A;  2A8W A;  3CA1 A;  1HM0 A;  5C4F A;  3HBW A;  4B3U A;  4JQ0 A;  3O3P A;  4HO5 A;  3T7M A;  2A8U A;  2KI6 B;  1V82 A;  1R81 A;  2QGI A;  3I0K A;  4I4O A;  1KNM A;  2D22 A;  2VSE A;  1H4C A;  3U2X A;  1V6V A;  1DIW A;  1GQC A;  1TZF A;  1MP5 A;  3U0X A;  5IDS A;  1IHK A;  3CKV A;  2D7I A;  1BFG A;  4QBV A;  1FMZ A;  3OGG A;  4CJM A;  1VCL A;  3RTJ B;  1R7U A;  3VWC A;  2Z86 A;  1N4K A;  4I7I A;  2F2F C;  3USR A;  4ASY A;  3WO4 A;  4I37 A;  4ZBV B;  3H6R A;  3UD9 A;  1IIM A;  4D11 C;  2Y6P A;  5JMC A;  4P02 A;  4I1B A;  5DVH A;  3OGF A;  3IM7 A;  3QVB A;  1FO8 A;  4XFT A;  3O4C A;  1ZCT A;  3WMV A;  3BRG C;  1HKN A;  4KEK A;  1S0G A;  3FJ9 A;  2E3D A;  2J0B A;  1HV9 A;  5FV9 A;  1FR8 A;  1S0L A;  3LLP A;  1ISZ A;  2KKI A;  1FZW A;  1NWG B;  2VS3 A;  2X60 A;  5BXR A;  3FWW A;  4P6A A;  2BO8 A;  1DZD A;  3CU1 B;  2FFV A;  3HSM A;  1D0H A;  1RY7 A;  3WA1 A;  4A7Z A;  1S0B A;  2Z87 A;  3FOQ A;  4F83 A;  5EJZ A;  2FDB M;  2AES A;  4IRQ A;  3FGM A;  3AKI A;  1QG8 A;  1BLA A;  5F8S A;  1H7F A;  1LL2 A;  2YC5 A;  1V6X A;  3V8Y A;  3TC2 A;  4P0J A;  1LZ0 A;  4X3A A;  4LO1 A;  2WVM A;  1BFF A;  4FVV A;  4J2K A;  2QN4 A;  4I0Y A;  5BQU A;  2WVK A;  3R4S A;  5FTS A;  1R7X A;  5AJN A;  2RJ4 A;  3I0F A;  3ZGG A;  1R7Y A;  4OW4 A;  2XWL A;  3SX8 A;  3IAG C;  3V0Q A;  3HMY A;  4XFU A;  1FWV A;  2NP0 A;  5JLV A;  4GOY A;  1T4Q A;  1QGS A;  1H7G A;  1ZI5 A;  4B2X A;  3POL A;  1YP4 A;  3CGX A;  3SX3 A;  2AH9 A;  3HAL A;  1LVW A;  1NHE B;  3T7O A;  5EIY A;  4EE5 A;  3N9W A;  3PKQ A;  1VIC A;  3LTQ A;  4I4V A;  2AQZ A;  3Q7Y A;  4B4B A;  3SX5 A;  4LO0 C;  1R7T A;  1ILR 1;  1FV2 A;  3N7L A;  3BA4 A;  2K43 A;  3I0H A;  4FRQ A;  1PZT A;  5HS2 A;  5FZZ A;  3ZLL A;  1FV3 A;  2Y9F A;  3BAV A;  5FU8 A;  1S0E A;  4B4M A;  3EF2 A;  3MAL A;  3U0Y A;  2RIT A;  2D43 A;  3OH1 A;  2X2S A;  2Y9X E;  3F1Y A;  4G9M A;  4HO6 A;  4Y7V A;  5AJP A;  4QAL A;  1YYN A;  1IIL A;  4OWJ A;  2VK9 A;  2Y7A A;  4IZX A;  2XMH A;  1H3M A;  1S4O A;  1ZJ3 A;  2DRZ A;  2RJ5 A;  1VZT A;  3CKJ A;  4G3Q A;  3VUO A;  2OI7 A;  1M16 A;  3IOJ A;  4DEP A;  1G95 A;  2P72 A;  5DDV A;  3WO2 A;  1EPW A;  4IRP A;  1O23 B;  5L6S A;  4J18 A;  2MC2 A;  3V79 C;  5DDT A;  1F31 A;  3RMY A;  3F62 B;  4C2S A;  4FRE A;  2VU9 A;  1ZCV A;  4G1R A;  1CVS A;  2RQ9 A;  3A07 A;  2NM1 A;  2RJ8 A;  3A22 A;  5C3D A;  1VPA A;  3RMW A;  1HWN B;  1WT1 A;  2ZU7 A;  3SXG A;  1W77 A;  3MPP G;  5BQU C;  2X5S A;  4OUJ A;  5D62 A;  1ZI3 A;  2RJ0 A;  2BEA A;  3T8S A;  3EE5 A;  1RZO B;  3IIR A;  2F8X C;  2AM4 A;  1ISY A;  2VSA A;  4LO7 B;  2HW9 A;  2VSH A;  3ZXG A;  4KC2 A;  4QC4 A;  3Q4S A;  1HJL A;  4MZF B;  4D0Z A;  4KXO A;  1DQO A;  4LW6 A;  2XOA A;  2VFZ A;  2D20 A;  2F2F A;  4Y6N A;  5BXS A;  5DUY A;  4YS8 A;  3FUQ A;  2HZ9 A;  1IT0 A;  2ZQN A;  4XFS A;  5EJ1 A;  4L4H A;  3BRD A;  5DSS B;  1T9F A;  1PC8 B;  3RTI B;  2VXM A;  3I0C A;  4FRD A;  4NAK A;  3ZF8 A;  4I4R A;  31BI A;  1V83 A;  1ZCY A;  3F1C A;  4HO2 A;  1DQG A;  2IHO A;  2Y9W C;  2X65 A;  3V0O A;  3CA0 A;  3D98 A;  2P39 A;  3O4A A;  2I5E A;  4KPZ A;  1ZI4 A;  4KEI A;  1P63 A;  3V0M A;  2J3P A;  3D7W B;  1K5U A;  3QYD A;  3VT0 A;  4Q91 A;  1S4N A;  1EVT A;  2VXR A;  4GAI A;  4P00 A;  3BX1 C;  2Y4J A;  4DEC A;  1TFM B;  3AJ6 A;  1G9C A;  1AVA C;  2Q3N B;  2O1G A;  4I2S A;  3ZC8 A;  3N7J A;  1LZI A;  2KI4 A;  3Q80 A;  4F34 A;  1AVX B;  1H7Q A;  1HIB A;  1TW1 A;  2AM5 A;  4DE7 A;  2XWM A;  3AH4 A;  1BA7 A;  1YXW A;  7I1B A;  3S8J A;  2RJ1 A;  1SS9 A;  4B42 A;  4EE3 A;  4HOC A;  1DFQ A;  1H5S B;  1YTO A;  3AKF A;  2RG9 B;  1FXO A;  1O0R A;  2Y9G A;  4JKQ A;  3Q7W A;  4I4X A;  4HO4 A;  1JLY A;  5FZY A;  5BXP A;  1Z90 A;  2FYA A;  5CMF X;  1EZI A;  4FRP A;  3NGW A;  3OJM A;  2VXT I;  4KC3 A;  4END A;  3PHZ A;  1XZZ A;  4I6I A;  1H4E A;  1LL0 A;  2RIY A;  4QD2 B;  3KIA A;  4UEG A;  1HWO B;  1LZJ A;  4H9W A;  1H5T B;  4IHZ A;  4G6J A;  5G00 A;  3BAO A;  4LO0 A;  4ZA3 B;  1W3F A;  2VUA A;  1FO9 A;  2VS5 A;  2W0W A;  3V90 A;  3E26 A;  4GP0 A;  1MD6 A;  2KLL A;  2V0I A;  2MZB A;  2I7B A;  1HM9 A;  1G8O A;  3P6I A;  2DS0 A;  1AF9 A;  2RST A;  1H5R B;  1ZCU A;  4KC4 A;  1FWU A;  4BQH A;  5C49 A;  1V6U A;  1VGT A;  2D44 A;  2OEF A;  3D5N A;  1FR9 A;  3RSJ A;  2RIZ A;  1R82 A;  1II4 A;  1Q1U A;  2UX8 A;  1WD3 A;  1WT2 A;  2YQJ A;  3V91 A;  4XKI A;  5FYE A;  1Q04 A;  4ZGR B;  2Q4J A;  1GA8 A;  4ISR A;  1FMM S;  2NZ9 A;  5BVP I;  1GWW A;  2BO4 A;  2O1H A;  5C4B A;  2BFH A;  5CMH A;  3VSZ A;  1G0R A;  5FU0 A;  2WEE A;  2J0A A;  3USQ A;  5C38 A;  3I0J A;  4AN7 B;  2LIQ A;  1H5T A;  2WAW A;  2VS4 A;  4KQL A;  4LO7 C;  2V0J A;  2PGV A;  4M4K A;  5DZU A;  2AGD A;  2RJ6 A;  4M2B A;  4Y7F A;  3BA5 A;  2PA4 A;  3BAQ A;  3O4B A;  3VT2 A;  2VD4 A;  1H5R A;  3TZT A;  1V6W A;  41BI A;  1R7V A;  4AYL A;  1ITB A;  4HA2 A;  4LO3 C;  1JVG A;  5CQO A;  2NTD A;  1JYK A;  3OJV A;  1RG8 A;  3BCV A;  4R6U B;  4MIX A;  5C4D A;  5FUH A;  4P0L A;  3UD7 A;  4I4P A;  5FNX A;  4EB2 B;  2GGQ A;  4FCE A;  2ERM A;  3AZW A;  3JUJ A;  1EYL A;  1ON6 A;  2OI5 A;  4FIY A;  2D7R A;  4JIS A;  3I0L A;  1NUN A;  1O7O A;  4FCU A;  4FRA A;  1FQ9 A;  2X5Z A;  4B4G A;  1TWM A;  5HPZ A;  3Q7U A;  3RMV A;  1YBI A;  1MP3 A;  2R9K B;  4NAL A;  4IYB A;  4USO A;  2O1F A;  1SZ6 B;  4OEF A;  2DPW A;  3JUK A;  1HJJ A;  1O7Q A;  4EEG A;  1G9R A;  3JRR A;  3U2V A;  4ZKT B;  1S0D A;  4IZE A;  2Y4M A;  4KPX A;  8I1B A;  1A8D A;  3OH0 A;  2Z48 A;  4J2Y A;  3I0G A;  2YCM A;  4MYB A;  4EFR A;  2GO2 A;  1TVY A;  1VGZ A;  4M2A A;  3VSF A;  3AH1 A;  1H5S C;  5F8W A;  1AXM A;  4XWI A;  4CVH A;  3AZV A;  5I1F A;  3H6S E;  1W57 A;  4FIX A;  1BLD A;  1GWV A;  3P6J A;  1R8O A;  1TWE A;  2E8B A;  2V0H A;  4FRM A;  4KNX A;  4KRV A;  5CQM X;  2M49 A;  3B9U A;  4ISQ A;  1HWP B;  5C48 A;  4DCK C;  4AN6 A;  3KMV A;  4EEM A;  1XZ6 A;  4QD2 C;  5GAQ A;  3IM5 A;  4G6M A;  3HOM A;  3I0I X;  4G3P A;  3BAD A;  2XME A;  1OQM B;  3BB2 A;  1SR4 C;  4GAF A;  4QKR A;  4WBC A;  5CMG X;  4Y6U A;  4TLP A;  4NAI A;  3JTJ A;  4I4S A;  1FRW A;  1ZDG A;  2ET2 A;  1GX4 A;  1ZJ0 A;  1ZJP A;  1CE7 B;  4Y7U A;  1PWA A;  1UPS A;  4D48 A;  4X37 A;  1IJT A;  1Z4S A;  1FG5 N;  2AE7 A;  4M28 A;  21BI A;  4B2W A;  1WT0 A;  4HO8 A;  4CJB A;  3FJH A;  4D0T A;  3PNN A;  2K4A B;  3OBR A;  4LO2 A;  3AKH A;  4FRO A;  4Y64 A;  4MND A;  3P53 A;  2Z49 A;  3NBN A;  4EFQ A;  1XYF A;  4PC4 A;  3O4D A;  1OMX A;  3U2T A;  1W3G A;  2MIB A;  5FNW A;  5AJO A;  4JPZ A;  1M2T B;  3O49 A;  3K8D A;  1OMZ A;  1JT4 A;  1VZU A;  3PME A;  3LW6 A;  5JQQ A;  3BTA A;  3RSB A;  5BOW A;  2JCO A;  1MC3 A;  1XG6 A;  1MC9 A;  1I1E A;  4P0K A;  3V0B B;  1FN0 A;  3AKG A;  3I0E A;  5J49 A;  3NBD A;  2RIX A;  1K5V A;  4G9N A;  1R8N A;  3K1X A;  5B2H A;  4MZG B;  1H7L A;  1RML A;  3DUV A;  3H6Q A;  1FWY A;  3OBT A;  3FJK A;  3WMU A;  3RMX A;  3CA4 A;  4ION A;  4BMA A;  5C3B A;  2HWA A;  3FJA A;  2AM3 A;  3DJ4 A;  5CQL X;  1DFC A;  1TOO A;  3AJ5 A;  3I2A A;  4HO3 A;  1ZJO A;  3VT1 A;  2AAI B;  5D92 A;  4KC1 A;  1G93 A;  4Q9G A;  1ZI1 A;  2BO6 A;  2I5K A;  1DLL A;  4LO3 A;  5I1B A;  4AC3 A;  1WT3 A;  4AAW A;  3NBE A;  5C1L A;  3FJE A;  1QXM A;  4K6R A;  3HN1 A;  4I1E A;  4EVW A;  3O4O A;  3K8E A;  4FGF A;  4DEN A;  3FJD A;  3R4U A;  4CJ8 A;  3FJJ A;  1WBA A;  2Y4K A;  3V0B A;  4ZDQ A;  4E1K A;  4GBP A;  4QKS A;  3S8K A;  1H7H A;  3F1R A;  1QQL A;  4A7K A;  1FOA A;  1H4D A;  3BAG A;  1JVD A;  2P23 A;  4Y63 A;  2DRE A;  3PKP A;  2FY7 A;  4LO2 C;  1W3A A;  2NVH A;  5EHA A;  1E0O A;  1NQI B;  1H5S D;  1ZJ1 A;  1EV2 A;  6I1B A;  1I52 A;  1R80 A;  5FTV A;  3FJ8 A;  2YC3 A;  1YF8 B;  2VLC A;  3BRF A;  1FGA A;  1W55 A;  5C36 A;  2BEB A;  2D1Z A;  1EYR A;  3SX7 A;  1LL3 A;  4GOV A;  1TP0 A;  1VM8 A;  1JY0 A;  4G87 A;  3UDA A;  3CRI A;  1H5S A;  3FUO A;  2DRY A;  3U2W A;  4IQP A;  1S0C A;  5D63 A;  1Q03 A;  5EC5 A;  4EEE B;  1FGX A;  1JT7 A;  2D23 A;  2YUG A;  4IY9 A;  1G1L A;  1TW5 A;  3ZXD A;  2RJ7 A;  3OC9 A;  4Q7C A;  1G9A A;  5C1H A;  3W9T A;  1JLX A;  1YRO B;  3CRG A;  2FFU A;  3CKO A;  4OEG A;  1ZHJ A;  1GX0 A;  3I0D A;  2AXM A;  1ZIZ A;  2WBC A;  2V0L A;  4Z8S B;  2FYD B;  4HR6 C;  3UJ4 A;  1WVC A;  1SR4 A;  2YQH A;  1G3L A;  3SPT A;  4HO9 A;  4EEA A;  4UY4 A;  5BP5 C;  4EE4 A;  4HCQ A;  2PX7 A;  4L4I A;  4DDZ A;  2AEC A;  3CKQ A;  1INJ A;  3V0N A;  3CRH A;  1H7T A;  4II0 A;  1VGW A;  9ILB A;  3IM6 A;  3A23 A;  4OWK A;  2WE9 A;  3O5W B;  1I1B A;  5D61 A;  2WVL A;  3V0P A;  1HWM B;  4ZOT A;  1AVW B;  1VH1 A;  4Y7G A;  4X38 A;  3ZLK A;  5C4C A;  1AFC A;  3QR5 A;  2ICY A;  1S4P A;  3N7K A;  4FRB A;  3N7M A;  2FO1 A;  1HCD A;  1H7E A;  3SXE A;  3OJ2 A;  1JTC A;  3BAH A;  1OQL B;  4FQW A;  2E4M A;  4ARW A;  3DK5 A;  3WIN C;  3E8L C;  3BA7 A;  1XHB A;  4IY8 A;  3OH2 A;  4LW3 A;  2BO7 A;  2ICX A;  1PZZ A;  4JKX B;  4D8H A;  1VZX A;  3U2U A;  1JT5 A;  1NMM B;  3FFZ A;  3OH4 A;  4OWL A;  3SXB A;  1FXJ A;  1IRP A;  3FJB A;  1ABR B;  2UUS A;  2Q9X A;  1IOB A;  1WD4 A;  5BXT A;  1VH3 A;  2Y4L A;  3POK A;  1PZY B;  3OKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...