2FFVA

Human ppgalnact-2 complexed with manganese and udp
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
499
structure length
489
Chain Sequence
DALKVRWPDFNQEAYVGGPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polypeptide N-acetylgalactosaminyltransferase 2
publication title Dynamic Association between the Catalytic and Lectin Domains of Human UDP-GalNAc:Polypeptide {alpha}-N-Acetylgalactosaminyltransferase-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 158
structure length 489
sequence length 499
chains with identical sequence B
ec nomenclature ec 2.4.1.41: Polypeptide N-acetylgalactosaminyltransferase.
pdb deposition date 2005-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2ffvA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2ffvA01
4A7YA 4HA2A 4I7IA 4HOCA 2AM5A 4I4QA 3OH0A 3TZTA 4USPA 1TVYA 5EC5A 1M2TB 3HMYA 3CU0A 1QWJA 2MIBA 3VUOA 1EYRA 2W0VA 3UJ0A 2Y6PA 2ZQOA 3A22A 3BAUA 3WMUA 3I0LA 5CQOA 2VSEA 1JTCA 4EEOA 3BRDA 2E4MC 1FXOA 3V90A 2YESA 2Y9WC 1G9BA 1Z4SA 4CJMA 1VZXA 1TFMB 4J2KA 4JP0A 4OW4A 1H7TA 2X2SA 3POLA 4Y7GA 5BVPI 4NAIA 2FO1A 1DZDA 1IHKA 3I0HA 2VXRA 2RG9B 2DPWA 2ICYA 2V0IA 4JQ0A 1ISWA 4DENA 2VSHA 1YF8B 2NVHA 1XHBA 1AVWB 4K6RA 3HN1A 1G9RA 5CMJA 1FR8A 1W3AA 1AVUA 1S0BA 3LTQA 3N7LA 1OMZA 1HIBA 2D20A 3DUVA 3OKRA 2AM4A 1FQ9A 2FFUA 2OI7A 21BIA 5D62A 1FGAA 2ET2A 4GAFA 3I0FA 1F31A 1XZ6A 3O3PA 2WVLA 1OQLB 1H7GA 4J18A 1FMMS 1WT1A 4EE4A 1K5VA 1G0RA 1TIEA 3N9WA 3ZF8A 2MLLB 3ZLKA 3UD7A 5BQUC 4LW3A 1AVXB 1W57A 2F2FC 1ZDFA 4HR6C 1ILR1 3V0QA 4ZFYB 4C2SA 5C48A 2IHOA 1G9CA 1FV2A 1YP4A 2BO7A 1PUMB 3OJVA 3USQA 3O4DA 5FNXA 1R82A 1FG5N 2HW9A 2NZ9A 2GO2A 4I96A 2JCJA 3FGMA 5BXCA 4LO1C 2BO6A 3VT2A 1S0CA 3SPTA 1WSZA 5AJPA 3Q7YA 4E1KA 4LO2C 4G87A 1JT5A 3CA4A 1JT7A 1ON8A 1HM9A 2PA4A 2Z87A 3JUKA 2BEBA 2OI5A 1H7EA 1VCLA 1T9FA 3FJFA 3IAGC 4LO3A 1FO8A 1LZIA 4DCKC 4QBCA 5EIYA 1Z0HA 3NJ5A 4X38A 4ISQA 1R80A 3DK5A 4B42A 2KH2A 3Q4SA 4FRQA 4JRAA 2HWAA 2Y9FA 2YCMA 4DEPA 2WBCA 3S8KA 1ZJPA 4Y62A 3FOQA 3V0PA 5CMGX 2PGYA 3NBDA 3FJCA 2O1FA 3K8EA 3VT0A 2CU2A 5CQMX 2FYBA 4LO0C 4HO0A 2ZU7A 3QYDA 1ONKB 5I1FA 4G9MA 4ZLBB 4R7PA 4ZFWB 1IINA 5C1GA 4EB2B 4OWJA 3N0KA 1FO9A 5BXRA 2E4MA 1V82A 1FWYA 2AE7A 1IT0A 4D48A 5FV9A 4IYBA 1FRWA 1LL3A 4DDZA 2HZ9A 1FXJA 2XWLA 1XZZA 4JKQA 1YTOA 1INIA 4HO8A 3V0AB 1D0HA 5F8WA 2RJ4A 1LZ0A 3P53A 2BEAA 1Z2VA 4GOYA 3SXAA 1ISVA 1HWNB 1JVGA 1KNMA 3ZC8A 1DQOA 2DS0A 3FJHA 1PC8B 1PZZA 1G1LA 2V0HA 1H3MA 4EEMA 4MYBA 4QC4A 4QBVA 4KRVA 4HG6A 4B2XA 4EVWA 2VU9A 4ZDQA 2L5XA 1QGQA 1ZCVA 3FJIA 5C38A 4Z8SB 1HJLA 1HCEA 4B5BA 1DFQA 1SS9A 1ZCUA 4H9WA 1H7FA 2VXMA 1DZCA 5BQUA 3AH1A 5F8SA 1R7TA 1ZJ1A 2F2FA 2FY7A 2Y4LA 5FUHA 4AYLA 1AXMA 1BFGA 1QQLA 2AGDA 4FRBA 3U2VA 1RZOB 1H5TB 1JVDA 4X3AA 5C4EA 1ZJ2A 5BP5A 3SX5A 4I8MA 2MC2A 1S4OA 31BIA 4JPZA 1W77A 2Q4JA 1K4VA 4I3NA 2WVMA 1MP4A 4OEFA 3FJDA 4G3QA 4LO1A 3PHZA 4D0TA 3QVBA 3CKJA 3V79C 3IIRA 2X65A 1DLLA 2YQCA 5C36A 1WD3A 4ZBVB 3CKQA 1RMLA 5EG6C 3WINA 1G2VA 1G97A 3NBEA 4I37A 4JD0A 2A8WA 3FJ8A 1RY7A 4YS8A 1VH1A 1IJTA 3FFZA 3IM5A 4P6AA 2RIYA 2RJ7A 4ASJA 1JYKA 3H6RB 3FWWA 1VGZA 3IM7A 4M2BA 2YQHA 2J3PA 4KNXA 1AF9A 4G9NA 2V0LA 3CQAA 1JV3A 1E5KA 3O44A 2D23A 4OEEA 4KC4A 4B4GA 4Y63A 3T7OA 4FVVA 5D63A 1DJSB 1S0DA 4LO0A 2JCKA 4FRLA 3FJBA 3D8VA 3SXBA 5L6SA 3SNVA 4PC4A 5DUYA 1H4DA 4ARWA 1VPAA 3U2XA 1Q1UA 2APCA 1H5TA 4HCQA 5JQQA 1BASA 2RJ9A 2BO4A 4QO3A 2NXVA 2XWMA 2Q3NB 1IRPA 3R4UA 1W55A 4IZXA 2X2TA 3N7MA 1ZCYA 1BFCA 3BADA 2F8XC 1VGTA 2KKIA 3CU1B 4HO9A 1R8NA 1H5RA 5C4DA 3VWCA 1WT2A 1CE7B 5FTVA 3RSBA 5DDTA 4I4OA 1GA8A 5BOWA 3HBWA 2E3DA 1JY0A 4CJ8A 3V8YA 3B9UA 4ZKTB 1H4EA 1V6XA 2VLCA 5CMFX 3HOMA 9ILBA 5CQPA 1ZDGA 5CQNX 1O7QA 5FU8A 5DSSB 3H6RA 5AJNA 3RMVA 3ZXGA 2AECA 3TC2A 2A8UA 3HSMA 5HPZA 3QR5A 3WO3A 2WRYA 3CGXA 3PKPA 2WGZA 4EEGA 1N4KA 5BP5C 3I0DA 3POKA 3SXCA 3V0OA 3O3QA 1WD4A 3W9TA 3GUEA 3F1RA 1I1EA 4ZGRB 3ZGFA 1VGWA 1ZJOA 1S4PA 2ERMA 4FRDA 1O7OA 5EJ1A 3A21A 4Y7VA 3N7KA 2MZBA 3O5WB 1HM8A 4ZOTA 3OH1A 4JISA 3H6QA 2FYDB 1DFCA 4J23B 1GWWA 3CRHA 2WVKA 1HCDA 1ISXA 3P6IA 3BA5A 3WINC 4P0JA 1NHEB 2RIZA 4AC3A 2PX7A 2VS4A 2O1GA 4II0A 3Q80A 1JLYA 3CA0A 4CJBA 4AN7B 5IDSA 1ZJ3A 3I0GA 1VZUA 1QXMA 2R9KB 3AKGA 1DQGA 4G3SA 1LZ7A 4J2SA 5JMCA 4I0YA 2AH9A 1WT0A 2P73A 2X5SA 2UX8A 3D5NA 4BQHA 2Y4KA 4A7KA 5C1LA 4Y7TA 2X60A 1PWAA 2KLLA 4EKXB 4QKSA 4ENDA 1QGSA 4FCUA 4KNRA 4AYJA 2JCLA 3Q7WA 4G6JA 4ECMA 3HL3A 1HJJA 1O0RA 2K4AB 2D43A 4D11A 4CVHA 4YOLA 3U2UA 5EHAA 3FJEA 4LW6A 1HKNA 8I1BA 3SXEA 1G23A 1HWMB 4I4XA 1AVAC 1IRAX 4I4PA 2RITA 4M2AA 3RMXA 5C3AA 1EZIA 3RMYA 1G82A 4Y6UA 1L2HA 3OJ2A 4IQPA 4FGFA 2GGOA 1H7QA 1ABRB 1WT3A 2YQSA 4B4MA 5J49A 5C8RA 2PGVA 4IY8A 4EFQA 5F90A 1E0OA 3CA6A 4QALA 2NYYA 1R81A 3ZLLA 1SR4C 5HS2A 1V6VA 1PZTA 3F1YA 2Y7AA 4FRHA 4HO4A 4MNDA 4XWIA 1P63A 1VM8A 4Y64A 5AJOA 5C4BA 1G9AA 1BA7A 3BAGA 1A8DA 3S8JA 5C47A 1OQMB 4KT7A 3ST8A 5JLVA 2YQJA 1JYLA 1EPWA 4Z9WB 1H7LA 3NBNA 4FREA 1NQIB 2RJ5A 1ISZA 4KPXA 1SZ6B 3USRA 3U0XA 2NTDA 2P6WA 3A07A 3MPPG 1H5SD 3R2WA 3O49A 2DRYA 3BA7A 1LL2A 1O23B 4M4KA 2RJ6A 1R7UA 1S4NA 3OJMA 2AQZA 5C1HA 4IONA 3WMVA 2DREA 3IOIA 2XMHA 4P02A 3SX3A 2VXTI 3FJ9A 3O4OA 1FZWA 4FRAA 2K43A 4IRPA 3UJ4A 1FWVA 5G00A 5GAQA 5FTSA 1EVTA 3V0LA 3BX1C 1NWGB 1S0FA 2D22A 3CA3A 2Y9XE 2YUGA 2BO8A 2WAWA 3OGGA 1V84A 3OH3A 3PNNA 2K8RA 2UUSA 4I4YA 4IZEA 1H5RB 2VD4A 4EEAA 3VT1A 3V0BA 3IOHA 2FGFA 1TWMA 2P39A 2NP0A 1PUUB 3AKHA 2YC3A 4NALA 2ZQNA 3SX7A 1HM0A 1ZJ0A 3UD9A 3OH2A 4XKIA 5DZUA 1JLXA 3AZWA 3T7MA 3SX8A 2Z86A 2ZU9A 5CQLX 4G6MA 3WO2A 3E25A 2VSIA 3R3IA 4D11C 1S0LA 4GP0A 4IRQA 3U2TA 3UDAA 3R4SA 3O4BA 4D0ZA 1G3LA 2WE9A 4L4HA 3AKFA 1NMMB 1MC3A 1YP3A 1BFBA 3BAVA 4X39A 3CKVA 3E26A 4KC2A 1Z90A 3I0EA 3BCVA 4XFTA 3BAOA 2ICXA 3JUJA 3RSJA 1V6WA 1FGXA 1FOAA 4Y7UA 1JQZA 3VSFA 4EE5A 1XYFA 2V0KA 3D98A 1CVSA 3RTJB 1GX4A 4P0LA 2AXMA 1BARA 2D7RA 2QYIB 3K8DA 4HO3A 1VZTA 6I1BA 1H4CA 2KI4A 1ON6A 1H5SA 5FZUA 2P23A 1ZI5A 5DVHA 4H04A 1TZFA 4GBPA 2RIXA 4KEJA 4EFRA 5B2HA 3ZXDA 1XG6A 3KIAA 1SR4A 3NBCA 4LO8B 5C49A 3OC9A 2QN4A 5CMIA 3E8LC 2I5KA 4J2XA 2Q9XA 1FV3A 4KBBA 2Y4MA 1FR9A 1TW1A 4R6UB 3CKNA 4KC1A 4I4VA 1LZJA 1ITBA 4F34A 2OI6A 3BAHA 4HO5A 3CKOA 1NUNA 4XFSA 2FYCB 4AAWA 2E8BA 3I0CA 3FUQA 1TP0A 1H7HA 1II4A 1TOOA 3V0MA 5BXSA 3V91A 4Y7FA 1MC9A 1QG8A 3Q7XA 4J2YA 2RJ0A 2YC5A 4NANA 4UEGA 3V8ZA 5C4FA 2VXLA 4QD2C 1G93A 4FROA 4I2SA 4I6IA 2Z48A 2VSAA 3O4CA 3OBRA 3WO4A 3ZC9A 3ZGGA 1G8OA 1NKHB 3BRGC 2OEFA 1Q03A 4B2WA 41BIA 1GX0A 4Y9XA 4IY9A 1ISYA 2GGQA 1JV1A 1V83A 3HALA 4ISRA 2AM3A 4Y6NA 5C3BA 1FMZA 3VSZA 4D8HA 1IILA 4B4BA 4OWLA 5FU0A 4EFPA 4FCEA 4NAKA 1FGGA 4CJCA 1DIWA 2I5EA 3SXGA 3UD8A 3VEQA 1ZI3A 4HO6A 2QKXA 2D0JA 2I7BA 2AAIB 4P0KA 2V0JA 5EJZA 4HJJA 3LW6A 1TW5A 5FZZA 3NGWA 4OEGA 3CA5A 1VGUA 1ZIZA 4FQWA 1M16A 1JT3A 3LLPA 1YROB 2P72A 2Y9GA 1ZHJA 1RG8A 2D7IA 3AKIA 1W3FA 1YP2A 4ASYA 1BLAA 2NM1A 3IM6A 2AFGA 2JCOA 5FNWA 3D7WB 3OGZA 5CMHA 1INJA 1YBIA 5IDTA 1IIMA 4QD2B 3ILAA 4F83A 2RSTA 1J0SA 4X37A 1VICA 1NZKA 2D24A 1FN0A 3BTAA 4GOVA 4M28A 4LO7C 1G9DA 4L41C 2DRZA 1K5UA 5D61A 1QQKA 2LIEA 3OGFA 3T8SA 4KEIA 2XWNA 2ZU8A 3I0JA 2I1BA 3K1XA 3WA1A 4AN6A 3V0BB 1H5SC 4OUJA 3FJKA 3I0IX 4DECA 4OWKA 1IOBA 3P6JA 5I1BA 3U2WA 4KXOA 1EV2A 2M49A 1I1BA 1S0EA 4G1RA 1PZYB 1LL0A 2RJ8A 4KQLA 4DE7A 4KPZA 2FYAA 1WBAA 2IWTB 2FDBM 4EE3A 1WVCA 2VUAA 3DJ4A 3BB2A 1GGPB 3EE5A 1G95A 2O1HA 3IOJA 1MP5A 5FYEA 3T7NA 3FUOA 7I1BA 1NF5B 2ESUA 3CRIA 3JUTA 1R7YA 3JTJA 1GWVA 1MD6A 3Q7UA 3OAMA 3U0YA 5IFYA 4WBCA 1HWPB 4A7ZA 1KWSA 2GZBA 4XFUA 1TWEA 3PMEA 1TTUA 3F1CA 3OH4A 3C9ZA 3MALA 2KI6B 3SXDA 5L6VA 4TLPA 1T4QA 4ZA3B 4JKXB 4FRMA 2ZR1B 4Q9PA 1ZI1A 4L4IA 3OBTA 3PUBA 4IHZA 4LO7B 3AZVA 3FJAA 3I29B 3I0KA 3AH2A 4ZFUB 1W3GA 3BRKX 3KMVA 2OEGA 4KC3A 1JT4A 2LIQA 1H5SB 4I4SA 5FZYA 1V6UA 3A23A 4I1BA 5BXTA 2QH5A 4P00A 3O4AA 1FWUA 4KEKA 4Q9GA 2W0WA 4BMAA 3BRFA 4I1EA 4Q91A 4QKRA 3JRRA 3TQDA 5E24E 1AFCA 2D1ZA 4EEEB 4I4RA 1OMXA 2FFVA 2RJ1A 2VS5A 4G3PA 1R7XA 1R7VA 1GQ9A 2Z49A 2VFZA 2HWMA 1YYNA 3I2AA 3F62B 2WEEA 1HV9A 1I52A 1YXWA 3FJJA 1Q04A 3CRGA 4GAIA 2RQ9A 3ZX7A 3I2XA 5BXPA 4JAWA 4USOA 1VH3A 4B3UA 5C3DA 1LVWA 1HWOB 1S0GA 3EF2A 3AJ5A 4FRPA 4HO2A 3PG0A 4I4UA 4LO3C 3V0AA 2BFHA 4LO2A 1MP3A 2VS3A 3H6SE 2Y4JA 3V0NA 3BA4A 3PKQA 1GQCA 5F8YA 2X5ZA 5C4CA 3AH4A 1WBCA 3RTIB 2AESA 3RMWA 2D44A 1EYLA 1R8OA 2XOAA 4GP3A 1ZI4A 2QGIA 2XMEA 1UPSA 1BLDA 3AJ6A 3BAQA 1BFFA 3N7JA 3CAHA 5DDVA 3CA1A 1ZCTA
chains in the Genus database with same CATH superfamily
4A7YA 4HA2A 4I7IA 4HOCA 2AM5A 4I4QA 3OH0A 3TZTA 4USPA 1TVYA 5EC5A 1M2TB 3HMYA 3CU0A 1QWJA 2MIBA 3VUOA 1EYRA 2W0VA 3UJ0A 2Y6PA 2ZQOA 3A22A 3BAUA 3WMUA 3I0LA 5CQOA 2VSEA 1JTCA 4EEOA 3BRDA 2E4MC 1FXOA 3V90A 2YESA 2Y9WC 1G9BA 1Z4SA 4CJMA 1VZXA 1TFMB 4J2KA 4JP0A 4OW4A 1H7TA 4H75A 2X2SA 3POLA 4Y7GA 5BVPI 4NAIA 2FO1A 1DZDA 1IHKA 3I0HA 2VXRA 2RG9B 2DPWA 2ICYA 2V0IA 4JQ0A 1ISWA 4DENA 2VSHA 1YF8B 2NVHA 1XHBA 1AVWB 4K6RA 3HN1A 1G9RA 5CMJA 1FR8A 1W3AA 1AVUA 1S0BA 3LTQA 3N7LA 1OMZA 1HIBA 2D20A 2J0AA 3DUVA 2AM4A 1FQ9A 2FFUA 2OI7A 21BIA 5D62A 1FGAA 2ET2A 4GAFA 3I0FA 1F31A 1XZ6A 3O3PA 2WVLA 1OQLB 1H7GA 4J18A 1FMMS 1WT1A 4EE4A 1K5VA 1G0RA 1TIEA 3N9WA 3ZF8A 2MLLB 3ZLKA 3UD7A 5BQUC 4LW3A 1AVXB 1W57A 2F2FC 1ZDFA 4HR6C 1ILR1 3V0QA 4ZFYB 4C2SA 5C48A 2IHOA 1G9CA 1FV2A 1YP4A 2BO7A 1PUMB 3OJVA 3USQA 3O4DA 5FNXA 1R82A 1FG5N 2HW9A 2NZ9A 2GO2A 4I96A 2JCJA 3FGMA 5BXCA 4LO1C 2BO6A 3VT2A 1S0CA 3SPTA 1WSZA 5AJPA 3Q7YA 4E1KA 4LO2C 4G87A 1JT5A 3CA4A 1JT7A 1ON8A 1HM9A 2PA4A 2Z87A 3JUKA 2BEBA 2OI5A 1H7EA 1VCLA 1T9FA 3FJFA 3IAGC 4LO3A 1FO8A 1LZIA 4DCKC 4QBCA 5EIYA 1Z0HA 3NJ5A 4X38A 4ISQA 2C0NA 1R80A 3DK5A 4B42A 2KH2A 3Q4SA 4FRQA 4JRAA 2HWAA 2Y9FA 2YCMA 4DEPA 2WBCA 3S8KA 1ZJPA 4Y62A 3FOQA 3V0PA 5CMGX 2PGYA 3NBDA 3FJCA 2O1FA 3K8EA 3VT0A 2CU2A 5CQMX 2FYBA 4LO0C 4HO0A 2ZU7A 3QYDA 1ONKB 5I1FA 4G9MA 4ZLBB 4R7PA 4ZFWB 1IINA 5C1GA 4EB2B 4OWJA 3N0KA 1FO9A 5BXRA 2E4MA 1V82A 1FWYA 2AE7A 1IT0A 4D48A 5FV9A 4IYBA 1FRWA 1LL3A 4FIYA 4DDZA 2HZ9A 1FXJA 2XWLA 1XZZA 4JKQA 1YTOA 1INIA 4HO8A 3V0AB 1D0HA 5F8WA 2RJ4A 1LZ0A 3P53A 2BEAA 1Z2VA 4GOYA 3SXAA 1ISVA 1HWNB 1JVGA 1KNMA 3ZC8A 1DQOA 2DS0A 3FJHA 1PC8B 1PZZA 1G1LA 2V0HA 1H3MA 4EEMA 4MYBA 4QC4A 4QBVA 4KRVA 4HG6A 4B2XA 4EVWA 2VU9A 4ZDQA 2L5XA 1QGQA 1ZCVA 3FJIA 5C38A 4Z8SB 1HJLA 1HCEA 4B5BA 1DFQA 1SS9A 1ZCUA 4H9WA 1H7FA 2VXMA 1DZCA 5BQUA 3AH1A 5F8SA 1R7TA 1ZJ1A 2F2FA 2FY7A 2Y4LA 5FUHA 4AYLA 1AXMA 1BFGA 1QQLA 2AGDA 4FRBA 3U2VA 1RZOB 1H5TB 1JVDA 4X3AA 5C4EA 1ZJ2A 5BP5A 3SX5A 4I8MA 2MC2A 1S4OA 31BIA 4JPZA 1W77A 2Q4JA 1K4VA 4I3NA 2WVMA 1MP4A 4OEFA 3FJDA 4G3QA 4LO1A 3PHZA 4D0TA 3QVBA 3CKJA 3V79C 3IIRA 2X65A 1DLLA 2YQCA 5C36A 1WD3A 4ZBVB 3CKQA 1RMLA 5EG6C 3WINA 1G2VA 1G97A 3NBEA 4I37A 4JD0A 2NS2A 3FJ8A 1RY7A 2A8WA 1VH1A 1IJTA 3FFZA 4YS8A 3IM5A 4P6AA 2RIYA 2RJ7A 4ASJA 1JYKA 3H6RB 3FWWA 1VGZA 3IM7A 4M2BA 2YQHA 2J3PA 4KNXA 1AF9A 4G9NA 2V0LA 3CQAA 1JV3A 1E5KA 3O44A 2D23A 5L6VA 4OEEA 4KC4A 4B4GA 4Y63A 3T7OA 4FVVA 5D63A 1DJSB 1S0DA 4LO0A 2JCKA 4FRLA 3FJBA 3D8VA 3SXBA 5L6SA 3SNVA 4PC4A 5DUYA 1H4DA 4ARWA 1VPAA 3U2XA 1Q1UA 2APCA 1H5TA 4HCQA 5JQQA 1BASA 2RJ9A 2BO4A 4QO3A 2NXVA 5D91A 2XWMA 2Q3NB 1IRPA 3R4UA 1W55A 4IZXA 2X2TA 3N7MA 1ZCYA 1BFCA 3BADA 2F8XC 1VGTA 2KKIA 3CU1B 4HO9A 1R8NA 1H5RA 5C4DA 3VWCA 1WT2A 1CE7B 5FTVA 3RSBA 5DDTA 4I4OA 1GA8A 5BOWA 4Q7CA 3HBWA 2E3DA 1JY0A 4CJ8A 3V8YA 3B9UA 4ZKTB 1H4EA 1V6XA 2VLCA 5CMFX 3HOMA 9ILBA 5CQPA 1ZDGA 5CQNX 1O7QA 5FU8A 5DSSB 3H6RA 5AJNA 3RMVA 3ZXGA 2AECA 3TC2A 2A8UA 3HSMA 5HPZA 3QR5A 3WO3A 2WRYA 3CGXA 3PKPA 2WGZA 4EEGA 1N4KA 5BP5C 3I0DA 3POKA 3SXCA 3V0OA 3O3QA 1WD4A 3W9TA 3GUEA 3F1RA 1I1EA 4ZGRB 3ZGFA 1VGWA 1ZJOA 1S4PA 2ERMA 4FRDA 1O7OA 5EJ1A 3A21A 4Y7VA 3N7KA 2MZBA 3O5WB 1HM8A 4ZOTA 3OH1A 4JISA 3H6QA 2FYDB 1DFCA 4J23B 1GWWA 3CRHA 2WVKA 1HCDA 1ISXA 3P6IA 3BA5A 3WINC 4P0JA 1NHEB 2RIZA 4AC3A 2PX7A 2VS4A 2O1GA 4II0A 3Q80A 1JLYA 4MZGB 3CA0A 4CJBA 4AN7B 5IDSA 1ZJ3A 3I0GA 1VZUA 1QXMA 2R9KB 3AKGA 1DQGA 4G3SA 1LZ7A 4J2SA 5JMCA 4I0YA 2AH9A 1WT0A 2P73A 2X5SA 2UX8A 3D5NA 4BQHA 2Y4KA 4A7KA 5C1LA 4Y7TA 2X60A 1PWAA 2KLLA 4EKXB 4QKSA 4ENDA 1QGSA 4FCUA 4KNRA 4AYJA 2JCLA 3Q7WA 4G6JA 4ECMA 3HL3A 1HJJA 1O0RA 2K4AB 2D43A 4D11A 4CVHA 4YOLA 3U2UA 5EHAA 3FJEA 4LW6A 1HKNA 8I1BA 3SXEA 1G23A 1HWMB 4I4XA 1AVAC 1IRAX 4I4PA 2RITA 4M2AA 3RMXA 5C3AA 1EZIA 3RMYA 1G82A 4Y6UA 1L2HA 3OJ2A 4IQPA 4FGFA 2GGOA 1H7QA 1ABRB 1WT3A 2YQSA 4B4MA 5J49A 5C8RA 2PGVA 4IY8A 4EFQA 5F90A 1E0OA 3CA6A 4QALA 2NYYA 1R81A 3ZLLA 1SR4C 5HS2A 1V6VA 1PZTA 3F1YA 2Y7AA 4FRHA 4HO4A 4MNDA 4XWIA 1P63A 1VM8A 4Y64A 5AJOA 5C4BA 1G9AA 1BA7A 3BAGA 1A8DA 3S8JA 5C47A 1OQMB 4KT7A 3ST8A 5JLVA 2YQJA 1JYLA 1EPWA 4Z9WB 1H7LA 3NBNA 4FREA 1NQIB 2RJ5A 1ISZA 4KPXA 1SZ6B 3USRA 3U0XA 2NTDA 2P6WA 3A07A 3MPPG 1H5SD 3R2WA 3O49A 2DRYA 3BA7A 1LL2A 1O23B 4M4KA 2RJ6A 1R7UA 1S4NA 3OJMA 2AQZA 5C1HA 4IONA 3WMVA 2DREA 3IOIA 2XMHA 4P02A 3SX3A 2VXTI 3FJ9A 3O4OA 1FZWA 4FRAA 2K43A 4IRPA 3UJ4A 1FWVA 5G00A 5GAQA 5FTSA 1EVTA 3V0LA 3BX1C 1NWGB 1S0FA 2D22A 3CA3A 2Y9XE 2YUGA 2BO8A 2WAWA 3OGGA 1V84A 3OH3A 3PNNA 2K8RA 2UUSA 4I4YA 4IZEA 1H5RB 2VD4A 4EEAA 3VT1A 3V0BA 3IOHA 2FGFA 1TWMA 2P39A 2NP0A 1PUUB 3AKHA 4O6NA 2YC3A 4NALA 2ZQNA 3SX7A 1HM0A 1ZJ0A 3UD9A 3OH2A 4XKIA 5DZUA 1JLXA 3AZWA 3T7MA 3SX8A 2Z86A 2ZU9A 5CQLX 4G6MA 3WO2A 5D92A 3E25A 2VSIA 3R3IA 4D11C 1S0LA 4GP0A 4IRQA 3U2TA 3UDAA 3R4SA 3O4BA 4D0ZA 1G3LA 2WE9A 4L4HA 3AKFA 1NMMB 1MC3A 1YP3A 1BFBA 3BAVA 4X39A 3CKVA 3E26A 4KC2A 4MZFB 1Z90A 3I0EA 3BCVA 4XFTA 3BAOA 2ICXA 3JUJA 3RSJA 1V6WA 1FGXA 1FOAA 4Y7UA 1JQZA 3VSFA 4EE5A 1XYFA 2V0KA 3D98A 1CVSA 3RTJB 1GX4A 4P0LA 2AXMA 4UY4A 1BARA 2D7RA 2QYIB 3K8DA 4HO3A 1VZTA 6I1BA 1H4CA 2KI4A 1ON6A 1H5SA 5FZUA 2P23A 1ZI5A 5DVHA 4H04A 1TZFA 4GBPA 2RIXA 4KEJA 4EFRA 5B2HA 3ZXDA 1XG6A 3KIAA 1SR4A 3NBCA 4LO8B 5C49A 3OC9A 2QN4A 2VK9A 5CMIA 3E8LC 2I5KA 4J2XA 2Q9XA 1FV3A 4KBBA 2Y4MA 1FR9A 1TW1A 4R6UB 3CKNA 4KC1A 4I4VA 1LZJA 1ITBA 4F34A 2OI6A 3BAHA 4HO5A 3CKOA 1NUNA 4XFSA 2FYCB 4AAWA 2E8BA 3I0CA 3FUQA 1TP0A 1H7HA 1II4A 1TOOA 3V0MA 5BXSA 3V91A 4Y7FA 1MC9A 1QG8A 3Q7XA 4J2YA 2RJ0A 2YC5A 4NANA 4UEGA 3V8ZA 5C4FA 2VXLA 4O6MA 4QD2C 1G93A 4FROA 4I2SA 4I6IA 2Z48A 2VSAA 3O4CA 3OBRA 3WO4A 3ZC9A 3ZGGA 1G8OA 1NKHB 3BRGC 2OEFA 1Q03A 4B2WA 41BIA 1GX0A 4Y9XA 4IY9A 1ISYA 2GGQA 1JV1A 1V83A 3HALA 4ISRA 2AM3A 4Y6NA 5C3BA 1FMZA 3VSZA 4D8HA 1IILA 4B4BA 4OWLA 5FU0A 4EFPA 4FCEA 4NAKA 1FGGA 4CJCA 1DIWA 2I5EA 3SXGA 3UD8A 3VEQA 1ZI3A 4HO6A 2QKXA 2D0JA 2I7BA 2AAIB 4P0KA 2V0JA 5EJZA 4HJJA 3LW6A 1TW5A 5FZZA 3NGWA 4OEGA 3CA5A 1VGUA 1ZIZA 4FQWA 1M16A 1JT3A 3LLPA 1YROB 2P72A 2Y9GA 1ZHJA 1RG8A 2D7IA 3AKIA 1W3FA 1YP2A 4ASYA 1BLAA 2NM1A 3IM6A 2AFGA 2JCOA 5FNWA 3D7WB 3OGZA 5CMHA 1INJA 1YBIA 5IDTA 1IIMA 4QD2B 3ILAA 4F83A 2RSTA 1J0SA 4X37A 1VICA 1NZKA 2D24A 1FN0A 3BTAA 4GOVA 4M28A 4LO7C 1G9DA 4L41C 2DRZA 1K5UA 5D61A 1QQKA 2LIEA 3OGFA 3T8SA 4KEIA 2XWNA 2ZU8A 3I0JA 2I1BA 3K1XA 3WA1A 4AN6A 3V0BB 1H5SC 4OUJA 3FJKA 3I0IX 4DECA 4OWKA 1IOBA 3P6JA 5I1BA 2J0BA 3U2WA 4KXOA 1EV2A 2M49A 1I1BA 1S0EA 4G1RA 1PZYB 1LL0A 2RJ8A 4KQLA 4DE7A 4KPZA 2FYAA 1WBAA 2IWTB 4MZHA 2FDBM 4EE3A 1WVCA 2VUAA 3DJ4A 3BB2A 1GGPB 3EE5A 1G95A 2O1HA 3IOJA 1MP5A 5FYEA 3T7NA 3FUOA 7I1BA 1NF5B 2ESUA 3CRIA 3JUTA 1R7YA 3JTJA 1GWVA 1MD6A 3Q7UA 3OAMA 3U0YA 5IFYA 4WBCA 1HWPB 4A7ZA 4MIXA 1KWSA 2GZBA 4XFUA 1TWEA 3PMEA 1TTUA 3F1CA 3OH4A 3C9ZA 3MALA 2KI6B 3OKRA 3SXDA 4TLPA 1T4QA 4ZA3B 4JKXB 4FRMA 2ZR1B 4Q9PA 1ZI1A 4L4IA 3OBTA 3PUBA 4IHZA 4LO7B 3AZVA 3FJAA 3I29B 3I0KA 3AH2A 4ZFUB 1W3GA 3BRKX 3KMVA 2OEGA 4KC3A 1JT4A 2LIQA 1H5SB 4I4SA 5FZYA 1V6UA 3A23A 4I1BA 5BXTA 2QH5A 4P00A 3O4AA 1FWUA 4KEKA 4Q9GA 2W0WA 4BMAA 3BRFA 4I1EA 4Q91A 4QKRA 3JRRA 3TQDA 5E24E 1AFCA 2D1ZA 4EEEB 4I4RA 1OMXA 2FFVA 2RJ1A 2VS5A 4G3PA 1R7XA 1R7VA 1GQ9A 2Z49A 2VFZA 2HWMA 1YYNA 3I2AA 3F62B 2WEEA 1HV9A 1I52A 1YXWA 3FJJA 1Q04A 3CRGA 4GAIA 2RQ9A 3ZX7A 3I2XA 5BXPA 4JAWA 4USOA 1VH3A 4B3UA 5C3DA 1LVWA 4FIXA 1HWOB 1S0GA 3EF2A 3AJ5A 4FRPA 4HO2A 3PG0A 4I4UA 4LO3C 3V0AA 2BFHA 4LO2A 1MP3A 2VS3A 3H6SE 2Y4JA 3V0NA 3BA4A 3PKQA 1GQCA 5F8YA 2X5ZA 5C4CA 3AH4A 1WBCA 3RTIB 2AESA 3RMWA 2D44A 1EYLA 1R8OA 2XOAA 4GP3A 1ZI4A 2QGIA 2XMEA 1UPSA 1BLDA 3AJ6A 3BAQA 1BFFA 3N7JA 3CAHA 5DDVA 3CA1A 1ZCTA
chains in the Genus database with same CATH topology
4A7YA 4HA2A 4I7IA 4HOCA 2AM5A 4I4QA 3OH0A 3TZTA 4USPA 1TVYA 5EC5A 1M2TB 3HMYA 3CU0A 1QWJA 2MIBA 3VUOA 1EYRA 2W0VA 3UJ0A 2Y6PA 2ZQOA 3A22A 3BAUA 3WMUA 3I0LA 5CQOA 2VSEA 1JTCA 4EEOA 3BRDA 2E4MC 1FXOA 3V90A 2YESA 2Y9WC 1G9BA 1Z4SA 4CJMA 1VZXA 1TFMB 4J2KA 4JP0A 4OW4A 1H7TA 4H75A 2X2SA 3POLA 4Y7GA 5BVPI 4NAIA 2FO1A 1DZDA 1IHKA 3I0HA 2VXRA 2RG9B 2DPWA 2ICYA 2V0IA 4JQ0A 1ISWA 4DENA 2VSHA 1YF8B 2NVHA 1XHBA 1AVWB 4K6RA 3HN1A 1G9RA 5CMJA 1FR8A 1W3AA 1AVUA 1S0BA 3LTQA 3N7LA 1OMZA 1HIBA 2D20A 2J0AA 3DUVA 2AM4A 1FQ9A 2FFUA 2OI7A 21BIA 5D62A 1FGAA 2ET2A 4GAFA 3I0FA 1F31A 1XZ6A 3O3PA 2WVLA 1OQLB 1H7GA 4J18A 1FMMS 1WT1A 4EE4A 1K5VA 1G0RA 1TIEA 3N9WA 3ZF8A 2MLLB 3ZLKA 3UD7A 5BQUC 4LW3A 1AVXB 1W57A 2F2FC 1ZDFA 4HR6C 1ILR1 3V0QA 4ZFYB 4C2SA 5C48A 2IHOA 1G9CA 1FV2A 1YP4A 2BO7A 1PUMB 3OJVA 3USQA 3O4DA 5FNXA 1R82A 1FG5N 2HW9A 2NZ9A 2GO2A 4I96A 2JCJA 3FGMA 5BXCA 4LO1C 2BO6A 3VT2A 1S0CA 3SPTA 1WSZA 5AJPA 3Q7YA 4E1KA 4LO2C 4G87A 1JT5A 3CA4A 1JT7A 1ON8A 1HM9A 2PA4A 2Z87A 3JUKA 2BEBA 2OI5A 1H7EA 1VCLA 1T9FA 3FJFA 3IAGC 4LO3A 1FO8A 1LZIA 4DCKC 4QBCA 5EIYA 1Z0HA 3NJ5A 4X38A 4ISQA 2C0NA 1R80A 3DK5A 4B42A 2KH2A 3Q4SA 4FRQA 4JRAA 2HWAA 2Y9FA 2YCMA 4DEPA 2WBCA 3S8KA 1ZJPA 4Y62A 3FOQA 3V0PA 5CMGX 2PGYA 3NBDA 3FJCA 2O1FA 3K8EA 3VT0A 2CU2A 5CQMX 2FYBA 4LO0C 4HO0A 2ZU7A 3QYDA 1ONKB 5I1FA 4G9MA 4ZLBB 4R7PA 4ZFWB 1IINA 5C1GA 4EB2B 4OWJA 3N0KA 1FO9A 5BXRA 2E4MA 1V82A 1FWYA 2AE7A 1IT0A 4D48A 5FV9A 4IYBA 1FRWA 1LL3A 4FIYA 4DDZA 2HZ9A 1FXJA 2XWLA 1XZZA 4JKQA 1YTOA 1INIA 4HO8A 3V0AB 1D0HA 5F8WA 2RJ4A 1LZ0A 3P53A 2BEAA 1Z2VA 4GOYA 3SXAA 1ISVA 1HWNB 1JVGA 1KNMA 3ZC8A 1DQOA 2DS0A 3FJHA 1PC8B 1PZZA 1G1LA 2V0HA 1H3MA 4EEMA 4MYBA 4QC4A 4QBVA 4KRVA 4HG6A 4B2XA 4EVWA 2VU9A 4ZDQA 2L5XA 1QGQA 1ZCVA 3FJIA 5C38A 4Z8SB 1HJLA 1HCEA 4B5BA 1DFQA 1SS9A 1ZCUA 4H9WA 1H7FA 2VXMA 1DZCA 5BQUA 3AH1A 5F8SA 1R7TA 1ZJ1A 2F2FA 2FY7A 2Y4LA 5FUHA 4AYLA 1AXMA 1BFGA 1QQLA 2AGDA 4FRBA 3U2VA 1RZOB 1H5TB 1JVDA 4X3AA 5C4EA 1ZJ2A 5BP5A 3SX5A 4I8MA 2MC2A 1S4OA 31BIA 4JPZA 1W77A 2Q4JA 1K4VA 4I3NA 2WVMA 1MP4A 4OEFA 3FJDA 4G3QA 4LO1A 3PHZA 4D0TA 3QVBA 3CKJA 3V79C 3IIRA 2X65A 1DLLA 2YQCA 5C36A 1WD3A 4ZBVB 3CKQA 1RMLA 5EG6C 3WINA 1G2VA 1G97A 3NBEA 4I37A 4JD0A 2NS2A 3FJ8A 1RY7A 2A8WA 1VH1A 1IJTA 3FFZA 4YS8A 3IM5A 4P6AA 2RIYA 2RJ7A 4ASJA 1JYKA 3H6RB 3FWWA 1VGZA 3IM7A 4M2BA 2YQHA 2J3PA 4KNXA 1AF9A 4G9NA 2V0LA 3CQAA 1JV3A 1E5KA 3O44A 2D23A 5L6VA 4OEEA 4KC4A 4B4GA 4Y63A 3T7OA 4FVVA 5D63A 1DJSB 1S0DA 4LO0A 2JCKA 4FRLA 3FJBA 3D8VA 3SXBA 5L6SA 3SNVA 4PC4A 5DUYA 1H4DA 4ARWA 1VPAA 3U2XA 1Q1UA 2APCA 1H5TA 4HCQA 5JQQA 1BASA 2RJ9A 2BO4A 4QO3A 2NXVA 5D91A 2XWMA 2Q3NB 1IRPA 3R4UA 1W55A 4IZXA 2X2TA 3N7MA 1ZCYA 1BFCA 3BADA 2F8XC 1VGTA 2KKIA 3CU1B 4HO9A 1R8NA 1H5RA 5C4DA 3VWCA 1WT2A 1CE7B 5FTVA 3RSBA 5DDTA 4I4OA 1GA8A 5BOWA 4Q7CA 3HBWA 2E3DA 1JY0A 4CJ8A 3V8YA 3B9UA 4ZKTB 1H4EA 1V6XA 2VLCA 5CMFX 3HOMA 9ILBA 5CQPA 1ZDGA 5CQNX 1O7QA 5FU8A 5DSSB 3H6RA 5AJNA 3RMVA 3ZXGA 2AECA 3TC2A 2A8UA 3HSMA 5HPZA 3QR5A 3WO3A 2WRYA 3CGXA 3PKPA 2WGZA 4EEGA 1N4KA 5BP5C 3I0DA 3POKA 3SXCA 3V0OA 3O3QA 1WD4A 3W9TA 3GUEA 3F1RA 1I1EA 4ZGRB 3ZGFA 1VGWA 1ZJOA 1S4PA 2ERMA 4FRDA 1O7OA 5EJ1A 3A21A 4Y7VA 3N7KA 2MZBA 3O5WB 1HM8A 4ZOTA 3OH1A 4JISA 3H6QA 2FYDB 1DFCA 4J23B 1GWWA 3CRHA 2WVKA 1HCDA 1ISXA 3P6IA 3BA5A 3WINC 4P0JA 1NHEB 2RIZA 4AC3A 2PX7A 2VS4A 2O1GA 4II0A 3Q80A 1JLYA 4MZGB 3CA0A 4CJBA 4AN7B 5IDSA 1ZJ3A 3I0GA 1VZUA 1QXMA 2R9KB 3AKGA 1DQGA 4G3SA 1LZ7A 4J2SA 5JMCA 4I0YA 2AH9A 1WT0A 2P73A 2X5SA 2UX8A 3D5NA 4BQHA 2Y4KA 4A7KA 5C1LA 4Y7TA 2X60A 1PWAA 2KLLA 4EKXB 4QKSA 4ENDA 1QGSA 4FCUA 4KNRA 4AYJA 2JCLA 3Q7WA 4G6JA 4ECMA 3HL3A 1HJJA 1O0RA 2K4AB 2D43A 4D11A 4CVHA 4YOLA 3U2UA 5EHAA 3FJEA 4LW6A 1HKNA 8I1BA 3SXEA 1G23A 1HWMB 4I4XA 1AVAC 1IRAX 4I4PA 2RITA 4M2AA 3RMXA 5C3AA 1EZIA 3RMYA 1G82A 4Y6UA 1L2HA 3OJ2A 4IQPA 4FGFA 2GGOA 1H7QA 1ABRB 1WT3A 2YQSA 4B4MA 5J49A 5C8RA 2PGVA 4IY8A 4EFQA 5F90A 1E0OA 3CA6A 4QALA 2NYYA 1R81A 3ZLLA 1SR4C 5HS2A 1V6VA 1PZTA 3F1YA 2Y7AA 4FRHA 4HO4A 4MNDA 4XWIA 1P63A 1VM8A 4Y64A 5AJOA 5C4BA 1G9AA 1BA7A 3BAGA 1A8DA 3S8JA 5C47A 1OQMB 4KT7A 3ST8A 5JLVA 2YQJA 1JYLA 1EPWA 4Z9WB 1H7LA 3NBNA 4FREA 1NQIB 2RJ5A 1ISZA 4KPXA 1SZ6B 3USRA 3U0XA 2NTDA 2P6WA 3A07A 3MPPG 1H5SD 3R2WA 3O49A 2DRYA 3BA7A 1LL2A 1O23B 4M4KA 2RJ6A 1R7UA 1S4NA 3OJMA 2AQZA 5C1HA 4IONA 3WMVA 2DREA 3IOIA 2XMHA 4P02A 3SX3A 2VXTI 3FJ9A 3O4OA 1FZWA 4FRAA 2K43A 4IRPA 3UJ4A 1FWVA 5G00A 5GAQA 5FTSA 1EVTA 3V0LA 3BX1C 1NWGB 1S0FA 2D22A 3CA3A 2Y9XE 2YUGA 2BO8A 2WAWA 3OGGA 1V84A 3OH3A 3PNNA 2K8RA 2UUSA 4I4YA 4IZEA 1H5RB 2VD4A 4EEAA 3VT1A 3V0BA 3IOHA 2FGFA 1TWMA 2P39A 2NP0A 1PUUB 3AKHA 4O6NA 2YC3A 4NALA 2ZQNA 3SX7A 1HM0A 1ZJ0A 3UD9A 3OH2A 4XKIA 5DZUA 1JLXA 3AZWA 3T7MA 3SX8A 2Z86A 2ZU9A 5CQLX 4G6MA 3WO2A 5D92A 3E25A 2VSIA 3R3IA 4D11C 1S0LA 4GP0A 4IRQA 3U2TA 3UDAA 3R4SA 3O4BA 4D0ZA 1G3LA 2WE9A 4L4HA 3AKFA 1NMMB 1MC3A 1YP3A 1BFBA 3BAVA 4X39A 3CKVA 3E26A 4KC2A 4MZFB 1Z90A 3I0EA 3BCVA 4XFTA 3BAOA 2ICXA 3JUJA 3RSJA 1V6WA 1FGXA 1FOAA 4Y7UA 1JQZA 3VSFA 4EE5A 1XYFA 2V0KA 3D98A 1CVSA 3RTJB 1GX4A 4P0LA 2AXMA 4UY4A 1BARA 2D7RA 2QYIB 3K8DA 4HO3A 1VZTA 6I1BA 1H4CA 2KI4A 1ON6A 1H5SA 5FZUA 2P23A 1ZI5A 5DVHA 4H04A 1TZFA 4GBPA 2RIXA 4KEJA 4EFRA 5B2HA 3ZXDA 1XG6A 3KIAA 1SR4A 3NBCA 4LO8B 5C49A 3OC9A 2QN4A 2VK9A 5CMIA 3E8LC 2I5KA 4J2XA 2Q9XA 1FV3A 4KBBA 2Y4MA 1FR9A 1TW1A 4R6UB 3CKNA 4KC1A 4I4VA 1LZJA 1ITBA 4F34A 2OI6A 3BAHA 4HO5A 3CKOA 1NUNA 4XFSA 2FYCB 4AAWA 2E8BA 3I0CA 3FUQA 1TP0A 1H7HA 1II4A 1TOOA 3V0MA 5BXSA 3V91A 4Y7FA 1MC9A 1QG8A 3Q7XA 4J2YA 2RJ0A 2YC5A 4NANA 4UEGA 3V8ZA 5C4FA 2VXLA 4O6MA 4QD2C 1G93A 4FROA 4I2SA 4I6IA 2Z48A 2VSAA 3O4CA 3OBRA 3WO4A 3ZC9A 3ZGGA 1G8OA 1NKHB 3BRGC 2OEFA 1Q03A 4B2WA 41BIA 1GX0A 4Y9XA 4IY9A 1ISYA 2GGQA 1JV1A 1V83A 3HALA 4ISRA 2AM3A 4Y6NA 5C3BA 1FMZA 3VSZA 4D8HA 1IILA 4B4BA 4OWLA 5FU0A 4EFPA 4FCEA 4NAKA 1FGGA 4CJCA 1DIWA 2I5EA 3SXGA 3UD8A 3VEQA 1ZI3A 4HO6A 2QKXA 2D0JA 2I7BA 2AAIB 4P0KA 2V0JA 5EJZA 4HJJA 3LW6A 1TW5A 5FZZA 3NGWA 4OEGA 3CA5A 1VGUA 1ZIZA 4FQWA 1M16A 1JT3A 3LLPA 1YROB 2P72A 2Y9GA 1ZHJA 1RG8A 2D7IA 3AKIA 1W3FA 1YP2A 4ASYA 1BLAA 2NM1A 3IM6A 2AFGA 2JCOA 5FNWA 3D7WB 3OGZA 5CMHA 1INJA 1YBIA 5IDTA 1IIMA 4QD2B 3ILAA 4F83A 2RSTA 1J0SA 4X37A 1VICA 1NZKA 2D24A 1FN0A 3BTAA 4GOVA 4M28A 4LO7C 1G9DA 4L41C 2DRZA 1K5UA 5D61A 1QQKA 2LIEA 3OGFA 3T8SA 4KEIA 2XWNA 2ZU8A 3I0JA 2I1BA 3K1XA 3WA1A 4AN6A 3V0BB 1H5SC 4OUJA 3FJKA 3I0IX 4DECA 4OWKA 1IOBA 3P6JA 5I1BA 2J0BA 3U2WA 4KXOA 1EV2A 2M49A 1I1BA 1S0EA 4G1RA 1PZYB 1LL0A 2RJ8A 4KQLA 4DE7A 4KPZA 2FYAA 1WBAA 2IWTB 4MZHA 2FDBM 4EE3A 1WVCA 2VUAA 3DJ4A 3BB2A 1GGPB 3EE5A 1G95A 2O1HA 3IOJA 1MP5A 5FYEA 3T7NA 3FUOA 7I1BA 1NF5B 2ESUA 3CRIA 3JUTA 1R7YA 3JTJA 1GWVA 1MD6A 3Q7UA 3OAMA 3U0YA 5IFYA 4WBCA 1HWPB 4A7ZA 4MIXA 1KWSA 2GZBA 4XFUA 1TWEA 3PMEA 1TTUA 3F1CA 3OH4A 3C9ZA 3MALA 2KI6B 3OKRA 3SXDA 4TLPA 1T4QA 4ZA3B 4JKXB 4FRMA 2ZR1B 4Q9PA 1ZI1A 4L4IA 3OBTA 3PUBA 4IHZA 4LO7B 3AZVA 3FJAA 3I29B 3I0KA 3AH2A 4ZFUB 1W3GA 3BRKX 3KMVA 2OEGA 4KC3A 1JT4A 2LIQA 1H5SB 4I4SA 5FZYA 1V6UA 3A23A 4I1BA 5BXTA 2QH5A 4P00A 3O4AA 1FWUA 4KEKA 4Q9GA 2W0WA 4BMAA 3BRFA 4I1EA 4Q91A 4QKRA 3JRRA 3TQDA 5E24E 1AFCA 2D1ZA 4EEEB 4I4RA 1OMXA 2FFVA 2RJ1A 2VS5A 4G3PA 1R7XA 1R7VA 1GQ9A 2Z49A 2VFZA 2HWMA 1YYNA 3I2AA 3F62B 2WEEA 1HV9A 1I52A 1YXWA 3FJJA 1Q04A 3CRGA 4GAIA 2RQ9A 3ZX7A 3I2XA 5BXPA 4JAWA 4USOA 1VH3A 4B3UA 5C3DA 1LVWA 4FIXA 1HWOB 1S0GA 3EF2A 3AJ5A 4FRPA 4HO2A 3PG0A 4I4UA 4LO3C 3V0AA 2BFHA 4LO2A 1MP3A 2VS3A 3H6SE 2Y4JA 3V0NA 3BA4A 3PKQA 1GQCA 5F8YA 2X5ZA 5C4CA 3AH4A 1WBCA 3RTIB 2AESA 3RMWA 2D44A 1EYLA 1R8OA 2XOAA 4GP3A 1ZI4A 2QGIA 2XMEA 1UPSA 1BLDA 3AJ6A 3BAQA 1BFFA 3N7JA 3CAHA 5DDVA 3CA1A 1ZCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A7Y A;  4HA2 A;  4I7I A;  4HOC A;  2AM5 A;  4I4Q A;  3OH0 A;  3TZT A;  4USP A;  1TVY A;  5EC5 A;  1M2T B;  3HMY A;  3CU0 A;  1QWJ A;  2MIB A;  3VUO A;  1EYR A;  2W0V A;  3UJ0 A;  2Y6P A;  2ZQO A;  3A22 A;  3BAU A;  3WMU A;  3I0L A;  5CQO A;  2VSE A;  1JTC A;  4EEO A;  3BRD A;  2E4M C;  1FXO A;  3V90 A;  2YES A;  2Y9W C;  1G9B A;  1Z4S A;  4CJM A;  1VZX A;  1TFM B;  4J2K A;  4JP0 A;  4OW4 A;  1H7T A;  2X2S A;  3POL A;  4Y7G A;  5BVP I;  4NAI A;  2FO1 A;  1DZD A;  1IHK A;  3I0H A;  2VXR A;  2RG9 B;  2DPW A;  2ICY A;  2V0I A;  4JQ0 A;  1ISW A;  4DEN A;  2VSH A;  1YF8 B;  2NVH A;  1XHB A;  1AVW B;  4K6R A;  3HN1 A;  1G9R A;  5CMJ A;  1FR8 A;  1W3A A;  1AVU A;  1S0B A;  3LTQ A;  3N7L A;  1OMZ A;  1HIB A;  2D20 A;  3DUV A;  3OKR A;  2AM4 A;  1FQ9 A;  2FFU A;  2OI7 A;  21BI A;  5D62 A;  1FGA A;  2ET2 A;  4GAF A;  3I0F A;  1F31 A;  1XZ6 A;  3O3P A;  2WVL A;  1OQL B;  1H7G A;  4J18 A;  1FMM S;  1WT1 A;  4EE4 A;  1K5V A;  1G0R A;  1TIE A;  3N9W A;  3ZF8 A;  2MLL B;  3ZLK A;  3UD7 A;  5BQU C;  4LW3 A;  1AVX B;  1W57 A;  2F2F C;  1ZDF A;  4HR6 C;  1ILR 1;  3V0Q A;  4ZFY B;  4C2S A;  5C48 A;  2IHO A;  1G9C A;  1FV2 A;  1YP4 A;  2BO7 A;  1PUM B;  3OJV A;  3USQ A;  3O4D A;  5FNX A;  1R82 A;  1FG5 N;  2HW9 A;  2NZ9 A;  2GO2 A;  4I96 A;  2JCJ A;  3FGM A;  5BXC A;  4LO1 C;  2BO6 A;  3VT2 A;  1S0C A;  3SPT A;  1WSZ A;  5AJP A;  3Q7Y A;  4E1K A;  4LO2 C;  4G87 A;  1JT5 A;  3CA4 A;  1JT7 A;  1ON8 A;  1HM9 A;  2PA4 A;  2Z87 A;  3JUK A;  2BEB A;  2OI5 A;  1H7E A;  1VCL A;  1T9F A;  3FJF A;  3IAG C;  4LO3 A;  1FO8 A;  1LZI A;  4DCK C;  4QBC A;  5EIY A;  1Z0H A;  3NJ5 A;  4X38 A;  4ISQ A;  1R80 A;  3DK5 A;  4B42 A;  2KH2 A;  3Q4S A;  4FRQ A;  4JRA A;  2HWA A;  2Y9F A;  2YCM A;  4DEP A;  2WBC A;  3S8K A;  1ZJP A;  4Y62 A;  3FOQ A;  3V0P A;  5CMG X;  2PGY A;  3NBD A;  3FJC A;  2O1F A;  3K8E A;  3VT0 A;  2CU2 A;  5CQM X;  2FYB A;  4LO0 C;  4HO0 A;  2ZU7 A;  3QYD A;  1ONK B;  5I1F A;  4G9M A;  4ZLB B;  4R7P A;  4ZFW B;  1IIN A;  5C1G A;  4EB2 B;  4OWJ A;  3N0K A;  1FO9 A;  5BXR A;  2E4M A;  1V82 A;  1FWY A;  2AE7 A;  1IT0 A;  4D48 A;  5FV9 A;  4IYB A;  1FRW A;  1LL3 A;  4DDZ A;  2HZ9 A;  1FXJ A;  2XWL A;  1XZZ A;  4JKQ A;  1YTO A;  1INI A;  4HO8 A;  3V0A B;  1D0H A;  5F8W A;  2RJ4 A;  1LZ0 A;  3P53 A;  2BEA A;  1Z2V A;  4GOY A;  3SXA A;  1ISV A;  1HWN B;  1JVG A;  1KNM A;  3ZC8 A;  1DQO A;  2DS0 A;  3FJH A;  1PC8 B;  1PZZ A;  1G1L A;  2V0H A;  1H3M A;  4EEM A;  4MYB A;  4QC4 A;  4QBV A;  4KRV A;  4HG6 A;  4B2X A;  4EVW A;  2VU9 A;  4ZDQ A;  2L5X A;  1QGQ A;  1ZCV A;  3FJI A;  5C38 A;  4Z8S B;  1HJL A;  1HCE A;  4B5B A;  1DFQ A;  1SS9 A;  1ZCU A;  4H9W A;  1H7F A;  2VXM A;  1DZC A;  5BQU A;  3AH1 A;  5F8S A;  1R7T A;  1ZJ1 A;  2F2F A;  2FY7 A;  2Y4L A;  5FUH A;  4AYL A;  1AXM A;  1BFG A;  1QQL A;  2AGD A;  4FRB A;  3U2V A;  1RZO B;  1H5T B;  1JVD A;  4X3A A;  5C4E A;  1ZJ2 A;  5BP5 A;  3SX5 A;  4I8M A;  2MC2 A;  1S4O A;  31BI A;  4JPZ A;  1W77 A;  2Q4J A;  1K4V A;  4I3N A;  2WVM A;  1MP4 A;  4OEF A;  3FJD A;  4G3Q A;  4LO1 A;  3PHZ A;  4D0T A;  3QVB A;  3CKJ A;  3V79 C;  3IIR A;  2X65 A;  1DLL A;  2YQC A;  5C36 A;  1WD3 A;  4ZBV B;  3CKQ A;  1RML A;  5EG6 C;  3WIN A;  1G2V A;  1G97 A;  3NBE A;  4I37 A;  4JD0 A;  2A8W A;  3FJ8 A;  1RY7 A;  4YS8 A;  1VH1 A;  1IJT A;  3FFZ A;  3IM5 A;  4P6A A;  2RIY A;  2RJ7 A;  4ASJ A;  1JYK A;  3H6R B;  3FWW A;  1VGZ A;  3IM7 A;  4M2B A;  2YQH A;  2J3P A;  4KNX A;  1AF9 A;  4G9N A;  2V0L A;  3CQA A;  1JV3 A;  1E5K A;  3O44 A;  2D23 A;  4OEE A;  4KC4 A;  4B4G A;  4Y63 A;  3T7O A;  4FVV A;  5D63 A;  1DJS B;  1S0D A;  4LO0 A;  2JCK A;  4FRL A;  3FJB A;  3D8V A;  3SXB A;  5L6S A;  3SNV A;  4PC4 A;  5DUY A;  1H4D A;  4ARW A;  1VPA A;  3U2X A;  1Q1U A;  2APC A;  1H5T A;  4HCQ A;  5JQQ A;  1BAS A;  2RJ9 A;  2BO4 A;  4QO3 A;  2NXV A;  2XWM A;  2Q3N B;  1IRP A;  3R4U A;  1W55 A;  4IZX A;  2X2T A;  3N7M A;  1ZCY A;  1BFC A;  3BAD A;  2F8X C;  1VGT A;  2KKI A;  3CU1 B;  4HO9 A;  1R8N A;  1H5R A;  5C4D A;  3VWC A;  1WT2 A;  1CE7 B;  5FTV A;  3RSB A;  5DDT A;  4I4O A;  1GA8 A;  5BOW A;  3HBW A;  2E3D A;  1JY0 A;  4CJ8 A;  3V8Y A;  3B9U A;  4ZKT B;  1H4E A;  1V6X A;  2VLC A;  5CMF X;  3HOM A;  9ILB A;  5CQP A;  1ZDG A;  5CQN X;  1O7Q A;  5FU8 A;  5DSS B;  3H6R A;  5AJN A;  3RMV A;  3ZXG A;  2AEC A;  3TC2 A;  2A8U A;  3HSM A;  5HPZ A;  3QR5 A;  3WO3 A;  2WRY A;  3CGX A;  3PKP A;  2WGZ A;  4EEG A;  1N4K A;  5BP5 C;  3I0D A;  3POK A;  3SXC A;  3V0O A;  3O3Q A;  1WD4 A;  3W9T A;  3GUE A;  3F1R A;  1I1E A;  4ZGR B;  3ZGF A;  1VGW A;  1ZJO A;  1S4P A;  2ERM A;  4FRD A;  1O7O A;  5EJ1 A;  3A21 A;  4Y7V A;  3N7K A;  2MZB A;  3O5W B;  1HM8 A;  4ZOT A;  3OH1 A;  4JIS A;  3H6Q A;  2FYD B;  1DFC A;  4J23 B;  1GWW A;  3CRH A;  2WVK A;  1HCD A;  1ISX A;  3P6I A;  3BA5 A;  3WIN C;  4P0J A;  1NHE B;  2RIZ A;  4AC3 A;  2PX7 A;  2VS4 A;  2O1G A;  4II0 A;  3Q80 A;  1JLY A;  3CA0 A;  4CJB A;  4AN7 B;  5IDS A;  1ZJ3 A;  3I0G A;  1VZU A;  1QXM A;  2R9K B;  3AKG A;  1DQG A;  4G3S A;  1LZ7 A;  4J2S A;  5JMC A;  4I0Y A;  2AH9 A;  1WT0 A;  2P73 A;  2X5S A;  2UX8 A;  3D5N A;  4BQH A;  2Y4K A;  4A7K A;  5C1L A;  4Y7T A;  2X60 A;  1PWA A;  2KLL A;  4EKX B;  4QKS A;  4END A;  1QGS A;  4FCU A;  4KNR A;  4AYJ A;  2JCL A;  3Q7W A;  4G6J A;  4ECM A;  3HL3 A;  1HJJ A;  1O0R A;  2K4A B;  2D43 A;  4D11 A;  4CVH A;  4YOL A;  3U2U A;  5EHA A;  3FJE A;  4LW6 A;  1HKN A;  8I1B A;  3SXE A;  1G23 A;  1HWM B;  4I4X A;  1AVA C;  1IRA X;  4I4P A;  2RIT A;  4M2A A;  3RMX A;  5C3A A;  1EZI A;  3RMY A;  1G82 A;  4Y6U A;  1L2H A;  3OJ2 A;  4IQP A;  4FGF A;  2GGO A;  1H7Q A;  1ABR B;  1WT3 A;  2YQS A;  4B4M A;  5J49 A;  5C8R A;  2PGV A;  4IY8 A;  4EFQ A;  5F90 A;  1E0O A;  3CA6 A;  4QAL A;  2NYY A;  1R81 A;  3ZLL A;  1SR4 C;  5HS2 A;  1V6V A;  1PZT A;  3F1Y A;  2Y7A A;  4FRH A;  4HO4 A;  4MND A;  4XWI A;  1P63 A;  1VM8 A;  4Y64 A;  5AJO A;  5C4B A;  1G9A A;  1BA7 A;  3BAG A;  1A8D A;  3S8J A;  5C47 A;  1OQM B;  4KT7 A;  3ST8 A;  5JLV A;  2YQJ A;  1JYL A;  1EPW A;  4Z9W B;  1H7L A;  3NBN A;  4FRE A;  1NQI B;  2RJ5 A;  1ISZ A;  4KPX A;  1SZ6 B;  3USR A;  3U0X A;  2NTD A;  2P6W A;  3A07 A;  3MPP G;  1H5S D;  3R2W A;  3O49 A;  2DRY A;  3BA7 A;  1LL2 A;  1O23 B;  4M4K A;  2RJ6 A;  1R7U A;  1S4N A;  3OJM A;  2AQZ A;  5C1H A;  4ION A;  3WMV A;  2DRE A;  3IOI A;  2XMH A;  4P02 A;  3SX3 A;  2VXT I;  3FJ9 A;  3O4O A;  1FZW A;  4FRA A;  2K43 A;  4IRP A;  3UJ4 A;  1FWV A;  5G00 A;  5GAQ A;  5FTS A;  1EVT A;  3V0L A;  3BX1 C;  1NWG B;  1S0F A;  2D22 A;  3CA3 A;  2Y9X E;  2YUG A;  2BO8 A;  2WAW A;  3OGG A;  1V84 A;  3OH3 A;  3PNN A;  2K8R A;  2UUS A;  4I4Y A;  4IZE A;  1H5R B;  2VD4 A;  4EEA A;  3VT1 A;  3V0B A;  3IOH A;  2FGF A;  1TWM A;  2P39 A;  2NP0 A;  1PUU B;  3AKH A;  2YC3 A;  4NAL A;  2ZQN A;  3SX7 A;  1HM0 A;  1ZJ0 A;  3UD9 A;  3OH2 A;  4XKI A;  5DZU A;  1JLX A;  3AZW A;  3T7M A;  3SX8 A;  2Z86 A;  2ZU9 A;  5CQL X;  4G6M A;  3WO2 A;  3E25 A;  2VSI A;  3R3I A;  4D11 C;  1S0L A;  4GP0 A;  4IRQ A;  3U2T A;  3UDA A;  3R4S A;  3O4B A;  4D0Z A;  1G3L A;  2WE9 A;  4L4H A;  3AKF A;  1NMM B;  1MC3 A;  1YP3 A;  1BFB A;  3BAV A;  4X39 A;  3CKV A;  3E26 A;  4KC2 A;  1Z90 A;  3I0E A;  3BCV A;  4XFT A;  3BAO A;  2ICX A;  3JUJ A;  3RSJ A;  1V6W A;  1FGX A;  1FOA A;  4Y7U A;  1JQZ A;  3VSF A;  4EE5 A;  1XYF A;  2V0K A;  3D98 A;  1CVS A;  3RTJ B;  1GX4 A;  4P0L A;  2AXM A;  1BAR A;  2D7R A;  2QYI B;  3K8D A;  4HO3 A;  1VZT A;  6I1B A;  1H4C A;  2KI4 A;  1ON6 A;  1H5S A;  5FZU A;  2P23 A;  1ZI5 A;  5DVH A;  4H04 A;  1TZF A;  4GBP A;  2RIX A;  4KEJ A;  4EFR A;  5B2H A;  3ZXD A;  1XG6 A;  3KIA A;  1SR4 A;  3NBC A;  4LO8 B;  5C49 A;  3OC9 A;  2QN4 A;  5CMI A;  3E8L C;  2I5K A;  4J2X A;  2Q9X A;  1FV3 A;  4KBB A;  2Y4M A;  1FR9 A;  1TW1 A;  4R6U B;  3CKN A;  4KC1 A;  4I4V A;  1LZJ A;  1ITB A;  4F34 A;  2OI6 A;  3BAH A;  4HO5 A;  3CKO A;  1NUN A;  4XFS A;  2FYC B;  4AAW A;  2E8B A;  3I0C A;  3FUQ A;  1TP0 A;  1H7H A;  1II4 A;  1TOO A;  3V0M A;  5BXS A;  3V91 A;  4Y7F A;  1MC9 A;  1QG8 A;  3Q7X A;  4J2Y A;  2RJ0 A;  2YC5 A;  4NAN A;  4UEG A;  3V8Z A;  5C4F A;  2VXL A;  4QD2 C;  1G93 A;  4FRO A;  4I2S A;  4I6I A;  2Z48 A;  2VSA A;  3O4C A;  3OBR A;  3WO4 A;  3ZC9 A;  3ZGG A;  1G8O A;  1NKH B;  3BRG C;  2OEF A;  1Q03 A;  4B2W A;  41BI A;  1GX0 A;  4Y9X A;  4IY9 A;  1ISY A;  2GGQ A;  1JV1 A;  1V83 A;  3HAL A;  4ISR A;  2AM3 A;  4Y6N A;  5C3B A;  1FMZ A;  3VSZ A;  4D8H A;  1IIL A;  4B4B A;  4OWL A;  5FU0 A;  4EFP A;  4FCE A;  4NAK A;  1FGG A;  4CJC A;  1DIW A;  2I5E A;  3SXG A;  3UD8 A;  3VEQ A;  1ZI3 A;  4HO6 A;  2QKX A;  2D0J A;  2I7B A;  2AAI B;  4P0K A;  2V0J A;  5EJZ A;  4HJJ A;  3LW6 A;  1TW5 A;  5FZZ A;  3NGW A;  4OEG A;  3CA5 A;  1VGU A;  1ZIZ A;  4FQW A;  1M16 A;  1JT3 A;  3LLP A;  1YRO B;  2P72 A;  2Y9G A;  1ZHJ A;  1RG8 A;  2D7I A;  3AKI A;  1W3F A;  1YP2 A;  4ASY A;  1BLA A;  2NM1 A;  3IM6 A;  2AFG A;  2JCO A;  5FNW A;  3D7W B;  3OGZ A;  5CMH A;  1INJ A;  1YBI A;  5IDT A;  1IIM A;  4QD2 B;  3ILA A;  4F83 A;  2RST A;  1J0S A;  4X37 A;  1VIC A;  1NZK A;  2D24 A;  1FN0 A;  3BTA A;  4GOV A;  4M28 A;  4LO7 C;  1G9D A;  4L41 C;  2DRZ A;  1K5U A;  5D61 A;  1QQK A;  2LIE A;  3OGF A;  3T8S A;  4KEI A;  2XWN A;  2ZU8 A;  3I0J A;  2I1B A;  3K1X A;  3WA1 A;  4AN6 A;  3V0B B;  1H5S C;  4OUJ A;  3FJK A;  3I0I X;  4DEC A;  4OWK A;  1IOB A;  3P6J A;  5I1B A;  3U2W A;  4KXO A;  1EV2 A;  2M49 A;  1I1B A;  1S0E A;  4G1R A;  1PZY B;  1LL0 A;  2RJ8 A;  4KQL A;  4DE7 A;  4KPZ A;  2FYA A;  1WBA A;  2IWT B;  2FDB M;  4EE3 A;  1WVC A;  2VUA A;  3DJ4 A;  3BB2 A;  1GGP B;  3EE5 A;  1G95 A;  2O1H A;  3IOJ A;  1MP5 A;  5FYE A;  3T7N A;  3FUO A;  7I1B A;  1NF5 B;  2ESU A;  3CRI A;  3JUT A;  1R7Y A;  3JTJ A;  1GWV A;  1MD6 A;  3Q7U A;  3OAM A;  3U0Y A;  5IFY A;  4WBC A;  1HWP B;  4A7Z A;  1KWS A;  2GZB A;  4XFU A;  1TWE A;  3PME A;  1TTU A;  3F1C A;  3OH4 A;  3C9Z A;  3MAL A;  2KI6 B;  3SXD A;  5L6V A;  4TLP A;  1T4Q A;  4ZA3 B;  4JKX B;  4FRM A;  2ZR1 B;  4Q9P A;  1ZI1 A;  4L4I A;  3OBT A;  3PUB A;  4IHZ A;  4LO7 B;  3AZV A;  3FJA A;  3I29 B;  3I0K A;  3AH2 A;  4ZFU B;  1W3G A;  3BRK X;  3KMV A;  2OEG A;  4KC3 A;  1JT4 A;  2LIQ A;  1H5S B;  4I4S A;  5FZY A;  1V6U A;  3A23 A;  4I1B A;  5BXT A;  2QH5 A;  4P00 A;  3O4A A;  1FWU A;  4KEK A;  4Q9G A;  2W0W A;  4BMA A;  3BRF A;  4I1E A;  4Q91 A;  4QKR A;  3JRR A;  3TQD A;  5E24 E;  1AFC A;  2D1Z A;  4EEE B;  4I4R A;  1OMX A;  2FFV A;  2RJ1 A;  2VS5 A;  4G3P A;  1R7X A;  1R7V A;  1GQ9 A;  2Z49 A;  2VFZ A;  2HWM A;  1YYN A;  3I2A A;  3F62 B;  2WEE A;  1HV9 A;  1I52 A;  1YXW A;  3FJJ A;  1Q04 A;  3CRG A;  4GAI A;  2RQ9 A;  3ZX7 A;  3I2X A;  5BXP A;  4JAW A;  4USO A;  1VH3 A;  4B3U A;  5C3D A;  1LVW A;  1HWO B;  1S0G A;  3EF2 A;  3AJ5 A;  4FRP A;  4HO2 A;  3PG0 A;  4I4U A;  4LO3 C;  3V0A A;  2BFH A;  4LO2 A;  1MP3 A;  2VS3 A;  3H6S E;  2Y4J A;  3V0N A;  3BA4 A;  3PKQ A;  1GQC A;  5F8Y A;  2X5Z A;  5C4C A;  3AH4 A;  1WBC A;  3RTI B;  2AES A;  3RMW A;  2D44 A;  1EYL A;  1R8O A;  2XOA A;  4GP3 A;  1ZI4 A;  2QGI A;  2XME A;  1UPS A;  1BLD A;  3AJ6 A;  3BAQ A;  1BFF A;  3N7J A;  3CAH A;  5DDV A;  3CA1 A;  1ZCT A; 
#chains in the Genus database with same CATH topology
 4A7Y A;  4HA2 A;  4I7I A;  4HOC A;  2AM5 A;  4I4Q A;  3OH0 A;  3TZT A;  4USP A;  1TVY A;  5EC5 A;  1M2T B;  3HMY A;  3CU0 A;  1QWJ A;  2MIB A;  3VUO A;  1EYR A;  2W0V A;  3UJ0 A;  2Y6P A;  2ZQO A;  3A22 A;  3BAU A;  3WMU A;  3I0L A;  5CQO A;  2VSE A;  1JTC A;  4EEO A;  3BRD A;  2E4M C;  1FXO A;  3V90 A;  2YES A;  2Y9W C;  1G9B A;  1Z4S A;  4CJM A;  1VZX A;  1TFM B;  4J2K A;  4JP0 A;  4OW4 A;  1H7T A;  4H75 A;  2X2S A;  3POL A;  4Y7G A;  5BVP I;  4NAI A;  2FO1 A;  1DZD A;  1IHK A;  3I0H A;  2VXR A;  2RG9 B;  2DPW A;  2ICY A;  2V0I A;  4JQ0 A;  1ISW A;  4DEN A;  2VSH A;  1YF8 B;  2NVH A;  1XHB A;  1AVW B;  4K6R A;  3HN1 A;  1G9R A;  5CMJ A;  1FR8 A;  1W3A A;  1AVU A;  1S0B A;  3LTQ A;  3N7L A;  1OMZ A;  1HIB A;  2D20 A;  2J0A A;  3DUV A;  2AM4 A;  1FQ9 A;  2FFU A;  2OI7 A;  21BI A;  5D62 A;  1FGA A;  2ET2 A;  4GAF A;  3I0F A;  1F31 A;  1XZ6 A;  3O3P A;  2WVL A;  1OQL B;  1H7G A;  4J18 A;  1FMM S;  1WT1 A;  4EE4 A;  1K5V A;  1G0R A;  1TIE A;  3N9W A;  3ZF8 A;  2MLL B;  3ZLK A;  3UD7 A;  5BQU C;  4LW3 A;  1AVX B;  1W57 A;  2F2F C;  1ZDF A;  4HR6 C;  1ILR 1;  3V0Q A;  4ZFY B;  4C2S A;  5C48 A;  2IHO A;  1G9C A;  1FV2 A;  1YP4 A;  2BO7 A;  1PUM B;  3OJV A;  3USQ A;  3O4D A;  5FNX A;  1R82 A;  1FG5 N;  2HW9 A;  2NZ9 A;  2GO2 A;  4I96 A;  2JCJ A;  3FGM A;  5BXC A;  4LO1 C;  2BO6 A;  3VT2 A;  1S0C A;  3SPT A;  1WSZ A;  5AJP A;  3Q7Y A;  4E1K A;  4LO2 C;  4G87 A;  1JT5 A;  3CA4 A;  1JT7 A;  1ON8 A;  1HM9 A;  2PA4 A;  2Z87 A;  3JUK A;  2BEB A;  2OI5 A;  1H7E A;  1VCL A;  1T9F A;  3FJF A;  3IAG C;  4LO3 A;  1FO8 A;  1LZI A;  4DCK C;  4QBC A;  5EIY A;  1Z0H A;  3NJ5 A;  4X38 A;  4ISQ A;  2C0N A;  1R80 A;  3DK5 A;  4B42 A;  2KH2 A;  3Q4S A;  4FRQ A;  4JRA A;  2HWA A;  2Y9F A;  2YCM A;  4DEP A;  2WBC A;  3S8K A;  1ZJP A;  4Y62 A;  3FOQ A;  3V0P A;  5CMG X;  2PGY A;  3NBD A;  3FJC A;  2O1F A;  3K8E A;  3VT0 A;  2CU2 A;  5CQM X;  2FYB A;  4LO0 C;  4HO0 A;  2ZU7 A;  3QYD A;  1ONK B;  5I1F A;  4G9M A;  4ZLB B;  4R7P A;  4ZFW B;  1IIN A;  5C1G A;  4EB2 B;  4OWJ A;  3N0K A;  1FO9 A;  5BXR A;  2E4M A;  1V82 A;  1FWY A;  2AE7 A;  1IT0 A;  4D48 A;  5FV9 A;  4IYB A;  1FRW A;  1LL3 A;  4FIY A;  4DDZ A;  2HZ9 A;  1FXJ A;  2XWL A;  1XZZ A;  4JKQ A;  1YTO A;  1INI A;  4HO8 A;  3V0A B;  1D0H A;  5F8W A;  2RJ4 A;  1LZ0 A;  3P53 A;  2BEA A;  1Z2V A;  4GOY A;  3SXA A;  1ISV A;  1HWN B;  1JVG A;  1KNM A;  3ZC8 A;  1DQO A;  2DS0 A;  3FJH A;  1PC8 B;  1PZZ A;  1G1L A;  2V0H A;  1H3M A;  4EEM A;  4MYB A;  4QC4 A;  4QBV A;  4KRV A;  4HG6 A;  4B2X A;  4EVW A;  2VU9 A;  4ZDQ A;  2L5X A;  1QGQ A;  1ZCV A;  3FJI A;  5C38 A;  4Z8S B;  1HJL A;  1HCE A;  4B5B A;  1DFQ A;  1SS9 A;  1ZCU A;  4H9W A;  1H7F A;  2VXM A;  1DZC A;  5BQU A;  3AH1 A;  5F8S A;  1R7T A;  1ZJ1 A;  2F2F A;  2FY7 A;  2Y4L A;  5FUH A;  4AYL A;  1AXM A;  1BFG A;  1QQL A;  2AGD A;  4FRB A;  3U2V A;  1RZO B;  1H5T B;  1JVD A;  4X3A A;  5C4E A;  1ZJ2 A;  5BP5 A;  3SX5 A;  4I8M A;  2MC2 A;  1S4O A;  31BI A;  4JPZ A;  1W77 A;  2Q4J A;  1K4V A;  4I3N A;  2WVM A;  1MP4 A;  4OEF A;  3FJD A;  4G3Q A;  4LO1 A;  3PHZ A;  4D0T A;  3QVB A;  3CKJ A;  3V79 C;  3IIR A;  2X65 A;  1DLL A;  2YQC A;  5C36 A;  1WD3 A;  4ZBV B;  3CKQ A;  1RML A;  5EG6 C;  3WIN A;  1G2V A;  1G97 A;  3NBE A;  4I37 A;  4JD0 A;  2NS2 A;  3FJ8 A;  1RY7 A;  2A8W A;  1VH1 A;  1IJT A;  3FFZ A;  4YS8 A;  3IM5 A;  4P6A A;  2RIY A;  2RJ7 A;  4ASJ A;  1JYK A;  3H6R B;  3FWW A;  1VGZ A;  3IM7 A;  4M2B A;  2YQH A;  2J3P A;  4KNX A;  1AF9 A;  4G9N A;  2V0L A;  3CQA A;  1JV3 A;  1E5K A;  3O44 A;  2D23 A;  5L6V A;  4OEE A;  4KC4 A;  4B4G A;  4Y63 A;  3T7O A;  4FVV A;  5D63 A;  1DJS B;  1S0D A;  4LO0 A;  2JCK A;  4FRL A;  3FJB A;  3D8V A;  3SXB A;  5L6S A;  3SNV A;  4PC4 A;  5DUY A;  1H4D A;  4ARW A;  1VPA A;  3U2X A;  1Q1U A;  2APC A;  1H5T A;  4HCQ A;  5JQQ A;  1BAS A;  2RJ9 A;  2BO4 A;  4QO3 A;  2NXV A;  5D91 A;  2XWM A;  2Q3N B;  1IRP A;  3R4U A;  1W55 A;  4IZX A;  2X2T A;  3N7M A;  1ZCY A;  1BFC A;  3BAD A;  2F8X C;  1VGT A;  2KKI A;  3CU1 B;  4HO9 A;  1R8N A;  1H5R A;  5C4D A;  3VWC A;  1WT2 A;  1CE7 B;  5FTV A;  3RSB A;  5DDT A;  4I4O A;  1GA8 A;  5BOW A;  4Q7C A;  3HBW A;  2E3D A;  1JY0 A;  4CJ8 A;  3V8Y A;  3B9U A;  4ZKT B;  1H4E A;  1V6X A;  2VLC A;  5CMF X;  3HOM A;  9ILB A;  5CQP A;  1ZDG A;  5CQN X;  1O7Q A;  5FU8 A;  5DSS B;  3H6R A;  5AJN A;  3RMV A;  3ZXG A;  2AEC A;  3TC2 A;  2A8U A;  3HSM A;  5HPZ A;  3QR5 A;  3WO3 A;  2WRY A;  3CGX A;  3PKP A;  2WGZ A;  4EEG A;  1N4K A;  5BP5 C;  3I0D A;  3POK A;  3SXC A;  3V0O A;  3O3Q A;  1WD4 A;  3W9T A;  3GUE A;  3F1R A;  1I1E A;  4ZGR B;  3ZGF A;  1VGW A;  1ZJO A;  1S4P A;  2ERM A;  4FRD A;  1O7O A;  5EJ1 A;  3A21 A;  4Y7V A;  3N7K A;  2MZB A;  3O5W B;  1HM8 A;  4ZOT A;  3OH1 A;  4JIS A;  3H6Q A;  2FYD B;  1DFC A;  4J23 B;  1GWW A;  3CRH A;  2WVK A;  1HCD A;  1ISX A;  3P6I A;  3BA5 A;  3WIN C;  4P0J A;  1NHE B;  2RIZ A;  4AC3 A;  2PX7 A;  2VS4 A;  2O1G A;  4II0 A;  3Q80 A;  1JLY A;  4MZG B;  3CA0 A;  4CJB A;  4AN7 B;  5IDS A;  1ZJ3 A;  3I0G A;  1VZU A;  1QXM A;  2R9K B;  3AKG A;  1DQG A;  4G3S A;  1LZ7 A;  4J2S A;  5JMC A;  4I0Y A;  2AH9 A;  1WT0 A;  2P73 A;  2X5S A;  2UX8 A;  3D5N A;  4BQH A;  2Y4K A;  4A7K A;  5C1L A;  4Y7T A;  2X60 A;  1PWA A;  2KLL A;  4EKX B;  4QKS A;  4END A;  1QGS A;  4FCU A;  4KNR A;  4AYJ A;  2JCL A;  3Q7W A;  4G6J A;  4ECM A;  3HL3 A;  1HJJ A;  1O0R A;  2K4A B;  2D43 A;  4D11 A;  4CVH A;  4YOL A;  3U2U A;  5EHA A;  3FJE A;  4LW6 A;  1HKN A;  8I1B A;  3SXE A;  1G23 A;  1HWM B;  4I4X A;  1AVA C;  1IRA X;  4I4P A;  2RIT A;  4M2A A;  3RMX A;  5C3A A;  1EZI A;  3RMY A;  1G82 A;  4Y6U A;  1L2H A;  3OJ2 A;  4IQP A;  4FGF A;  2GGO A;  1H7Q A;  1ABR B;  1WT3 A;  2YQS A;  4B4M A;  5J49 A;  5C8R A;  2PGV A;  4IY8 A;  4EFQ A;  5F90 A;  1E0O A;  3CA6 A;  4QAL A;  2NYY A;  1R81 A;  3ZLL A;  1SR4 C;  5HS2 A;  1V6V A;  1PZT A;  3F1Y A;  2Y7A A;  4FRH A;  4HO4 A;  4MND A;  4XWI A;  1P63 A;  1VM8 A;  4Y64 A;  5AJO A;  5C4B A;  1G9A A;  1BA7 A;  3BAG A;  1A8D A;  3S8J A;  5C47 A;  1OQM B;  4KT7 A;  3ST8 A;  5JLV A;  2YQJ A;  1JYL A;  1EPW A;  4Z9W B;  1H7L A;  3NBN A;  4FRE A;  1NQI B;  2RJ5 A;  1ISZ A;  4KPX A;  1SZ6 B;  3USR A;  3U0X A;  2NTD A;  2P6W A;  3A07 A;  3MPP G;  1H5S D;  3R2W A;  3O49 A;  2DRY A;  3BA7 A;  1LL2 A;  1O23 B;  4M4K A;  2RJ6 A;  1R7U A;  1S4N A;  3OJM A;  2AQZ A;  5C1H A;  4ION A;  3WMV A;  2DRE A;  3IOI A;  2XMH A;  4P02 A;  3SX3 A;  2VXT I;  3FJ9 A;  3O4O A;  1FZW A;  4FRA A;  2K43 A;  4IRP A;  3UJ4 A;  1FWV A;  5G00 A;  5GAQ A;  5FTS A;  1EVT A;  3V0L A;  3BX1 C;  1NWG B;  1S0F A;  2D22 A;  3CA3 A;  2Y9X E;  2YUG A;  2BO8 A;  2WAW A;  3OGG A;  1V84 A;  3OH3 A;  3PNN A;  2K8R A;  2UUS A;  4I4Y A;  4IZE A;  1H5R B;  2VD4 A;  4EEA A;  3VT1 A;  3V0B A;  3IOH A;  2FGF A;  1TWM A;  2P39 A;  2NP0 A;  1PUU B;  3AKH A;  4O6N A;  2YC3 A;  4NAL A;  2ZQN A;  3SX7 A;  1HM0 A;  1ZJ0 A;  3UD9 A;  3OH2 A;  4XKI A;  5DZU A;  1JLX A;  3AZW A;  3T7M A;  3SX8 A;  2Z86 A;  2ZU9 A;  5CQL X;  4G6M A;  3WO2 A;  5D92 A;  3E25 A;  2VSI A;  3R3I A;  4D11 C;  1S0L A;  4GP0 A;  4IRQ A;  3U2T A;  3UDA A;  3R4S A;  3O4B A;  4D0Z A;  1G3L A;  2WE9 A;  4L4H A;  3AKF A;  1NMM B;  1MC3 A;  1YP3 A;  1BFB A;  3BAV A;  4X39 A;  3CKV A;  3E26 A;  4KC2 A;  4MZF B;  1Z90 A;  3I0E A;  3BCV A;  4XFT A;  3BAO A;  2ICX A;  3JUJ A;  3RSJ A;  1V6W A;  1FGX A;  1FOA A;  4Y7U A;  1JQZ A;  3VSF A;  4EE5 A;  1XYF A;  2V0K A;  3D98 A;  1CVS A;  3RTJ B;  1GX4 A;  4P0L A;  2AXM A;  4UY4 A;  1BAR A;  2D7R A;  2QYI B;  3K8D A;  4HO3 A;  1VZT A;  6I1B A;  1H4C A;  2KI4 A;  1ON6 A;  1H5S A;  5FZU A;  2P23 A;  1ZI5 A;  5DVH A;  4H04 A;  1TZF A;  4GBP A;  2RIX A;  4KEJ A;  4EFR A;  5B2H A;  3ZXD A;  1XG6 A;  3KIA A;  1SR4 A;  3NBC A;  4LO8 B;  5C49 A;  3OC9 A;  2QN4 A;  2VK9 A;  5CMI A;  3E8L C;  2I5K A;  4J2X A;  2Q9X A;  1FV3 A;  4KBB A;  2Y4M A;  1FR9 A;  1TW1 A;  4R6U B;  3CKN A;  4KC1 A;  4I4V A;  1LZJ A;  1ITB A;  4F34 A;  2OI6 A;  3BAH A;  4HO5 A;  3CKO A;  1NUN A;  4XFS A;  2FYC B;  4AAW A;  2E8B A;  3I0C A;  3FUQ A;  1TP0 A;  1H7H A;  1II4 A;  1TOO A;  3V0M A;  5BXS A;  3V91 A;  4Y7F A;  1MC9 A;  1QG8 A;  3Q7X A;  4J2Y A;  2RJ0 A;  2YC5 A;  4NAN A;  4UEG A;  3V8Z A;  5C4F A;  2VXL A;  4O6M A;  4QD2 C;  1G93 A;  4FRO A;  4I2S A;  4I6I A;  2Z48 A;  2VSA A;  3O4C A;  3OBR A;  3WO4 A;  3ZC9 A;  3ZGG A;  1G8O A;  1NKH B;  3BRG C;  2OEF A;  1Q03 A;  4B2W A;  41BI A;  1GX0 A;  4Y9X A;  4IY9 A;  1ISY A;  2GGQ A;  1JV1 A;  1V83 A;  3HAL A;  4ISR A;  2AM3 A;  4Y6N A;  5C3B A;  1FMZ A;  3VSZ A;  4D8H A;  1IIL A;  4B4B A;  4OWL A;  5FU0 A;  4EFP A;  4FCE A;  4NAK A;  1FGG A;  4CJC A;  1DIW A;  2I5E A;  3SXG A;  3UD8 A;  3VEQ A;  1ZI3 A;  4HO6 A;  2QKX A;  2D0J A;  2I7B A;  2AAI B;  4P0K A;  2V0J A;  5EJZ A;  4HJJ A;  3LW6 A;  1TW5 A;  5FZZ A;  3NGW A;  4OEG A;  3CA5 A;  1VGU A;  1ZIZ A;  4FQW A;  1M16 A;  1JT3 A;  3LLP A;  1YRO B;  2P72 A;  2Y9G A;  1ZHJ A;  1RG8 A;  2D7I A;  3AKI A;  1W3F A;  1YP2 A;  4ASY A;  1BLA A;  2NM1 A;  3IM6 A;  2AFG A;  2JCO A;  5FNW A;  3D7W B;  3OGZ A;  5CMH A;  1INJ A;  1YBI A;  5IDT A;  1IIM A;  4QD2 B;  3ILA A;  4F83 A;  2RST A;  1J0S A;  4X37 A;  1VIC A;  1NZK A;  2D24 A;  1FN0 A;  3BTA A;  4GOV A;  4M28 A;  4LO7 C;  1G9D A;  4L41 C;  2DRZ A;  1K5U A;  5D61 A;  1QQK A;  2LIE A;  3OGF A;  3T8S A;  4KEI A;  2XWN A;  2ZU8 A;  3I0J A;  2I1B A;  3K1X A;  3WA1 A;  4AN6 A;  3V0B B;  1H5S C;  4OUJ A;  3FJK A;  3I0I X;  4DEC A;  4OWK A;  1IOB A;  3P6J A;  5I1B A;  2J0B A;  3U2W A;  4KXO A;  1EV2 A;  2M49 A;  1I1B A;  1S0E A;  4G1R A;  1PZY B;  1LL0 A;  2RJ8 A;  4KQL A;  4DE7 A;  4KPZ A;  2FYA A;  1WBA A;  2IWT B;  4MZH A;  2FDB M;  4EE3 A;  1WVC A;  2VUA A;  3DJ4 A;  3BB2 A;  1GGP B;  3EE5 A;  1G95 A;  2O1H A;  3IOJ A;  1MP5 A;  5FYE A;  3T7N A;  3FUO A;  7I1B A;  1NF5 B;  2ESU A;  3CRI A;  3JUT A;  1R7Y A;  3JTJ A;  1GWV A;  1MD6 A;  3Q7U A;  3OAM A;  3U0Y A;  5IFY A;  4WBC A;  1HWP B;  4A7Z A;  4MIX A;  1KWS A;  2GZB A;  4XFU A;  1TWE A;  3PME A;  1TTU A;  3F1C A;  3OH4 A;  3C9Z A;  3MAL A;  2KI6 B;  3OKR A;  3SXD A;  4TLP A;  1T4Q A;  4ZA3 B;  4JKX B;  4FRM A;  2ZR1 B;  4Q9P A;  1ZI1 A;  4L4I A;  3OBT A;  3PUB A;  4IHZ A;  4LO7 B;  3AZV A;  3FJA A;  3I29 B;  3I0K A;  3AH2 A;  4ZFU B;  1W3G A;  3BRK X;  3KMV A;  2OEG A;  4KC3 A;  1JT4 A;  2LIQ A;  1H5S B;  4I4S A;  5FZY A;  1V6U A;  3A23 A;  4I1B A;  5BXT A;  2QH5 A;  4P00 A;  3O4A A;  1FWU A;  4KEK A;  4Q9G A;  2W0W A;  4BMA A;  3BRF A;  4I1E A;  4Q91 A;  4QKR A;  3JRR A;  3TQD A;  5E24 E;  1AFC A;  2D1Z A;  4EEE B;  4I4R A;  1OMX A;  2FFV A;  2RJ1 A;  2VS5 A;  4G3P A;  1R7X A;  1R7V A;  1GQ9 A;  2Z49 A;  2VFZ A;  2HWM A;  1YYN A;  3I2A A;  3F62 B;  2WEE A;  1HV9 A;  1I52 A;  1YXW A;  3FJJ A;  1Q04 A;  3CRG A;  4GAI A;  2RQ9 A;  3ZX7 A;  3I2X A;  5BXP A;  4JAW A;  4USO A;  1VH3 A;  4B3U A;  5C3D A;  1LVW A;  4FIX A;  1HWO B;  1S0G A;  3EF2 A;  3AJ5 A;  4FRP A;  4HO2 A;  3PG0 A;  4I4U A;  4LO3 C;  3V0A A;  2BFH A;  4LO2 A;  1MP3 A;  2VS3 A;  3H6S E;  2Y4J A;  3V0N A;  3BA4 A;  3PKQ A;  1GQC A;  5F8Y A;  2X5Z A;  5C4C A;  3AH4 A;  1WBC A;  3RTI B;  2AES A;  3RMW A;  2D44 A;  1EYL A;  1R8O A;  2XOA A;  4GP3 A;  1ZI4 A;  2QGI A;  2XME A;  1UPS A;  1BLD A;  3AJ6 A;  3BAQ A;  1BFF A;  3N7J A;  3CAH A;  5DDV A;  3CA1 A;  1ZCT A; 
#chains in the Genus database with same CATH homology
 4A7Y A;  4HA2 A;  4I7I A;  4HOC A;  2AM5 A;  4I4Q A;  3OH0 A;  3TZT A;  4USP A;  1TVY A;  5EC5 A;  1M2T B;  3HMY A;  3CU0 A;  1QWJ A;  2MIB A;  3VUO A;  1EYR A;  2W0V A;  3UJ0 A;  2Y6P A;  2ZQO A;  3A22 A;  3BAU A;  3WMU A;  3I0L A;  5CQO A;  2VSE A;  1JTC A;  4EEO A;  3BRD A;  2E4M C;  1FXO A;  3V90 A;  2YES A;  2Y9W C;  1G9B A;  1Z4S A;  4CJM A;  1VZX A;  1TFM B;  4J2K A;  4JP0 A;  4OW4 A;  1H7T A;  4H75 A;  2X2S A;  3POL A;  4Y7G A;  5BVP I;  4NAI A;  2FO1 A;  1DZD A;  1IHK A;  3I0H A;  2VXR A;  2RG9 B;  2DPW A;  2ICY A;  2V0I A;  4JQ0 A;  1ISW A;  4DEN A;  2VSH A;  1YF8 B;  2NVH A;  1XHB A;  1AVW B;  4K6R A;  3HN1 A;  1G9R A;  5CMJ A;  1FR8 A;  1W3A A;  1AVU A;  1S0B A;  3LTQ A;  3N7L A;  1OMZ A;  1HIB A;  2D20 A;  2J0A A;  3DUV A;  2AM4 A;  1FQ9 A;  2FFU A;  2OI7 A;  21BI A;  5D62 A;  1FGA A;  2ET2 A;  4GAF A;  3I0F A;  1F31 A;  1XZ6 A;  3O3P A;  2WVL A;  1OQL B;  1H7G A;  4J18 A;  1FMM S;  1WT1 A;  4EE4 A;  1K5V A;  1G0R A;  1TIE A;  3N9W A;  3ZF8 A;  2MLL B;  3ZLK A;  3UD7 A;  5BQU C;  4LW3 A;  1AVX B;  1W57 A;  2F2F C;  1ZDF A;  4HR6 C;  1ILR 1;  3V0Q A;  4ZFY B;  4C2S A;  5C48 A;  2IHO A;  1G9C A;  1FV2 A;  1YP4 A;  2BO7 A;  1PUM B;  3OJV A;  3USQ A;  3O4D A;  5FNX A;  1R82 A;  1FG5 N;  2HW9 A;  2NZ9 A;  2GO2 A;  4I96 A;  2JCJ A;  3FGM A;  5BXC A;  4LO1 C;  2BO6 A;  3VT2 A;  1S0C A;  3SPT A;  1WSZ A;  5AJP A;  3Q7Y A;  4E1K A;  4LO2 C;  4G87 A;  1JT5 A;  3CA4 A;  1JT7 A;  1ON8 A;  1HM9 A;  2PA4 A;  2Z87 A;  3JUK A;  2BEB A;  2OI5 A;  1H7E A;  1VCL A;  1T9F A;  3FJF A;  3IAG C;  4LO3 A;  1FO8 A;  1LZI A;  4DCK C;  4QBC A;  5EIY A;  1Z0H A;  3NJ5 A;  4X38 A;  4ISQ A;  2C0N A;  1R80 A;  3DK5 A;  4B42 A;  2KH2 A;  3Q4S A;  4FRQ A;  4JRA A;  2HWA A;  2Y9F A;  2YCM A;  4DEP A;  2WBC A;  3S8K A;  1ZJP A;  4Y62 A;  3FOQ A;  3V0P A;  5CMG X;  2PGY A;  3NBD A;  3FJC A;  2O1F A;  3K8E A;  3VT0 A;  2CU2 A;  5CQM X;  2FYB A;  4LO0 C;  4HO0 A;  2ZU7 A;  3QYD A;  1ONK B;  5I1F A;  4G9M A;  4ZLB B;  4R7P A;  4ZFW B;  1IIN A;  5C1G A;  4EB2 B;  4OWJ A;  3N0K A;  1FO9 A;  5BXR A;  2E4M A;  1V82 A;  1FWY A;  2AE7 A;  1IT0 A;  4D48 A;  5FV9 A;  4IYB A;  1FRW A;  1LL3 A;  4FIY A;  4DDZ A;  2HZ9 A;  1FXJ A;  2XWL A;  1XZZ A;  4JKQ A;  1YTO A;  1INI A;  4HO8 A;  3V0A B;  1D0H A;  5F8W A;  2RJ4 A;  1LZ0 A;  3P53 A;  2BEA A;  1Z2V A;  4GOY A;  3SXA A;  1ISV A;  1HWN B;  1JVG A;  1KNM A;  3ZC8 A;  1DQO A;  2DS0 A;  3FJH A;  1PC8 B;  1PZZ A;  1G1L A;  2V0H A;  1H3M A;  4EEM A;  4MYB A;  4QC4 A;  4QBV A;  4KRV A;  4HG6 A;  4B2X A;  4EVW A;  2VU9 A;  4ZDQ A;  2L5X A;  1QGQ A;  1ZCV A;  3FJI A;  5C38 A;  4Z8S B;  1HJL A;  1HCE A;  4B5B A;  1DFQ A;  1SS9 A;  1ZCU A;  4H9W A;  1H7F A;  2VXM A;  1DZC A;  5BQU A;  3AH1 A;  5F8S A;  1R7T A;  1ZJ1 A;  2F2F A;  2FY7 A;  2Y4L A;  5FUH A;  4AYL A;  1AXM A;  1BFG A;  1QQL A;  2AGD A;  4FRB A;  3U2V A;  1RZO B;  1H5T B;  1JVD A;  4X3A A;  5C4E A;  1ZJ2 A;  5BP5 A;  3SX5 A;  4I8M A;  2MC2 A;  1S4O A;  31BI A;  4JPZ A;  1W77 A;  2Q4J A;  1K4V A;  4I3N A;  2WVM A;  1MP4 A;  4OEF A;  3FJD A;  4G3Q A;  4LO1 A;  3PHZ A;  4D0T A;  3QVB A;  3CKJ A;  3V79 C;  3IIR A;  2X65 A;  1DLL A;  2YQC A;  5C36 A;  1WD3 A;  4ZBV B;  3CKQ A;  1RML A;  5EG6 C;  3WIN A;  1G2V A;  1G97 A;  3NBE A;  4I37 A;  4JD0 A;  2NS2 A;  3FJ8 A;  1RY7 A;  2A8W A;  1VH1 A;  1IJT A;  3FFZ A;  4YS8 A;  3IM5 A;  4P6A A;  2RIY A;  2RJ7 A;  4ASJ A;  1JYK A;  3H6R B;  3FWW A;  1VGZ A;  3IM7 A;  4M2B A;  2YQH A;  2J3P A;  4KNX A;  1AF9 A;  4G9N A;  2V0L A;  3CQA A;  1JV3 A;  1E5K A;  3O44 A;  2D23 A;  5L6V A;  4OEE A;  4KC4 A;  4B4G A;  4Y63 A;  3T7O A;  4FVV A;  5D63 A;  1DJS B;  1S0D A;  4LO0 A;  2JCK A;  4FRL A;  3FJB A;  3D8V A;  3SXB A;  5L6S A;  3SNV A;  4PC4 A;  5DUY A;  1H4D A;  4ARW A;  1VPA A;  3U2X A;  1Q1U A;  2APC A;  1H5T A;  4HCQ A;  5JQQ A;  1BAS A;  2RJ9 A;  2BO4 A;  4QO3 A;  2NXV A;  5D91 A;  2XWM A;  2Q3N B;  1IRP A;  3R4U A;  1W55 A;  4IZX A;  2X2T A;  3N7M A;  1ZCY A;  1BFC A;  3BAD A;  2F8X C;  1VGT A;  2KKI A;  3CU1 B;  4HO9 A;  1R8N A;  1H5R A;  5C4D A;  3VWC A;  1WT2 A;  1CE7 B;  5FTV A;  3RSB A;  5DDT A;  4I4O A;  1GA8 A;  5BOW A;  4Q7C A;  3HBW A;  2E3D A;  1JY0 A;  4CJ8 A;  3V8Y A;  3B9U A;  4ZKT B;  1H4E A;  1V6X A;  2VLC A;  5CMF X;  3HOM A;  9ILB A;  5CQP A;  1ZDG A;  5CQN X;  1O7Q A;  5FU8 A;  5DSS B;  3H6R A;  5AJN A;  3RMV A;  3ZXG A;  2AEC A;  3TC2 A;  2A8U A;  3HSM A;  5HPZ A;  3QR5 A;  3WO3 A;  2WRY A;  3CGX A;  3PKP A;  2WGZ A;  4EEG A;  1N4K A;  5BP5 C;  3I0D A;  3POK A;  3SXC A;  3V0O A;  3O3Q A;  1WD4 A;  3W9T A;  3GUE A;  3F1R A;  1I1E A;  4ZGR B;  3ZGF A;  1VGW A;  1ZJO A;  1S4P A;  2ERM A;  4FRD A;  1O7O A;  5EJ1 A;  3A21 A;  4Y7V A;  3N7K A;  2MZB A;  3O5W B;  1HM8 A;  4ZOT A;  3OH1 A;  4JIS A;  3H6Q A;  2FYD B;  1DFC A;  4J23 B;  1GWW A;  3CRH A;  2WVK A;  1HCD A;  1ISX A;  3P6I A;  3BA5 A;  3WIN C;  4P0J A;  1NHE B;  2RIZ A;  4AC3 A;  2PX7 A;  2VS4 A;  2O1G A;  4II0 A;  3Q80 A;  1JLY A;  4MZG B;  3CA0 A;  4CJB A;  4AN7 B;  5IDS A;  1ZJ3 A;  3I0G A;  1VZU A;  1QXM A;  2R9K B;  3AKG A;  1DQG A;  4G3S A;  1LZ7 A;  4J2S A;  5JMC A;  4I0Y A;  2AH9 A;  1WT0 A;  2P73 A;  2X5S A;  2UX8 A;  3D5N A;  4BQH A;  2Y4K A;  4A7K A;  5C1L A;  4Y7T A;  2X60 A;  1PWA A;  2KLL A;  4EKX B;  4QKS A;  4END A;  1QGS A;  4FCU A;  4KNR A;  4AYJ A;  2JCL A;  3Q7W A;  4G6J A;  4ECM A;  3HL3 A;  1HJJ A;  1O0R A;  2K4A B;  2D43 A;  4D11 A;  4CVH A;  4YOL A;  3U2U A;  5EHA A;  3FJE A;  4LW6 A;  1HKN A;  8I1B A;  3SXE A;  1G23 A;  1HWM B;  4I4X A;  1AVA C;  1IRA X;  4I4P A;  2RIT A;  4M2A A;  3RMX A;  5C3A A;  1EZI A;  3RMY A;  1G82 A;  4Y6U A;  1L2H A;  3OJ2 A;  4IQP A;  4FGF A;  2GGO A;  1H7Q A;  1ABR B;  1WT3 A;  2YQS A;  4B4M A;  5J49 A;  5C8R A;  2PGV A;  4IY8 A;  4EFQ A;  5F90 A;  1E0O A;  3CA6 A;  4QAL A;  2NYY A;  1R81 A;  3ZLL A;  1SR4 C;  5HS2 A;  1V6V A;  1PZT A;  3F1Y A;  2Y7A A;  4FRH A;  4HO4 A;  4MND A;  4XWI A;  1P63 A;  1VM8 A;  4Y64 A;  5AJO A;  5C4B A;  1G9A A;  1BA7 A;  3BAG A;  1A8D A;  3S8J A;  5C47 A;  1OQM B;  4KT7 A;  3ST8 A;  5JLV A;  2YQJ A;  1JYL A;  1EPW A;  4Z9W B;  1H7L A;  3NBN A;  4FRE A;  1NQI B;  2RJ5 A;  1ISZ A;  4KPX A;  1SZ6 B;  3USR A;  3U0X A;  2NTD A;  2P6W A;  3A07 A;  3MPP G;  1H5S D;  3R2W A;  3O49 A;  2DRY A;  3BA7 A;  1LL2 A;  1O23 B;  4M4K A;  2RJ6 A;  1R7U A;  1S4N A;  3OJM A;  2AQZ A;  5C1H A;  4ION A;  3WMV A;  2DRE A;  3IOI A;  2XMH A;  4P02 A;  3SX3 A;  2VXT I;  3FJ9 A;  3O4O A;  1FZW A;  4FRA A;  2K43 A;  4IRP A;  3UJ4 A;  1FWV A;  5G00 A;  5GAQ A;  5FTS A;  1EVT A;  3V0L A;  3BX1 C;  1NWG B;  1S0F A;  2D22 A;  3CA3 A;  2Y9X E;  2YUG A;  2BO8 A;  2WAW A;  3OGG A;  1V84 A;  3OH3 A;  3PNN A;  2K8R A;  2UUS A;  4I4Y A;  4IZE A;  1H5R B;  2VD4 A;  4EEA A;  3VT1 A;  3V0B A;  3IOH A;  2FGF A;  1TWM A;  2P39 A;  2NP0 A;  1PUU B;  3AKH A;  4O6N A;  2YC3 A;  4NAL A;  2ZQN A;  3SX7 A;  1HM0 A;  1ZJ0 A;  3UD9 A;  3OH2 A;  4XKI A;  5DZU A;  1JLX A;  3AZW A;  3T7M A;  3SX8 A;  2Z86 A;  2ZU9 A;  5CQL X;  4G6M A;  3WO2 A;  5D92 A;  3E25 A;  2VSI A;  3R3I A;  4D11 C;  1S0L A;  4GP0 A;  4IRQ A;  3U2T A;  3UDA A;  3R4S A;  3O4B A;  4D0Z A;  1G3L A;  2WE9 A;  4L4H A;  3AKF A;  1NMM B;  1MC3 A;  1YP3 A;  1BFB A;  3BAV A;  4X39 A;  3CKV A;  3E26 A;  4KC2 A;  4MZF B;  1Z90 A;  3I0E A;  3BCV A;  4XFT A;  3BAO A;  2ICX A;  3JUJ A;  3RSJ A;  1V6W A;  1FGX A;  1FOA A;  4Y7U A;  1JQZ A;  3VSF A;  4EE5 A;  1XYF A;  2V0K A;  3D98 A;  1CVS A;  3RTJ B;  1GX4 A;  4P0L A;  2AXM A;  4UY4 A;  1BAR A;  2D7R A;  2QYI B;  3K8D A;  4HO3 A;  1VZT A;  6I1B A;  1H4C A;  2KI4 A;  1ON6 A;  1H5S A;  5FZU A;  2P23 A;  1ZI5 A;  5DVH A;  4H04 A;  1TZF A;  4GBP A;  2RIX A;  4KEJ A;  4EFR A;  5B2H A;  3ZXD A;  1XG6 A;  3KIA A;  1SR4 A;  3NBC A;  4LO8 B;  5C49 A;  3OC9 A;  2QN4 A;  2VK9 A;  5CMI A;  3E8L C;  2I5K A;  4J2X A;  2Q9X A;  1FV3 A;  4KBB A;  2Y4M A;  1FR9 A;  1TW1 A;  4R6U B;  3CKN A;  4KC1 A;  4I4V A;  1LZJ A;  1ITB A;  4F34 A;  2OI6 A;  3BAH A;  4HO5 A;  3CKO A;  1NUN A;  4XFS A;  2FYC B;  4AAW A;  2E8B A;  3I0C A;  3FUQ A;  1TP0 A;  1H7H A;  1II4 A;  1TOO A;  3V0M A;  5BXS A;  3V91 A;  4Y7F A;  1MC9 A;  1QG8 A;  3Q7X A;  4J2Y A;  2RJ0 A;  2YC5 A;  4NAN A;  4UEG A;  3V8Z A;  5C4F A;  2VXL A;  4O6M A;  4QD2 C;  1G93 A;  4FRO A;  4I2S A;  4I6I A;  2Z48 A;  2VSA A;  3O4C A;  3OBR A;  3WO4 A;  3ZC9 A;  3ZGG A;  1G8O A;  1NKH B;  3BRG C;  2OEF A;  1Q03 A;  4B2W A;  41BI A;  1GX0 A;  4Y9X A;  4IY9 A;  1ISY A;  2GGQ A;  1JV1 A;  1V83 A;  3HAL A;  4ISR A;  2AM3 A;  4Y6N A;  5C3B A;  1FMZ A;  3VSZ A;  4D8H A;  1IIL A;  4B4B A;  4OWL A;  5FU0 A;  4EFP A;  4FCE A;  4NAK A;  1FGG A;  4CJC A;  1DIW A;  2I5E A;  3SXG A;  3UD8 A;  3VEQ A;  1ZI3 A;  4HO6 A;  2QKX A;  2D0J A;  2I7B A;  2AAI B;  4P0K A;  2V0J A;  5EJZ A;  4HJJ A;  3LW6 A;  1TW5 A;  5FZZ A;  3NGW A;  4OEG A;  3CA5 A;  1VGU A;  1ZIZ A;  4FQW A;  1M16 A;  1JT3 A;  3LLP A;  1YRO B;  2P72 A;  2Y9G A;  1ZHJ A;  1RG8 A;  2D7I A;  3AKI A;  1W3F A;  1YP2 A;  4ASY A;  1BLA A;  2NM1 A;  3IM6 A;  2AFG A;  2JCO A;  5FNW A;  3D7W B;  3OGZ A;  5CMH A;  1INJ A;  1YBI A;  5IDT A;  1IIM A;  4QD2 B;  3ILA A;  4F83 A;  2RST A;  1J0S A;  4X37 A;  1VIC A;  1NZK A;  2D24 A;  1FN0 A;  3BTA A;  4GOV A;  4M28 A;  4LO7 C;  1G9D A;  4L41 C;  2DRZ A;  1K5U A;  5D61 A;  1QQK A;  2LIE A;  3OGF A;  3T8S A;  4KEI A;  2XWN A;  2ZU8 A;  3I0J A;  2I1B A;  3K1X A;  3WA1 A;  4AN6 A;  3V0B B;  1H5S C;  4OUJ A;  3FJK A;  3I0I X;  4DEC A;  4OWK A;  1IOB A;  3P6J A;  5I1B A;  2J0B A;  3U2W A;  4KXO A;  1EV2 A;  2M49 A;  1I1B A;  1S0E A;  4G1R A;  1PZY B;  1LL0 A;  2RJ8 A;  4KQL A;  4DE7 A;  4KPZ A;  2FYA A;  1WBA A;  2IWT B;  4MZH A;  2FDB M;  4EE3 A;  1WVC A;  2VUA A;  3DJ4 A;  3BB2 A;  1GGP B;  3EE5 A;  1G95 A;  2O1H A;  3IOJ A;  1MP5 A;  5FYE A;  3T7N A;  3FUO A;  7I1B A;  1NF5 B;  2ESU A;  3CRI A;  3JUT A;  1R7Y A;  3JTJ A;  1GWV A;  1MD6 A;  3Q7U A;  3OAM A;  3U0Y A;  5IFY A;  4WBC A;  1HWP B;  4A7Z A;  4MIX A;  1KWS A;  2GZB A;  4XFU A;  1TWE A;  3PME A;  1TTU A;  3F1C A;  3OH4 A;  3C9Z A;  3MAL A;  2KI6 B;  3OKR A;  3SXD A;  4TLP A;  1T4Q A;  4ZA3 B;  4JKX B;  4FRM A;  2ZR1 B;  4Q9P A;  1ZI1 A;  4L4I A;  3OBT A;  3PUB A;  4IHZ A;  4LO7 B;  3AZV A;  3FJA A;  3I29 B;  3I0K A;  3AH2 A;  4ZFU B;  1W3G A;  3BRK X;  3KMV A;  2OEG A;  4KC3 A;  1JT4 A;  2LIQ A;  1H5S B;  4I4S A;  5FZY A;  1V6U A;  3A23 A;  4I1B A;  5BXT A;  2QH5 A;  4P00 A;  3O4A A;  1FWU A;  4KEK A;  4Q9G A;  2W0W A;  4BMA A;  3BRF A;  4I1E A;  4Q91 A;  4QKR A;  3JRR A;  3TQD A;  5E24 E;  1AFC A;  2D1Z A;  4EEE B;  4I4R A;  1OMX A;  2FFV A;  2RJ1 A;  2VS5 A;  4G3P A;  1R7X A;  1R7V A;  1GQ9 A;  2Z49 A;  2VFZ A;  2HWM A;  1YYN A;  3I2A A;  3F62 B;  2WEE A;  1HV9 A;  1I52 A;  1YXW A;  3FJJ A;  1Q04 A;  3CRG A;  4GAI A;  2RQ9 A;  3ZX7 A;  3I2X A;  5BXP A;  4JAW A;  4USO A;  1VH3 A;  4B3U A;  5C3D A;  1LVW A;  4FIX A;  1HWO B;  1S0G A;  3EF2 A;  3AJ5 A;  4FRP A;  4HO2 A;  3PG0 A;  4I4U A;  4LO3 C;  3V0A A;  2BFH A;  4LO2 A;  1MP3 A;  2VS3 A;  3H6S E;  2Y4J A;  3V0N A;  3BA4 A;  3PKQ A;  1GQC A;  5F8Y A;  2X5Z A;  5C4C A;  3AH4 A;  1WBC A;  3RTI B;  2AES A;  3RMW A;  2D44 A;  1EYL A;  1R8O A;  2XOA A;  4GP3 A;  1ZI4 A;  2QGI A;  2XME A;  1UPS A;  1BLD A;  3AJ6 A;  3BAQ A;  1BFF A;  3N7J A;  3CAH A;  5DDV A;  3CA1 A;  1ZCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...