2FGOA

Structure of the 2[4fe-4s] ferredoxin from pseudomonas aeruginosa
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
81
structure length
81
Chain Sequence
SLKITDDCINCDVCEPECPNGAISQGEEIYVIDPNLCTECVGHYDEPQCQQVCPVDCIPLDDANVESKDQLMEKYRKITGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the 2[4Fe-4S] ferredoxin from Pseudomonas aeruginosa at 1.32-A resolution: comparison with other high-resolution structures of ferredoxins and contributing structural features to reduction potential values.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Ferredoxin
total genus 14
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fgoA00
1IR0A 1GT8A 1PC5A 1Y5LB 3IR5B 1FRIA 3IR7B 1Y5IB 3PNIA 4L6V3 1JNZB 1FRMA 4DHVA 3MMCA 1BC6A 2XSJB 2WAQD 1G6BA 3C8YA 3MM8A 1F5BA 3OR2A 2VPXB 2FD2A 1FDDA 1SIWB 1FEHA 4XDDA 2UZAA 2FJBB 2C3OA 1D3WA 1DURA 1FRJA 1G3OA 2C3YA 1DFDA 1C4CA 2FDNA 1FERA 1GAOA 1FTCA 2V4JA 1BLUA 1FXRA 1R27B 1Y5NB 1DAXA 2PA8D 1A6LA 2C42A 3HKZD 3MM6B 3MM7B 1KEKA 4YDDB 1IQZA 2VPZB 1JNRB 2GMHA 1B0TA 5BYRA 2FJDB 2Z8QA 2WB1D 3MM9B 1Y4ZB 5CH7B 1FD2A 2VPWB 5BYSA 4XK8C 1FDNA 1FRKA 1H7XA 1H7WA 1KQFB 1ROFA 6FDRA 1F2GA 3OR1A 3MMBA 1C4AA 3MM5B 1Q16B 3EGWB 3MMAA 2FJEB 2VKRA 1GTHA 1FRLA 2C3UA 1SIZA 1FDAA 2GMJA 4Y28C 1FDBA 1KQGB 2PDAA 4XDCA 2WSEC 5FD1A 7FD1A 2WSCC 4AYBD 5E7OB 1F5CA 2O01C 3MMCB 2XSJA 2C3MA 1GTEA 1SJ1A 2PMZD 1BWEA 3EUNA 3MM8B 3LW5C 4CI0B 3GYXB 3OR2B 1H98A 4KT0C 1FRXA 1CLFA 4OV1A 1FF2A 1K0TA 1FXDA 2V4JB 2ZVSA 1PC4A 1VJWA 4OMFG 1AXQA 1H0HB 2Y0SD 3MM6A 1FCAA 3MM7A 1B0PA 1XERA 2FJAB 1HFEL 2C3PA 1BQXA 4ID8A 1JB0C 1WTFA 5BYQA 6FD1A 3MM9A 1RGVA 5CHCB 1B0VA 3EXYA 2IVFB 2FGOA 5L8RC 3IR6B 1FRHA 1BD6A 3MMBB 3OR1B 2V2KA 3MM5A 3MMAB 2VPYB 4RKUC 7FDRA 2WSFC
chains in the Genus database with same CATH superfamily
3NRBA 1Q1KA 2QN6B 4PG8A 2VQFF 3QO9B 4RBUA 1YI2S 1FRIA 1C0UB 1H6KX 3D6FB 4NASA 4PUOB 3FMWA 3BO3A 5DG7A 2UUAJ 2XM3A 3LGNA 1BC6A 2DGVA 2M5YA 2E1PA 2VHGA 4KTQA 1GK8A 2GGPA 2HHWA 1KFSA 2XC9A 3VAKA 5FJ4A 2XYHB 2Q43A 4A47A 1S9GA 2RH3A 5HVFA 1NK9A 4GKJJ 3A8EA 4HTIA 1RZMA 1Q8LA 2ZH8A 4NMXA 4QU6A 5G0RB 3G6VA 2APOA 1DJ0A 2C3OA 1FRJA 2MLXA 3GV8B 4JBCA 2DGUA 2FDNA 5JJBA 1Q8BA 2CPDA 5C24A 3WBZA 2UUBJ 3HXMA 4LF7J 3DC2A 1FXRA 1NKBA 3I56S 3MEGA 1L5UA 1A6LA 1QUPA 3HKZD 1N54B 1NSPA 2RU9A 1IQZA 3MGJA 4NL5A 1Y9OA 1IKWA 1WHWA 2EFOA 3IM8A 4CLFA 5GAGU 4DQIA 2ZITA 1VQMS 3PRVA 3UE2A 4MKYA 1D8ZA 2BRKA 4O3SA 1FJGJ 5BYSA 2RE1A 2ALYB 4XK8C 4EEYA 2XMAA 5LMNJ 1YIJS 2VASA 2CQ1A 2QGFB 3B8HA 4O44A 4PG4A 1VRQC 1UZDA 4AL6A 4P73A 4AL5A 3DLEA 1X9SA 1UEUA 1UFKA 2GA7A 1C1BA 2RJZA 1HNIA 2HVDA 4ED8A 1Q79A 2DEIA 4DR7F 3L7PA 4F36A 2KG1A 2AX1A 2B51A 8RUCA 1XQIA 3TUJC 3C16A 2KL8A 1RACB 1RT5A 3FSYA 3K57A 1NPPA 3MCOA 4MYUA 3TRGA 1VCTA 4I6AA 2PDAA 2JL9A 4XDCA 2K1RA 1WC3A 3ZO7A 1F3VA 1SC1B 1SC3B 2Q3PA 4PYDA 3WHIA 3KHLA 1JXEA 1WHYA 4LVNP 3W1YC 5KFQA 3F73A 4XO0A 1VBYA 2FJWA 3Q2TC 2XO7A 1HWJA 2CJ9A 4ETZA 1GX5A 3LO3A 1SJ1A 4DR4J 4X4OA 4IUFA 4G1QA 3OL7A 1R8PA 2GIRA 3MCSA 3CC2S 2H9ZA 4R5PB 4LF4J 5K20B 3EGVA 4CLZA 5F8GA 1S6PA 3EJMA 4ECUA 1VQ8S 3IAS9 2ACMA 2AEJA 1S4EA 1PJ5A 4E2FB 1ITPA 3R5DA 1PSDA 2NSBA 3V6KA 4B08A 1S9FA 1AT1B 2RB7A 4HHHA 1T9YA 2ZHAA 1WC5A 3WC2A 2EVZA 2R7XA 1H0HB 2YNIB 5C25A 3C6TA 4X65F 3MM7A 3MPVA 1CS4A 1N6QA 1TMJA 4DU7A 2HHVA 3J7Z5 3HJVA 1TR0A 1KVKA 2C3PA 3ZTOA 1G7CB 2VF3A 2ZUAA 5DETA 3DHXA 4I67A 1HBNB 1T9UA 1VQOS 2BZ2A 3ZZ0A 3X1LB 4KQZA 3PIPQ 3MCMA 1VDHA 3EMTA 2DHXA 3KG0A 4RR5A 4AD6A 4YUDA 2QMWA 1RWUA 1S4FA 1SV5B 4TLRA 5L8RC 1ZTWA 5KOWA 2YNFA 1EKRA 3OR1B 3IC1A 5EDWA 3V6DA 1XR5A 3GJRB 4DPWA 1WD6A 2VKZG 2X3GA 4TQRA 4F2SA 4KHPF 1IM4A 3L9ZA 4JI7J 3KMSA 3QLHA 1Q95G 3AXMA 1OWXA 4UQGA 5F8MA 2DHAA 9RUBA 1OSCA 4DV1J 4B3OB 4DSIA 1H2TZ 1GMVA 1Y5IB 3TOQA 2H54B 3S1TA 3HVRA 2CQBA 3I9ZA 3M8QA 3TW0A 4ECVA 3T1HJ 4QW8A 3W9IA 2PMHA 3RB4A 1U26A 2DTJA 2B3TB 2FLLA 3LWLA 1RWWB 3FNNA 3JSYA 3V81B 3DU6A 2QJ3A 4GO5X 3RYLA 5BR8J 4KPCA 2CPHA 2I1RA 3PR4A 4Q0BA 2GS8A 4LF5J 1FDDA 2I6WA 1R0AA 3OSPA 3IFEA 5D6GA 3PKYA 1GMWA 4ZPTR 4GKKJ 3CD0A 1AROP 4NA2A 3GMGA 4EMDA 1J27A 1FERA 5ETLA 3M8RA 4KO0A 3BGRB 1S6UA 3MAAA 3NWRA 3Q0AA 4F4YA 2CG8A 1JJCB 3MM6B 2RDIA 5DDQC 1KOOA 2CQGA 4YDDB 2R2SA 4YOEA 4ZPWR 4KKOB 2J7WA 3GG0A 4OJGA 3R97A 4QIWD 4MK9A 4DR1F 3KXDA 3VAIA 2QEXS 3ENQA 1Z4UA 1Y4ZB 1RTHB 4H4MB 4CLSA 2AWZA 2YKMB 1DQAA 3EGNA 3MDFA 3SDEB 4EO6A 1AUDA 3RRGA 1S99A 4OI6A 4NI2B 2GVZB 2ASJA 4LF9J 4OHYA 1CJUA 1EJ7L 5DDOC 3PZPA 3PFEA 1B70B 1DARA 3FSXA 1QAJA 4F4KA 4S0MA 4JI6J 3DRSB 3ZZPA 1N5QA 3NGDA 3VVTA 3OL6A 1QTNB 1JLFA 1WUUA 1ZA1B 3A3NB 1FWLA 1HR0J 2PIIA 1JIHA 4LRFA 2CJXB 4B9VA 3W2WB 3M05A 3S01A 1UMJA 3TAPA 3BR9A 3B54A 1ZZFA 4L3NA 4M5JA 1IN0A 3QYYA 4AFFA 4ATNA 1VFJA 2IY5B 2OPPA 1FDBA 2IC3A 4WFBQ 3KJQB 3GIKA 1JLBB 4FYXB 3B78A 3FK4A 3CCQS 3LP0B 1Q82T 2DRBA 3DM2B 4K0KF 2VOPA 1RA6A 3LALA 5GMKa 4NXNJ 2WRMA 4RUCA 1H73A 4YMEA 3SQOP 4PXCA 2BJDA 1KLNA 4N56A 1URNA 2LXFA 2OKQA 4IG3B 4OYXA 5KFDA 3OTOJ 3NNCA 2H1YA 2J7KA 2WW4A 3HP6A 3OJUA 2O66A 4ZLLA 1R7IA 3A8JA 4NLQA 3W3SA 5F8JA 5KG0A 2UVUA 4KHRA 4DBQA 4XTTA 3ISZA 1PCAA 1RT6A 2ZOGA 4DL0C 2MGZB 1TFWA 1K0TA 1ZYQA 1YK9A 2VJVA 4JI1F 4DX5A 2QL5B 2XS2A 2QMXA 1S1UA 2DYAA 2HHUA 4D3GA 1VJWA 2KH9A 2ZC4A 2DNYA 1K1SA 2QTWA 2GJ2A 2KTQA 2HGMA 3SMZA 1FHTA 1R8BA 3DFEA 2VDIA 3DYAA 1JB0C 4LVOP 2L9DA 4E8UA 3VVUA 3PR5B 1NDCA 4I6YA 3QQCD 4RBVA 4YB1P 5IZHA 5ETNA 4ED6A 3NS7B 4LBIA 2K7JA 4B02A 1PJ7A 3CB4A 1BD6A 4DPUA 1RU2A 3HFKA 4NLUA 2NUHA 2LXUA 2HRTA 2ZZTA 2OMLA 3GIIA 3I55S 4ECYA 1N34J 4EZ6A 3K2YA 5K5MA 4F4AA 2OIHA 4LQ3A 2HKEA 3HHLA 1HBOA 1LWEA 2BOPA 1IR0A 3KG4A 1H72C 4JV0A 2Y8WA 2H51B 1RLDA 4MYTA 1NDPA 3TUZC 3R5BA 3BH6B 2Y1IA 3P3DA 3UR3C 3HFVA 3KNGA 2OELA 1FRMA 3PCOB 5GAEI 2FHKA 3HVAA 4CLLA 3KK2A 2J6SA 1RT2B 4I2PB 4KE5A 3MMCA 3SCKE 3M6UA 2P8IA 5G4DA 4DG1A 3TEHB 1NLKL 3OLAA 3QJPA 3CCRS 2LEAA 1O51A 4PYAA 4O23A 4DX6A 1OO0B 1WEYA 2KT2A 3CWJA 4WK3A 4MH8A 4RJVA 3TA0A 5GMDA 2I5JA 5CA5A 1FEHA 5CABA 5A8KA 3KUHA 4NRUA 4KHPJ 4ZK7M 4MKBA 2C3YA 2ZJRQ 5HO4A 5DM6Q 2BEFA 1G2EA 1HKAA 5JXSA 5KG6A 4PR6A 5CYMB 2GIFA 4DV1F 4DR5F 4PWDB 3H5UA 4WTYA 2ROGA 4A48A 3A13A 2KHCA 1UVIA 1KHVA 2DH9A 5CXTA 3GV7B 4OLPA 1OJ4A 3LUYA 4FYVB 1BHNA 3U1MA 2ROPA 4RUBA 4IG0A 1OQ6A 4KC5A 4RPFA 3GCXP 3PO5A 3BQ0A 4Q8EA 3OVAA 1LK5A 1KTVA 1VIXA 2XHWA 2OPSA 3AA8A 3BYRA 4ITSA 5ETQA 4DXLA 1FJGF 2CPXA 3N5FA 3JS9A 4FF3A 4KGKA 3CCVS 1KVJA 1Q8KA 1KBRA 2Z2LA 3DI6B 3N28A 2VFRA 3OT9A 2HVEA 2MEWA 5EX0A 2AKWB 2P6TA 4V1Ak 2DGQA 4KIAA 3V2UC 5J1EA 2N82B 4RU2A 1UPPA 2IAJB 2MKJA 1J5EJ 4BBYA 4FXVA 2CNLB 5HP1A 3I4HX 1Q8IA 4ZVEA 3MAHA 1T9TA 1GTHA 2XCAA 1JKHB 4OZ0A 3FZ2A 5F3ZA 1HI1A 2QYCA 3ENVA 2DXFA 2MKCA 2RKIA 2ZVIA 4HH1A 4C11B 2MLYA 2IBKA 3PJWA 1V9OA 3FMBA 5ETPA 1FESA 1Z2ZA 4PUOA 2LXIA 3KJNB 2HFUA 2HFZA 2BUNA 1TK0A 5CAAA 4DV0F 5E7OB 1S1VB 4CM0A 4BWMA 4WFYA 4Y65A 4DPYA 3K8WA 3KLHB 4LFBJ 1RCXB 1GXLA 2MJNA 2NUUG 2YPYA 2FZGB 1RWXB 2YQ0A 1O0PA 2YTCA 4DX8H 3DN9A 4DUZF 1TL1A 1EX8A 4DUYF 1RBOB 2FQQB 4M1KA 3TJAA 2BX6A 5I3UB 2I9SA 5EHHA 4R8UB 1MWYA 1U25A 1UJ4A 3SIPB 4ES2A 4RZRA 3KLGB 2VBZA 2UXDJ 3QMQA 2HNZA 2HZCA 3OTDA 1N5YB 3WX4A 1CJKA 2DGOA 1O8BA 5KFLA 1MWQA 4WZQA 3BKTA 3QT5A 5C24B 3PW4A 3W8GA 1KC8T 1VQ6S 2JEGA 1OY9A 2DGTA 2OTLS 3B4DA 3CD5A 3AH6A 4BWJA 2N3OA 2LQJA 2NPIA 3GIMA 2D3OR 1CULB 3THTA 4URGA 2F1FA 3NGKA 1XERA 2FJAB 1WSRA 4P72A 3FGVA 1JLEA 3MUTP 1FNMA 5H1SV 3CCLS 3RB6A 1T05A 5EWFA 3CJTA 3QJLA 3ZFVA 2OFHX 5EWGA 1OQ3A 1S0OA 3ZZOA 1QSYA 3AOAA 3HHNB 3FZBA 1WOSA 4OX9F 4NA3A 5GAEU 1B0VA 5T41A 1SJFA 2HBZB 2XMTA 1TV6A 2E44A 4O44B 3T9NA 1S6OA 3KUGA 4KJIA 4Y00A 5L39A 1HPZB 2HK2A 3FQKA 2AEMA 3BR8A 1C1BB 3UO0A 2IRXA 3HMJG 2XS5A 1RAHB 5H9FK 1SH0A 4RW9A 1DHMA 1DY3A 3VQTA 1S97A 3TI0A 4QU7A 3FRYA 1L3KA 3SI8A 4QIEA 4KH0B 3POTA 4Q2LA 5KG4A 2SXLA 2FY8A 4JI3F 2QFIA 4I68A 3W61A 3RAXA 3IG1B 4PEOA 2RNEA 4N77A 1JNZB 3DGPA 1TAQA 3W60A 5LXRA 5D0HA 1RAEB 4QWBA 2O3DA 2YWFA 5EUHA 2ZOFA 1TP7A 5F0UA 4L74A 1S72S 2D1CA 3CULA 1N32F 2W7OA 4NCBA 3K5OA 3S7RA 4DV6J 5ETTA 2J0XA 4ANEA 5EGYA 3QGPA 4DLGA 4DFKA 2HMIB 4IR1A 2NREA 3NNHA 3O8WA 2JLFA 2YNGA 1S6PB 2POKA 2G9OA 2WHOA 2XULA 4TXSA 4I64A 3KNAA 2CYYA 4KRWA 4J9QA 4GKJF 2GMLA 2JOQA 2AZ3A 5F8NA 1G3OA 3GJSB 1FFSB 4M5HA 1F5AA 2CQHA 2R42A 3M4XA 5KFSA 3G8SA 3KKFA 1RWKB 3RBZA 2R4FA 3VAFA 3O44A 1HI8A 3JQJA 2Z30B 4GVBB 5C25B 3MR3A 2ZH4A 1FXLA 1CS4B 3IBCB 1UJ5A 2QA4S 2OSQA 1RWVB 4BCAA 1CQNA 5LSLA 1I3OB 2IHR1 5LSRA 1YJUA 1NSQA 4HYKA 2OP5A 1VQNS 5KFKA 3QATA 4Y2CA 2X7IA 3OHAA 5IC4B 4K4TA 5ETOA 4L72B 3K5LA 2VL1A 1MNEA 3FUYA 3MR5A 3HVWA 1AA1B 1FDNA 6AT1B 1SUQB 3US5A 2EG2A 2HQ3A 5C2CA 5ITHA 4RW7A 1T8EA 5IT9Y 3ZNUA 2XMVA 1UA1A 1SV5A 1FI4A 2I8EA 4WZMA 2ZBCA 2GFFA 2YNFB 3OR1A 3D3BJ 1C4AA 2AQ4A 3HT3A 1U6BA 1NJXA 4P2XA 3ELHA 3I31A 2MQLA 3W7BA 2B8QA 2MZTA 3BDEA 3HPOA 1F0XA 2ZDPA 4WCEQ 2R2UA 2HLUA 3R5AA 3TWZA 5DJBA 2V50A 3CDBA 1WHXA 2IM3A 3MCNA 5LXYA 4NXNF 3A12A 3OFGA 5IWAJ 4M94A 4B9SA 1HNVB 4OX7A 3A3PB 5L1JA 1Q7YT 1WDDA 3DRYA 3MUVP 2CQDA 3OTOF 3HFZB 4NXMJ 1ULRA 3EUNA 2QMUB 3MM8B 3LW5C 4WBFA 4DFJA 4O3PA 1UFLA 3I0SB 1VHIA 2HFSA 3OR2B 1MWZA 5CYJA 3DMJA 2KYZA 3K5MA 1SKRA 3QJJA 2RS2A 2OEKA 4JI1J 3BGUA 3RUBL 3EDQB 2QA1A 2YWHA 5FDLB 4N8NA 4DMZA 1N5SA 4AXJA 4DQSA 4RW6A 1AB8A 3OFHA 4X4TA 4CLWA 2OFGX 3PHTA 1LOUA 5L9XA 2VQFJ 2E1AA 4HI2A 4I7FA 3W5YA 5RUBA 2E7XA 3BYPA 4OHZA 4F8RA 1TKZA 2J9DA 4LSLA 5BYQA 2VA2A 1MSWD 1RTHA 4H4MA 2RHSB 4C8ZA 2AP6A 3QSIA 1NSKL 2L3MA 3R3TA 4FDFA 4BLGA 3QZ7A 2GVZA 4RX6A 2ZKTA 4HACA 4X84A 3D66A 3R8YA 2V5HG 3CGIA 2C1EB 2IYGA 3UWTA 4DUTA 2V4QA 4ZVSB 1U09A 2A10A 2UV8A 5HBMA 5M2PA 2PT0A 3LH2S 3M1VA 2RRBA 3PRDA 2MZRA 2V2KA 4LT6A 3MMAB 1SBRA 2EKYA 1ZS6A 3G82A 3MPDA 5KFYA 3C19A 5HQ8A 4C8OA 2KXFA 4OQJA 2P5VA 4F26A 5JMNA 4V19X 1RDRA 3SEOA 1GT8A 4P6QA 4CYUA 1BUXA 2OPPB 1TKDA 3KK1B 1TAUA 4GVLA 4JOUA 1TQLA 2WB4A 2DHSA 3CDWA 3GIRA 2GC8A 2D7SA 2QG9B 1NKEA 4DR2J 5E41A 1W2BR 4PABA 2LQBA 5IT9U 2AJ2A 4DQPA 5GAGI 4X4PA 2JWNA 1S0VA 3LQVA 2FVCA 2H3EB 3GFYA 2E5GA 2QV6A 3DLKB 3GR0A 3IWLA 3TP2A 5LMNF 2V4RA 2ZFHA 2HNYB 2AGQA 1VQYA 1IBKJ 3F44A 3HJFA 4DEZA 1U1RA 4LIWA 2YX4A 4LR8A 2MGZA 3SXLA 2Z2MA 4ED1A 2EC2A 4OYWA 2FY1A 1VC5A 2V6AA 2C42A 4CZCA 1X0FA 1K8AT 4DCJB 4M5MA 2JX2A 2WBRA 3D28A 1YJWS 4U9RA 2DR9A 5KFJA 2ILYA 1RXOB 2JZ5A 4QIVA 3BSCA 4KV8B 2GO8A 4NPOA 2QL9B 3MEEA 2ATCB 2Z57B 2D3UA 3VF0B 2CPIA 2E1MC 1X4BA 4USIA 1U1QA 2HWTA 4M63A 1MW7A 3IS9B 4IH6A 1VBKA 5F8HA 3FRZA 3QSYB 3MTKA 6FDRA 2DNPA 2RVJA 2VBYA 3I9V9 4OYMA 4JI0J 4N7TA 2VJUA 4K4SA 4FYWB 4O3NA 4JUZA 1Q16B 3U02A 1V5VA 4FS1A 1UVJA 1IKVA 3UQSA 1OPIA 5HJYA 1HR0F 2E5IA 4IR9A 4FBTA 4WIIA 1VISA 2GIQA 3F56A 2J9EA 5HANA 2R7RA 4ZHRB 4J7CA 1S48A 3KDNA 2HRYA 1Y3KA 3BO2A 3M32A 1XMBA 5SUHA 2DY9A 4DV0J 4LF6J 4MFBB 5CCMA 3OVSA 3KK2B 4F3QA 1UWBB 1KDNA 2EKNA 3RU0A 2F3JA 1F5CA 3K59A 5C42A 3BO4A 2NXCA 1N5TA 2QA4G 2M9KA 3KFWX 4ZPVR 4M5KA 2OPQA 3THPA 2UXDF 5LMUF 3DDIA 1HWIA 4G6VB 2Z58B 2GNKA 4ZLPA 3K7RA 2EFQA 4DPOA 2BYCA 4QQBA 1FO1A 5A2QY 1S9EB 1OPZA 3QZ8A 4C8KA 3EWGA 2A6MA 1U8SA 3C15B 2WOMB 2R8IA 2J8AA 3VAMA 3UD4P 1RA7A 1NH8A 2ZVSA 4HT5A 2BJ9A 3M8YA 2VIHA 1X4AA 1JLCB 2HQFA 4WYLA 2X1AA 1L3TA 4A8YA 2VOOA 4EK2A 4B3RF 2Q1LA 2UXCJ 4FBUA 2W01A 2E1RA 3Q2SC 1RT7A 1YRXA 4IG0B 1HWLA 3HX9A 4ID8A 2HWHA 2PEHA 4PG5A 3CJKA 2G1DA 2CPEA 1FJCA 3Q8PB 3W65A 1RQ0A 4UOCA 1ZOTA 3S8SA 1KTQA 3QRPA 1X4GA 5J2NB 5I42B 1MN9A 2HVHA 8ATCB 4O3RA 3K8VA 5KAKA 3VAGA 3MOJB 1M1GA 3I6PA 1YZ6A 3LP2A 4TU7A 3DOKA 4DV4J 1DZ5A 2DGSA 4N41A 2VC0A 3NP5A 5D3GA 2RUGA 3QFHA 4USKA 4WJBA 3EGZA 1I6JA 1QJHA 2C2ZB 4C11A 4EWTA 2QLBB 4UOHA 3SQGB 3TAQA 3PHEA 2XY6A 2XMWA 1U0HB 2CNOB 2GQ2A 1R8AA 3MD3A 3PNIA 4L6V3 4Q43A 4A8WA 4UQTA 4KGXB 3KLFA 3MPWA 3QRQA 2G2OA 3MF5A 2VG6A 2A3JA 4U7UD 4FVCA 5AXNA 1WACA 1SL1A 3JAMY 5KFFA 3GPAA 4K2XA 3UN2A 4BS2A 3WX8A 1TL1B 3NMRA 2KDOA 4P74A 5I3UA 3DLJA 4MK8A 1DRZA 4PQAA 5KG7A 4RUAA 3J7YI 3HVTA 1XTZA 3DRXA 5D77A 5IV3A 2ZJQQ 2AGPA 5B0BA 4OZ1A 5IC6B 1F2HA 2HNZB 4XDDA 3KDOA 4DR3F 1SCJB 4YY3J 2ZE2A 4LRDA 2OMOA 4U7CA 3MPUB 3EZOA 3TVKA 2NZ4A 3KLIA 1Q5YA 4YP3A 4NCAA 4LRAA 3Q24A 1KSPA 4WFAQ 2I38A 1CULA 2XYPB 1MG7A 4KSEB 1U0SA 2EK6A 3J80Y 3G8QA 4X62F 2MY8A 5A8RA 2IFXA 4EBDA 3R7BB 2Y1RI 2BKOA 1N36F 4WP9A 3J81U 2F4VF 2GW8A 1RU1A 1WELA 2CZ4A 4URQU 2AYBA 2D74B 4ZN3A 2AD9A 3ZTSA 3C6UA 4YHHJ 1MROB 2IYIA 1AW0A 2YNHB 2LVWA 1NK7A 5AJ3J 3NGUA 2DNZA 2DO4A 1HYSA 2BE2A 4NLPA 4OV6A 1IWAA 2DNKA 2GX8A 4WK1A 3OHBA 3MUMP 2BBEA 2MKYA 2AYMA 2FJEB 3CVKA 4DV3J 4DV5F 4CP5A 2R8KA 4ER8A 4QOTA 4WP3A 2V68A 1T3OA 2CG4A 2XCPA 2QFJA 1X31C 2XLIA 3POTB 4MAKA 2C2NA 1XR7A 2V2VA 3JAMU 4EYHB 3A1YG 2GVDA 3LOUA 2WSEC 3IG1A 2P9EA 5T14A 1U1NA 2B9XA 4M5IA 3DU5A 2P9CA 1T7PA 2V63A 5HN0A 2LU2A 4I0WA 3BN7A 1CVJA 3QT8A 3AJ1A 2RIJA 4HR2A 4CT8A 4OI4A 3ILJA 4CI0B 4CRJA 2R7OA 3GYXB 1VJQA 4DUYJ 3ITHA 1S12A 5HMXA 3ZC4A 1D9DA 1AZSA 2C2OB 1UVLA 4IKAA 2BQ3A 2Q79A 1IR1A 3H7HB 5IT4A 2R7TA 2ASLA 2KYXA 2W2PP 4O0NA 1NU4A 4OYPA 5AT1B 3AD8C 3D6TB 4K4YA 2EFGA 5KG5A 3RRHA 3MXHP 2XHCA 5DLGA 4DX7A 3EPGA 2Y0SD 2FGCA 4PWWA 2H4YB 4OHXA 2JFDA 1HFEL 1N4LA 2ZD1B 2DT9A 2IIHA 4Z7YA 3TVZA 5E33A 1QUVA 2FHOB 3RW6A 4PXDA 3E01B 1RBLA 2DNQA 1EAYC 3BGFA 4WKYA 2A18A 1GEHA 1IKXA 3H25A 2JNJA 2PC6A 1SUQA 8AT1B 2C2RA 2NR0A 2E7VA 4RW7B 3J7A1 3CE8A 4QJVA 5LM7E 3AY0A 3CJSA 4F0KA 3GQCA 2YKNA 4K4UA 1J5OB 4UOGA 1HNIB 4JI7F 1KLMB 2CJYB 2F9JA 1LXNA 2F8HA 4RL1A 4RKUC 7FDRA 1X7VA 4K2JA 5CZVA 2ZWOA 1RT5B 5FIIA 5IT0A 2FZCB 1U48A 3PX4A 3MAQA 1RKJA 4DL4A 3OUYA 1AYEA 2PE8A 3IR5B 2K1RB 2FLOA 5HROB 3H90A 4O4GA 4DR2F 2B4PA 3KOAA 4K7QA 3VAJA 5C2GA 1HNVA 4D3HA 2ZUGA 3NOCA 4DHVA 2RMLA 1WC0A 4NLSA 1KOHA 1S7HA 5KFZA 3W66A 5M2RA 5I4MA 1FWKA 3N6LA 5K8PA 1DTTA 3MM8A 3N5BA 1XNQJ 2FHMA 2D3O1 5F0WA 4OX8A 5D4LA 2LCWA 5DS7A 2FD2A 3CNQP 4X4QA 3DMJB 3KJFB 1FKAF 1B99A 3H2LA 3NAIA 3HZEA 2FB0A 2FJBB 1LEOA 2LKZA 1JX4A 5LT5A 3TANA 1RE1B 2IA0A 5FDLA 4U8YA 1SI9A 1UZHA 3NGRA 2IJNA 4UUXA 2YNIA 3Q8VA 5M2UA 1NK0A 3G86A 3LANA 1KEKA 4J37A 3TAMB 1VIOA 1B64A 2VPZB 4PPDA 4LFCJ 4G1PA 1S57A 4IYQA 3DXSX 1YJ7A 1LW0A 3JQKA 4DR6J 2V8VA 4JI8J 3I5AA 2MLZA 3PEJA 2V2ZA 4FYDA 1TKZB 1HBNA 2BM1A 4LRBA 2E7WA 4EGLA 1HNXJ 2ZNZA 3CTRA 3PX6A 1UP1A 2AJQA 4JI0F 1APSA 2DNMA 3PJ9A 1AUSL 3FCVA 3M1VB 1N33F 1VBZA 3L7OA 5GMEA 2XNRA 3EGWB 3MMAA 3UVJA 1HMVA 1X4CA 3AT1B 3FKBA 4OJ3A 1QDUB 2VG7B 1BY9A 2CJKA 1WWHA 1S76D 1UW9A 3QLHB 3F0NA 2WCXA 2HPUA 1XNRJ 4CYUB 4M5LA 3QT6A 1RBAA 2MYFA 4JI6F 3KK1A 5J2MA 4B3OA 3DRRB 4ZPCA 4YQWA 2E66A 3NCRA 2Z2ZA 2XG8A 2H65B 2RRNA 2IM2A 2AYEA 3I82A 3H8YA 4ZJLA 2NXEA 2AHOB 3I96A 3EICA 5IWAF 4B3TF 2IVYA 2XEXA 4U8VA 4DV2J 2D69A 3BGOP 4TVAB 2L9WA 1LXJA 2AU0A 3NS6A 2DNGA 3SFUA 4NCGA 4CLTA 5E3CA 3DLKA 1S6QA 3HD2A 2HNYA 4MMOA 2ZH1A 5HAOA 1X9WA 2QT7A 1HHTP 2QA2A 2M8DB 1CLFA 1WOPA 1IR2A 3FBCA 1KONA 4J9UE 4NEZA 3MEDB 5DQGA 3MR6A 5D8HB 1NJIT 4KO0B 3BGRA 3NGSA 1PYSB 3NBPA 5A8WA 3MAAB 2HZVA 4WP8A 4QPXA 1FCAA 1Y00A 4DOZA 1N56A 3JSRA 1B0PA 4Y2MA 2W8KA 2VICA 5I3QA 4FS2A 4X65J 4WWSA 2YKOA 4W4MA 4KV8A 3MM9A 1UCNA 2ZH6A 3MEEB 1RGVA 3MWBA 2UUAF 4QIGA 3M2UA 2H5IB 2ZH7A 1IWGA 2XLJA 3CO9A 3SBMA 3NL0A 3LPEA 1R8CA 5MAOA 2VFUA 3WIUA 4YS2A 4X4SA 3W9JA 2QE5A 3PVXA 4RW8B 1QSSA 2BDPA 3T6JA 3CC7S 3DRSA 3BN4A 1FRHA 3AD9C 1OIAA 3IR6B 3FBFA 1JLFB 4EBEA 3RW7A 1BQNB 1S79A 3H20A 3JSMA 4HI1A 5DM7Q 1UVMA 4RWWA 3EX7B 4LSZB 3H4BA 1D1UA 3C3LA 4W92B 1RT1B 2WVEA 3NCQA 3T9ZA 4ZHRA 2NSCA 3KK3B 1KQKA 5IM0B 4LF7F 1YVFA 1JLBA 1KHWA 1LKZA 1U6FA 2QX0A 3IR7B 5BJRA 5JUMA 3DM2A 3T6BA 3SZ2A 1D8YA 1UWBA 1FTRA 2HNDB 2XWXA 3MR7A 5MLCV 2B7CB 2DNLA 4PZVA 1SXLA 1JWWA 3GE9A 5CQGA 3RTVA 1MN7A 1VLYA 4ED4A 2DH7A 1JK9B 5F8LA 1UAWA 3BKUA 1OY8A 4ANCA 4K4WA 1Q86T 4R25A 3IGVA 2Z0GA 4GC6A 2JJ4D 3UNYA 1RT6B 2CNNB 1HD0A 2W7PA 2UV8G 1ZH5A 1S9EA 2XMJA 2MMYA 1VRTA 3C15A 4GKKF 3AA9A 4UF4A 1HBMA 5KFXA 3FFIB 3EZ5A 1U1OA 4JI3J 3FQLA 1WNEA 1BQMA 3VQSA 4ZKAA 1MMLA 4IOBA 1T9XA 1X4DA 2RUSA 1HHQA 1JLCA 4ES3A 5K8MA 3EXCX 4ZJQA 1HARA 4M5NA 4U95A 2HSEB 1RT7B 2L48A 4N5SA 4YR3A 1I94F 1MU2B 1TL3A 2BRLA 5HMZA 3PW7A 3MURP 1ZPWX 2MHEA 1RABB 1TL5A 1VQ9S 3QRRA 1P1TA 2PSZA 2DISA 4F4WA 1OYDA 3KHRA 3QNWB 2HZAA 4B9LA 4K50A 3NKYA 3D1HA 1VMBA 3ZTPA 3M6VA 2HIQA 4PWUA 2WTFA 3Q83A 4F25A 3PG9A 2OTJS 4U6PA 3AOBA 1KQFB 1RADB 3DLLQ 3H2UB 2IJRA 3AQPA 3JYTB 3R5JB 1YJNS 1M5VC 1XN9A 3D0GE 3K5NA 3RGIA 1L3SA 3G71S 2D3ZA 1VOMA 5KFIA 2OD6A 3O6QA 2WONA 3MTJA 2CWKA 1VK3A 4X66J 1FRLA 5AE1A 2GHVC 3HHLB 4C3LA 2HFNA 2ZBIA 3SQGA 3QGGA 4FKXA 4YN3B 3EYZA 4P7TA 1FX2A 1WEZA 2P9GA 4J9SA 4NE9C 3OLBA 2EK1A 3VGUA 4JV5F 1SH3A 2AJ4A 4ALZA 5CZXA 5K9FA 4LFBF 2OSRA 4K4ZA 3DDNA 2CQ3A 3MMCB 3QAEA 2C3MA 2KU7A 3TZYA 1GTEA 5DQHA 2V0NA 3TNVA 1ZA2B 2RD5C 3N79A 2CQ2A 4KPYA 1BWEA 1RWMB 4ECQA 1M90T 4LF8F 4HHUA 1D09B 1W26A 4DN9A 1JQGA 3HVTB 2MDAA 1DQ9A 2DXDA 3O1LA 4WFXA 1FRXA 2I5JB 3CMQA 3OPKA 4HHJA 2ADBA 3ZZUA 3CCJS 3LGMA 3E2EA 2RT3A 3OD2A 2IMOA 5T7LB 4H4OA 2QRRA 1KS2A 2FZKB 2X1GA 3BV8A 2H5JB 5DQIA 2UVRA 2HIYA 3TYTA 2M0GB 3KLEB 2RDJA 1NB7A 2KT5A 4DSLA 3VGSA 3M8PA 2CVIA 2X3DA 1GNKA 1O6XA 3M2VB 2N4CA 1NBEB 2IVMA 3UDEA 1YLXA 4IQXA 1RT4A 2M3DA 3G4SS 2IRYA 3ZZRA 2U1AA 1YWXA 2UXCF 2DO0A 3NS5A 4LUBA 1OYEA 1KWMA 2OPSB 3LF0A 1FEEA 3CW2C 2V34A 1HQEA 3DRPA 4HEA9 3CCUS 1PAUB 3OTCA 3W64A 2Q66A 3DI6A 1MROA 1YRUA 1UKUA 2BJ8A 2NXUA 2ZNYA 2K2PA 2D9OA 3OFFA 4G65A 4Z7CA 2XGPA 2FVPA 4DSJA 2D9PA 2DH8A 2QSFA 3WIVA 4ETXA 2VG5B 1SQGA 3CJ2A 1RAIB 4WTOB 1FD8A 2HS3A 2KJVA 4G1IA 1RTDB 4A8FA 2JEIA 4JI5J 1KQSR 4ZP8A 4KBIA 2XS7A 2WSFC 4K5SA 2RF2A 1TKXA 3DLGB 2XYGB 1RT3A 2G2YA 3MFIA 1V3RA 1K1QA 2GVDB 2QL7B 3BH7B 3MOZA 3UCUP 5HLFB 5KT3A 1UEKA 1F3FA 4IRKA 5J1NA 2L41A 3VZHA 2B4UA 2EG1A 2IM0A 5IQ6A 2EBGA 1S1VA 2AIRB 3QBCA 4U67Q 3TUIC 1IBMF 1Z1ZA 2F40A 3HCXA 1ZAVA 4HH0A 4JP8A 2PGCA 5KG2A 4AQYJ 5KT6A 2UUCF 2EWHA 3VTIA 5CD4H 2OD4A 3C46A 1E6VB 4HL9A 1CBKA 4R8UA 4L76A 1TUGB 3AHPA 3FEXB 3H0PA 3KLGA 1AZSB 3H5YA 4JYAJ 2ZH5A 3J80U 2YXLA 3UCZP 1N5YA 3ET6B 3VCDA 5DDPC 1S10A 3TEGA 2MQOA 2L9NA 3D54A 5DO2A 1U45A 4K4VA 4OFZA 1A7GE 2GAHC 1VQSA 3E3XA 1I1GA 1SQEA 1HWUA 4F0HA 3GFXA 5KG3A 5B0CA 3SCLE 3T41A 3BZQA 1RISA 1JLEB 3BPDA 3TX0A 1REVA 2BE7D 3OJSA 1T05B 2X1FA 4B3MJ 4OHWA 2AJ0A 3D4JA 1OY6A 5L46A 1NM2A 1N5VA 4NMLA 4OZ2A 4YDXA 4RNOA 3JB9k 1N36J 3HT0A 4NLYA 1VS3A 3I0RA 1QE1A 2AZ1A 3D9BA 1HNZF 1TV6B 2VUGA 5J2PA 1D9FA 1S1XA 4YHHF 1Q7LB 4DSKA 2CVEA 1X8DA 2Q6CA 2H5EA 4LF2A 1X5TA 2CPJA 2M4MA 2YKNB 4AT1B 4WIQA 1ZZNA 4C8LA 1CC7A 1FVSA 2AV5A 3FCHA 1P8GA 4OL8A 1BWVA 4FXWA 4I69A 4LRCA 4IQMA 5D4OA 4J9VA 3G96A 1SIZA 2XZWA 1FDAA 2DY1A 5GVQA 4Y0FA 1H3DA 5D0GA 4C8NA 4ELUA 1KQGB 1OS5A 2BJEA 4I1TA 5A76A 3HKWA 4QWEA 1U2FA 4EZ9A 3TZZA 3DGPB 2W8LA 1NPKA 3Q89A 1IJFB 2OO4A 2ACYA 5L1IA 1M1KT 5L38A 1YJTA 5J1PA 3KWMA 2IPOB 1FK9A 1XMQF 2E5LF 1HHSA 2YPZA 1DTTB 2CA9A 3RRKA 4C0BA 5HSPA 5GADI 2N4DA 3M9NB 4X64J 4FF1A 4ZJOA 3ZZYA 2W9BA 4FN5A 2JLEA 4USHA 1H98A 4Y34A 5LSOA 2XQCA 2PI5A 4XPEA 1TUWA 4ZCIA 1KR4A 3K5PA 1T03A 4X4NA 1FF2A 3EDRB 2HAIA 3W62A 2NYIA 2W7AA 4TYAA 2ERRA 4WU3A 1N48A 3Q8RB 2RQCA 1FXDA 5KFGA 2WVFA 2RDDA 2XZTB 1O5JA 2IDLA 1SB6A 4PAAA 3ZTQA 1C0TB 2ZH9A 4IO9Q 3BSNA 3PV8A 3G8TA 2FLPA 1RYSA 3GSIA 1EIYB 4TNOA 5DLFA 1EP4B 2O5DA 1U24A 3MEKA 4YB7A 1LW0B 4DL2A 2AYGA 2EC0A 1BQXA 1SC4B 5E0OA 1OSDA 3T1AA 4KGVB 4FXDA 1XR6A 3OSNA 4B3SJ 1HW8A 1FE0A 1R3NA 2EFPA 2DGWA 4ZCMA 5AE3A 5KOXA 2N7CA 4NLGA 3EXYA 3HK2A 4M5GA 3UPFA 4UZCA 5ETKA 3LA0A 2EPIA 2W2QP 1LK7A 2RU3A 4N76A 3RBDA 5B08A 2CDQA 2KG0A 2R9LA 3K17A 3UVJB 1HMVB 5U47A 4C3KA 4ECTA 3SYZA 2UU9F 2VG7A 2YH1A 3M8WA 1LWCB 1ACMB 1R6VA 5KT2A 1CPZA 5J2MB 3GR1A 1QM9A 4OZNA 3DRRA 2WVBA 3B4MA 5K14A 5DG8A 2VFSA 3VWSA 2W4CA 2ZWPA 2LP4A 2KRBA 2R8HA 2WBMA 5LJ5Y 4RNMA 3VAHA 2I2YA 1A0OB 1GXUA 4LMZA 2HYIB 1M5KC 3M8SA 2DNRA 1U1PA 5B0FA 4A46A 3NLCA 4LFAF 2M7SA 1B7YB 1N88A 2E5HA 2V8GA 2HAFA 2PN6A 4NCGB 3MFHA 2WK4A 3RR8A 4Q45A 1UEVA 4P71A 5B0EA 5B0DA 2NXNA 4MTPA 2FTRA 1YKWA 2MPUA 2W9AA 1VBXA 5D4PA 1J5EF 3MEDA 1VQ4S 2HQCA 4DPTA 4RNHA 2DBBA 4RU9A 4QWDA 2V67A 3H98A 4DFPA 2RSQA 4DLEA 1S1WA 3GG1A 1GAOA 2B6AB 3LP1A 4LQ9A 3KUEA 1Y5NB 3NBPB 3DOMA 4RW6B 2PA8D 5A8WB 3IRWP 1QAYA 1RHQB 3KTQA 4QR2A 2CAJA 2ZM6F 1IBMJ 4ERDA 1JLAB 2CPZA 2PEBA 4ZVTB 3LAKA 3KJVA 4CM2A 3CEDA 3D0HE 2OJ3A 3Q23A 3U1LA 2PFDA 2Z8QA 3HHEA 1XJWB 2WB1D 3MM9B 2F8EX 1LWFB 1V3SA 3L7UA 4LSLB 1SJRA 4OZ5A 1TUVA 1V3ZA 3M2UB 3BSOA 1D0EA 2J7UA 4OI0A 3R27A 3CMAS 1FRKA 1TK8A 1P9QC 1FA0A 4DQRA 3HLUA 2KXNB 3I5CA 4L73A 2EFVA 4NWBA 1F2GA 4RW8A 2VC1A 2LFVA 5HBMB 2QC3A 1PKUA 2MKKA 1S5ZA 3PDNA 3PRBA 2G0JA 3MM5B 2MZJA 1U2RA 2JVRA 5AXKA 4ZMMA 5A0YB 3JSMB 2VU5A 4AE5A 3IO1A 3FC9A 4NYPA 1CJVB 1NHVA 1RT1A 2KM8B 3KK3A 1N52B 4ECXA 1S1TA 1WI6A 5IM0A 4DQQA 4BHQA 4X62J 2E9RX 1TL7A 3CCWA 3IXQA 2XI3A 2OLWA 4RUHA 2RS8A 1FKOA 2RQ4A 3DOLA 2F5GA 2HNDA 2J76E 4NEYA 4AYBD 2R2TA 1K0VA 1C1CA 2B0GA 4NLTA 2XSJA 2A6OA 2DVIA 3H42A 3MHYA 4RW4B 2M88A 1K47A 1R8HA 1WKKA 2ABYA 1LFPA 3D3CJ 4P9SA 1HWKA 1IBLF 4B3TJ 1XWLA 3UI3A 2P6SA 5KT5A 4ICLB 2MSTA 1RKIA 4ZP9A 2BJ3A 1GX6A 4KT0C 4ANDA 3R6GB 2V9WA 1SKUB 3D6MB 3FCWA 5KFEA 1FVQA 1VRTB 2OPRA 2J0SD 1S77D 1CJTB 1U02A 3G6XA 1TTHB 4H4KA 1BQMB 1SPBP 2YWKA 3EM1A 3T5JA 2HBRB 1U1KA 2FPHX 3TJ9A 5KFVA 3ZZTA 2AJ1A 1DLOA 5KT4A 3CF5Q 3L95X 1NK5A 1GXTA 3DLBA 3JTNA 2XB2D 4NOHA 1WC6A 4K0KJ 1LV5A 1E6YB 4CLKA 2B4VA 1BE4A 2W9CB 5IV4A 3TQ1A 2HHTA 4HKQA 4C48A 1ICEB 3H59A 4NYZA 1NRKA 3SFGA 2CQIA 3M6WA 1X4EA 2YKQA 2ZEJA 4J5OA 5BXIA 1JXVA 1T95A 5CD4A 2BW7A 2X1BA 3ULHA 2FGOA 3DCAA 2ZZNA 1T9WA 2CZVC 4DV4F 4ID5A 4X4RA 1CSJA 2ZKUA 3ENWA 4E98A 1T11A 2KT3A 4TY8A 5CCLA 4O3OA 3BQ2A 1IKVB 4I56A 5DRKA 4G3IA 3DNCA 4NZ6A 1WF0A 3CMES 1JLGB 1ELOA 3P45B 3EVWA 4ILLA 4PG7A 1ZAXA 3H5SA 4DCPB 1UA0A 3OVBA 4DSEA 3IBFB 4UZBA 2Y8YA 2YQ1A 2HEKA 3HM9A 1FNXH 1NJWA 5C42B 2C2MB 2OH2A 1UW4A 3C8YA 2COLA 2RAQA 2OPQB 1F5BA 4USWA 2IA6A 4QYZJ 4A8XA 4KGZB 1RLCL 1HQ2A 1NZAA 4XPCA 3CDAA 4IOCQ 4A8MP 1JLQB 1GMUA 1HNXF 3GLJA 4WF9Q 4JI2J 1KN6A 4ED2A 1IXKA 2LMIA 4DJBA 5HL7Q 4MIBA 1LW2A 1TVRB 4RLEA 2UUBF 3R1LA 4V19J 2C2DA 1NHKL 1IBKF 4QYZK 1S49A 3CSKA 2WOMA 4WYWA 1X9MA 2FVRA 1S7IA 4TKTA 3CO0P 5D15A 3KLEA 3M6XA 3AB4B 5D0EA 1W2IA 2EI5A 3ZZZA 3M2VA 2DJWA 2FVQA 2UVWA 1RT4B 3D7SB 1B0TA 1QAXA 4C9DA 4QYRA 1IM6A 2D41A 2F65A 3IM9A 4RNNA 2FLNA 3HO1A 2MQ8A 1DBDA 1RWPB 2FJDB 1N0VC 3CJKB 2VONA 1I94J 2LYVA 1HQEB 4KH1B 4J9MA 1VRUB 2CIMA 1PILA 4IRCA 3CJ4A 1HNWF 2MY7A 4LF5F 1F1BB 2JSXA 2PMWA 5HK4A 4KYZA 5J2NA 5I42A 1KRPA 3NCPA 1SL0A 4PRFA 2H4WB 3Q8SB 4H54A 2HGLA 4TLQA 1F6TA 4F04B 5H9EJ 3LP2B 1RTDA 3HSJA 4CIOA 1WC4A 3ENAA 2W25A 3ADAC 5D3GB 1SQFA 2QYGA 4QR0A 2AMCB 3CIZA 1T94A 2RF2B 4FPRA 1TKXB 3DLGA 4X66F 2X51A 2GMJA 1URRA 2ZBRA 3QO9A 3CXCR 2ZBQA 2ZH3A 4AL7A 5HLFA 5DG9A 3IN5A 1NDLA 1X4HA 1SL2A 3C14A 1NJYA 2CRLA 2ASYA 1NXIA 3IAM9 3JTOA 3NOGA 3Q86A 4UOFA 5HJXA 4YEAA 4DR4F 2GGPB 4LF4F 1H2VZ 1VK8A 2PMZD 5B7WA 3THVA 2J6TA 3RR7A 4LF1A 1U47A 3OXFA 4FVMA 3PTWA 1E6VA 4J9PA 1FJ7A 1S9GB 2I0XA 4J9OA 2BANB 2K06A 2MSSA 4IFVB 1UVKA 2OI2A 3UFCX 5H9FJ 3CJ0A 3K89A 3R6LB 2G1HA 4QCLA 3BGLA 2ZE2B 4ZVUB 2VBXA 2HHHJ 4UY85 4J9RA 2G13A 5HMYA 3D1OA 4Y2AA 1QY7A 4C8YA 3MEGB 3VALA 4ZS6A 4NLDA 3WZ0A 1TFYA 2XMUA 1GQEA 2AT1B 2ZC3A 1YDLA 3N01A 2C2EA 3CD6S 3M30A 2VA3A 4ILMA 1KKHA 4ZCLA 1RUSA 4ECRA 2KXHA 1P9YA 1TKTB 2CQ0A 3A3OB 3PACA 3CJ5A 2MXYA 2DR5A 4GMKA 2C2KB 4M5DA 2FJVA 1X5PA 2Y9HA 3PO4A 3TX8A 2G2ZA 4MT1A 1U49A 3I0RB 1QE1B 2DR6A 4WKRA 2E5JA 2V8DA 4LJMA 1ZAWA 4USMA 2CQPA 2V69A 5CYQB 4ZP7A 5J2PB 5THWA 1NKCA 4PQUA 2IBOA 2BE2B 3P5BP 4OYOA 4C7QA 2VH7A 2N7YA 3GILA 4OJ1A 3QIDA 2WZ1A 2W4PA 3JSBA 2JEJA 1BGXT 2VPYB 2DB1A 1IJEB 5B0AA 2PD1A 3LAMA 4DL7A 4DS4A 1NNDA 4KY3A 4DF4A 2NQPA 2LQ5A 2VQEF 3NXZA 3KG1A 4E0DA 4ED0A 2Y0BB 2BMBA 2R3VA 1QSLA 3MZIA 2EXUA 4A4JA 3NMAA 1XNQF 2J9DE 3D1QA 2B56A 4WXWA 1ZETA 1HLWA 3I87A 5KTQA 1X60A 1FKPB 4YFUA 4USJC 1G1XA 3P4UB 2W9BB 3PEHA 3BB5A 3EPIA 2DHHA 1C2PA 1P6TA 4ZPAA 1WG4A 3AXKA 3ITHB 1R0CB 4ZVPB 1SIWB 1IUJA 2HFOA 2JH3A 4USVA 3W2VB 4F0MA 4F67A 2KHDA 3RBEA 3OL8A 2BW2A 4OLOA 3D2WA 4JYAF 4NLOA 2MZ1A 4CLYA 1S0NA 3A8IA 1M5HA 2MQPA 3KYLA 2J6UA 2E9TA 5DGBA 4ELTA 3TA1A 1C0TA 3C6TB 3DXBA 4KGMA 2MKSA 4EYIB 1WC1A 3K0JA 3NY0A 2IJFA 4X4VA 4JI8F 2HBYB 1UJ6A 2ZD1A 2WW8A 2GMHA 1EP4A 5GAHU 1UETA 1W7WA 1VGYA 2BABA 1WG1A 4MKVA 3MR2A 2DEJA 4LSNA 4LF6F 3ILOA 3E01A 4HDHA 1HIYA 3E8OA 3ILIA 4GO7X 1RHUB 4OX6A 2NPFA 1ZM9A 2XTJP 1FD2A 2G4BA 1IKXB 2CJQA 2Z56B 5KFUA 2J0WA 1H7XA 4EO8A 2HQGA 3T5HA 3W5ZA 3TJ8A 1RYRA 3SSRA 3T5LA 4RNFA 4LF8J 3FBEA 1Z2LA 4YB6A 4C98A 1J5OA 3V6DB 1NH7A 1KLMA 2ZH2A 1X0PA 4DR5J 3HDSA 4K59A 3AAWB 1I51B 4ZVGA 2Y1JA 4DR7J 1N0UA 2OAUA 4GC7A 5IFMA 2E29A 3HI9A 3I32A 2DIUA 5E3RA 3OUYB 1YSJA 5FD1A 5K14B 5K8NA 4O4GB 5HROA 4A8QA 3UD5A 4MIWA 2YWWA 1B4SA 3T3FA 3DLHA 1IVZA 3IGNA 4CLPA 3Q8QB 2DR7A 2JVOA 3V81A 4P2MA 2AW0A 2CZ9A 3JXOA 3M9MB 2OEMA 5HATA 2XBPA 1TK5A 2RRAA 4WXOA 3IA0A 3GYNA 4IH7A 2XSFA 3EVOA 4ILRA 1H74A 3RBXA 2J5AA 3D67A 4DI6A 1VQPS 2J0QD 3SCIE 4DV7F 1WJ9A 3BBFA 4C97A 2A1BA 3NAHA 4P7VA 4TN2A 1RP5A 2BJ7A 4P75A 5K8OA 2ZHBA 2B6AA 2RILA 4WFZA 5EX3A 1PC4A 1R0BG 3DOMB 1NUEA 3LWMA 1DTQB 4KHMA 1Y7PA 9ATCB 5KFPA 2M2BA 1HL6A 3TAMA 4JI4J 5L9NA 2HGNA 1B7FA 3T1YF 4KKOA 4P2SA 4MKAA 3B6BA 3KJVB 2CWXA 4DUZJ 1PBUA 5ADZA 1AFJA 1RHRB 5DGAA 3KHGA 3OL9A 4DS5A 3GU0A 3MPYA 3H40A 2F4VJ 1PG5B 4NI2A 2ATLA 1IBCB 1CJUB 3TQEA 3H5XA 4AXIA 2VFTA 2ZJPQ 1JMTA 3K58A 1H2UX 2A2DA 5E2QA 4FNHA 5KFHA 4MJKA 1YJ9S 1WG5A 3MM5A 4URSA 4NRTA 5E3AA 5A0YA 4DFMA 1U2CA 3PY8A 3W2WA 1U7LA 3ICLA 2K3IA 4DU8A 2R7SA 2XNQA 3CD7A 2PO4A 4YY3F 3CJRA 2HW3A 4N47A 3OXGA 1XIQA 3GIJA 3Q22A 2AEFA 1PC5A 2BA9A 2ZZMA 4QZVB 1TL7B 3LP0A 2BXJA 2CADA 1FKOB 3DOLB 4CLUA 1T0TV 3B82A 3RJMB 2V2QA 2JHEA 3ILLA 3UDCA 4CO2A 5H9EK 2IRUA 4I4BA 4R0JA 3KHHA 2OGUA 3G2XA 4C4WA 4NLRA 4DDFA 2ROEA 2LECA 3CC4S 4F2RA 2XGQA 3CT9A 4JI2F 2EBEA 2H48B 4ICLA 2VPXB 3AD7C 2NS1B 4J90A 4DL6A 1KFDA 1S6QB 5FLXU 4UY8T 3X3UA 1MMDA 4JI5F 5AJ3F 2J8SA 4C3MA 4C8MA 2NCKL 1U8WA 2MKIA 1DURA 4ZVQB 4CNYA 2GZOA 2OPRB 3PIOQ 3IMQJ 3PYDA 2HVIA 1S1UB 2V4JA 4IFYA 3UR0A 3PX0A 1BLUA 3AODA 5J2QB 1RTZA 3FVYA 4CO5A 4NA1A 2VQEJ 5I3PA 3QIPB 3OQ2A 5L1KA 1H38A 2AF6A 2L08A 2Z2YB 5LOQA 1ZTTA 4ECSA 4DV6F 2ZM6J 1E6YA 4AQYF 2XY5A 4O0IA 2UUCJ 3DYAB 1HNWJ 3AJ2A 1CG2A 1QD1A 3CJQA 2AJFE 3H2VE 1RTJA 2DK2A 3BREA 4I2QA 2HQIA 4CQ1A 2DR8A 2VPWB 1SJ3P 5IQQA 2DNOA 1CC8A 1M0SA 2GCFA 2HLTA 2B5JB 3A4TA 3DDKA 4OI2A 4CTAA 3G6YA 3BDPA 2R7QA 4C2MA 4MIAA 2MHNA 4EFAC 4CO3A 4TY8B 1BQNA 4UW2A 4F4XA 3N9UC 1RB0A 1K73T 1VQ5S 2F9DA 3DGVA 5KFBA 4WE1B 4X2BA 1LFWA 1PBAA 2C3UA 1TELA 2VZ9A 3HHLC 1HBOB 1Q0NA 2CPYA 1JLGA 3D0IE 3BBCA 2W2MP 1M5PC 3HSDA 1RWOB 2HS4A 2KJWA 2VFVA 3J81Y 1HBUA 4OI3A 7FD1A 1XNRF 2VB6A 3TUPA 1ZPVA 3N6NA 4ED5A 3VGVA 3EE3A 3M7VA 1RT2A 2HG4A 3NWGA 4I2PA 4NLXA 4ZVHA 2Y3YA 4KR0B 3CUNA 4NLWA 3AJDA 1XC9A 1QTMA 2FC8A 3C2PA 4HTJA 2FIUA 2MQNA 2XMMA 4RWXA 4CCHA 1PJ6A 5KFOA 4U7UK 4B3SF 4DV2F 1YX2A 3OW2R 5F9LA 3LPYA 2MZSA 3R9LA 3T19A 4CO0A 4Q2MA 2EW9A 4CWBA 5A8KB 4B17A 4HDGA 5EWEA 5E5NA 1LW2B 1TVRA 2BACA 1IKYA 1EETB 1RAOA 4OV1A 2HWIA 2CPFA 4PCQA 2XO6A 1GFWB 1HBMB 3FFIA 3TR5A 1YTYA 5CYMA 1FE4A 4PWDA 4C0OC 3UD3P 2V8PA 3GYGA 4TU8A 3CDUA 5L1LA 1KVIA 4DWIA 3CCMS 1MU2A 1TL3B 2M8HA 3ONQA 1YBUA 1XMOJ 2E5LJ 4ZVOB 1I5OB 3OTEA 4OX9J 2AGOA 4F50A 3R2DJ 3U7JA 2EEYA 4CO1A 4CNZA 3R1HA 2CJAA 1KD1T 2IVFB 3GFZA 3O3LA 4IDKB 5J1EB 2B7BB 1Y0HA 4ZVFA 3QGIA 2B8PA 1D9AA 2IAJA 2XZDB 4WFNQ 3JYTA 3D68A 2VDHA 1PIEA 1YQHA 2JC0A 5IS2A 2G0CA 3SV3A 5F41A 2WONB 1SH2A 1JKHA 2LQ9A 3NGTA 1YGYA 1HA1A 2B9EA 1RHKB 4LR7A 1YITS 2RKIB 4JI4F 3DHWC 2K3KA 4JV1A 3FDSA 1Y5LB 4JB8B 2BVZA 1QVGR 2KZZA 2R8GA 2HFVA 5HQLA 3C14B 1VI7A 1SJ4P 2QLWA 3MECB 2KN4A 4LFCF 1RI7A 2HURA 1VYAA 3GSDA 5ETRA 4Q44A 2F4FA 3KLHA 1HI0P 2WAQD 2VODA 2XLKA 4DR1J 5F9NA 3MI7X 3T1HF 1WHVA 3GTYX 2CUYA 4H4KC 1FWPA 1V5IB 1NMEB 2YWGA 4FKYA 1UPMB 3JTPA 4NZ7A 5F8IA 1YZ7A 1FT8A 1G4CA 3QGHA 2BANA 4IFVA 1LQ9A 1RTIB 4LR9A 5SZTA 4YR0A 1AFIA 2UZAA 1CJKB 4F4ZA 1D3WA 1EHWA 3NEKA 3HHKA 3CJ8A 1DFDA 5T7LA 1N33J 2BOAA 2DNHA 4H4OB 4DL3A 3GZ7A 3BKFA 2K7KA 3EZUA 4TU9A 1Q81T 1GH8A 3P8BB 1R27B 4N8OA 5GAHI 3M8PB 2R8JA 2GQQA 4UTGA 3U1NA 4ELVA 1TZ0A 1SKSA 3V4IA 4B3MF 5D78A 3M30B 4RO0A 2YKAA 2W2OP 5JVGQ 1XEZA 4USUA 1TKTA 1TMMA 2W2NP 2Y1LB 2ZHOA 5AXLA 2IMWP 2CQCA 2B9YA 2F8MA 3M2RB 3RG6A 4M5DB 5CH7B 3DRPB 1HQUB 4ZVRB 1JJ4A 1K44A 2JC1A 2DXEA 3IBWA 1U1MA 2DRAA 3GV5B 4PKDB 3L4BC 5IOLA 2WVCA 5CYQA 4PQUB 1H7WA 1HPZA 4WU2A 2VG5A 2ZOMA 2ZBPA 3MMBA 2AX0A 3AB2B 3BSAA 3IRXB 3N6MA 4Y2KA 2DRDA 2MZQA 2LDYA 4PXEA 4RW9B 1R6YA 2VKRA 1YRTA 4KFBB 4I6WA 3C66A 3M8ZA 5KFRA 4ENOA 3A8KA 3OFEA 4EUVA 5D4NA 3ETMA 4TY9A 2KI2A 1RT3B 4XIUA 1RAGB 2WSCC 1C0UA 2CDRB 1V6HA 2EFNA 2XI2A 3BM7A 4NLVA 2LA6A 3ZNJ1 4JV5J 1UTAA 3KLVA 2B4OA 1LWXA 1PYTA 2W1BA 3I5BA 2ASDA 4FF2A 4Z37A 2HK3A 1EARA 2HMIA 1U4BA 2P2CB 2QO3A 4LBPA 5KFNA 1FKPA 2Q6BA 2IM1A 5DZ6A 3J7YU 4J9LA 2V8HA 2YNGB 2YWEA 1NEEA 3PFOA 3W2VA 3V6HA 1YHQS 2YKPA 4PG6A 5DDRC 3RB3A 4EBCA 5G0RA 3HULA 3AQOA 2CNKB 3HHDA 3ET6A 4FYYB 4FP9A 2BKNA 4LIRA 2DPIA 2BE9B 3UNGC 1SJQA 1X4FA 2GV1A 2UUWA 3GB0A 3Q8UA 4GVBA 4OZLA 2QZ8A 4CH7A 2K8GA 3KLFB 4Y3CA 1QLNA 1IKWB 4DZ6A 2LA4A 4ZIWA 3FJ2A 1GMWD 1REVB 1VLOA 1ZBTA 3J7AN 3BBBA 1WF1A 2UXBF 4LSNB 4ZN1A 3J81j 1WTFA 3E51A 3O5TB 5F3TA 1IBLJ 3N4WA 4IH5A 1HD1A 2R7VA 2PFFB 5JVHQ 3LTOA 3VGTA 3QPIA 3VZIA 2C28A 3BJYA 1PGZA 1S1XB 4B9NA 4C6AA 1JXLA 3DLEB 1RJJA 1X5SA 3N0VA 3TZWA 3UDLA 4EU0A 2BR0A 2KFZA 3CCTA 3UN5A 4F7VA 1N8RT 1NDKA 4MK7A 3C16B 3TARA 1S59A 1WKJA 4QPTA 4UUWA 4DF8A 3GCWP 4R0EA 4ZITA 4TQSA 3PKMA 4OYZA 4ZIVA 1YG0A 2BJ1A 2ILZA 4LBHA 3QWPA 2XWYA 3SSSA 2KKHA 3TZXA 1Q53A 4J9NA 3TO8A 2LU1A 1RCOB 2WVDA 3L3CA 3HZGA 1B3TA 4IO1A 1FK9B 5BR8F 2DIVA 2YVSA 1FNOA 4G1QB 2NXJA 3S6EA 5DZ7A 4R5PA 1T02A 3I0SA 1Y10A 3CCZA 3OR2A 1RHJB 1YJRA 3V4MA 3GONA 3JQMA 2PI4A 3VHQA 3D5MA 1UFWA 2V94A 3IWXA 3KMQA 2VBWA 2UVVA 1QVFR 4OYIA 5HVHA 1T03B 4L75A 4CH0S 2DITA 3FBBA 3ZTRA 1RSCA 1C4CA 3LGHA 1SKWA 2QIFA 4Q5VA 3OV7A 3Q8YA 2UP1A 4OYAA 2HHQA 1DAXA 3I4PA 1DTQA 3MM7B 1N6QB 3TA2A 4XAKA 4DL5A 1JNRB 1M5SA 2N3LA 3CCES 1NO8A 2OHDA 4I7FB 3UCGA 4W98A 2KVQE 4DV7J 2LEBA 3D6HB 5A6WA 3BS9A 4P2FA 1NK6A 3CIMA 3AFGA 1UVNA 4OZ3A 1R31A 4EI2A 2LQ8A 1WORA 4HACB 4J91A 3PXGa 3VV2B 1ROFA 1BXNA 1VQ7S 2Z4PA 3GP9A 4K4XA 2OEJA 1HNZJ 2DD8S 2HHSA 3P49B 1YBTA 5KFAA 1EB0A 1U6ZA 5KT7A 5FLXY 2XY7A 2IDEA 3G82B 1WEXA 3PM9A 1LNQA 2A0FB 2GHPA 2ZDOA 5C7PA 4USTA 3ISND 2C22A 1LWCA 1FX4A 2O67A 5B0GA 4TYBA 4A8KA 2HHHF 2QSWA 4YR2A 1T9VA 4K5RA 4NYOA 2QLFB 2KFNA 5ETMA 2BV3A 3T5KA 2QLJB 1NAQA 1XBWA 3M8QB 4ZCKA 1RWNB 3P6YC 1WKLA 2GJFA 3RAQA 3FEZA 1KNZA 4NZ0A 2DKOB 5HMWA 1EQMA 3R7SB 5HQMA 4IOAQ 4A8SA 2R7UA 1HW9A 3HHLD 5D0RA 4P52A 1NB2A 5LMUJ 2BQRA 4CT9A 2CXEA 4ZP6A 2FUG9 2W4DA 3J7ZT 3CCSS 2DPJA 4OI1A 4X64F 4OZJA 1NK8A 4Q0BB 2BM0A 1XK8A 5LJ3Y 2MB0B 1K9MT 4W90B 1NZ8A 5A6PA 1R0AB 1Y3JA 2JLGA 4DV3F 4DV5J 2GQCA 1R89A 3F41A 1U1LA 1S0MA 3W63A 2CKWA 1MLAA 1Q78A 1VR6A 1Q5VA 2BQUA 3R7NB 1VHFA 3PYGA 4OHVA 5KG1A 3OBIA 1NSAA 3UDVA 3H4DA 3SV4A 1S1WB 3LP1B 1RK8A 2V4JB 4IFYB 2HHPA 4ZA1A 1VC0A 3P96A 5J2QA 4ZPBA 2J9CA 2GHWA 2HRUA 3MM6A 3PYEA 3QIPA 4PXBA 1X5OA 1UL3A 3WDOA 1XMOF 4RBTA 1JLAA 3VR1A 3PW2A 3RB0A 4BC7A 1QAIA 4B9UA 5E3QA 3T1YJ 3PYFA 2LEPA 3SCJE 3GFHA 4PPZA 6FD1A 1LWFA 1EZZB 1RTJB 4I2QB 4O4RA 4X4UA 2YKMA 3SDEA 4Q7AA 3TVYA 1L3UA 4WPAA 2E1CA 3U27A 5KFWA 3IS9A 2B5JA 4CTAB 2FYXA 1NCLA 5E3PA 2GAGC 4F3MA 4Z2XA 4YB5A 4ED7A 2YH0A 3GJQB 2CFXA 2V9KA 2DHGA 3G87A 4HT7A 1N34F 2M52A 1DQ8A 3PW5A 4KAIA 4WE1A 2MQQA 2DGXA 4F02A 2KRRA 1TU0B 3FSIA 1CJVA 1WSVA 2VV5A 5B09A 4GRSA 5ETSA 2UU9J 2LDIA 1S1TB 4DPXA 1OMSA 2IC3B 3M32B 7AT1B 1CEZA 1HBUB 1KP6A 2YX7A 2F63A 3GJTB 4MFBA 2M70A 5KFMA 1UWAA 4ECWA 2RQMA 3AOCA 4OIXA 3L09A 1C1CB 4C0HA 2XSJB 4OYBA 1WF2A 2E9ZA 1G6BA 1RHMB 1Q4RA 1RAAB 2DCUB 2NYHA 4RW4A 2KVIA 3ISNC 4IG3A 5ETVA 4ECZA 2MTLA 1EQ0A 4L3KA 2RQKA 2LLZA 5KFTA 1F9HA 3NNAA 3ZXWA 2JDJA 3QAUA 4CO4A 2R7WA 1ZM4A 1P1LA 4LFAJ 4M95A 2KZMA 2JRSA 2CQ4A 4QIFA 3V5RA 4IRDA 1R43A 1YJVA 1A9NB 3DKDA 3BF4A 4OJHA 1IKYB 1EETA 1FFGB 4QR1A 5HI7A 1RAJA 1CJTA 2U2FA 1NK4A 4P10A 3EVMA 1FTCA 1WI8A 4DN0A 4ES1A 1PO6A 2DCLA 4JV2A 3OXLA 1DLOB 5EN1A 5LL6d 3OTBA 4ZDNA 1F9EB 4UT4A 2NLWA 2O1PA 4Y6IA 5BYRA 1NJZA 4ED3A 3FEYB 2W9CA 1PAEX 2HBQB 3BQ1A 2FC9A 2ALZA 4M8LA 4ZLNA 5IXUA 1JJHA 4NXMF 3CJ3A 2KM8C 4FZVA 2B9WA 1XMQJ 3UN3A 1NHUA 4IDKA 1SVDA 3HSZA 3CPWR 3G9CA 3R2CJ 2B43A 3HD1A 3P5TL 4FF4A 4HVZA 4ID5B 3W5XA 1WTBA 1JJ2R 3DOKB 3V6JA 2HHXA 4K8RA 3R5CA 2MQMA 2YX1A 5AE2A 1M5OC 2UUTA 4ZPDA 4QW9A 1LWEB 2PA3A 3MD1A 4BDPA 3O2IA 2W24A 3PJXA 3QFWA 4Y28C 5AXMA 1ZM3A 3WQPA 1REGX 2MKHA 1ZM2A 4DZDA 1F60B 1U0HA 4B9MA 4DR6F 1N32J 4FNIA 2FHJA 4QBUA 1J2VA 2FHJD 4U96A 2G0IA 2XMKA 2GJIA 4Y2IA 4QWCA 1WDTA 2JFKA 1TL4A 2VG6B 2O01C 3MECA 3QWUA 5KFCA 1F9FA 2YBVA 3CDEA 4CH1A 3M9OB 1VQKS 1VC6A 1YBAA 4DG1B 4B9TA 3QT7A 3RZAA 4LF9F 1WOOA 1IQTA 2OUGA 1Y11A 4ZLJA 2KFYA 2QLXA 3WC0A 2VD3A 2NZCA 3MMJA 1JLQA 4QWAA 2DNNA 1T3NA 1RTIA 1L3VA 3G6ES 1FJEB 3R5GA 2MJUA 4J9KA 1VQLS 2FJXA 1M1HA 2FVSA 3GWCA 2RHQB 4DR3J 1CQMA 2KO1A 1P27B 2HS0A 3BPSP 4O3QA 4OMFG 3KLIB 1AXQA 1EKSA 3HSGA 4DCOB 3PW0A 3IWNC 2UXBJ 3BEGB 4FPIA 4Q8FA 2BKPA 2KB2A 3V4IB 5A8RB 2HQDA 1FFWB 2F7VA 3W9HA 4F3OA 1SC6A 2YQ3A 2CJBA 3W8PA 2A2CA 3M2RA 2GO9A 4CDIA 1HQUA 1MMNA 1VRUA 3IP0A 4KB7A 5CHCB 4BC9A 1BMQB 3C6UB 4ZOSA 5C5JA 2HVZA 2YNHA 3SSQA 1NPRA 1HYSB 3ETOA 3UW1A 1PYOB 2YY3A 3RAMA 5A2QU 2JEFA 4DSFA 4B3RJ 3MMBB 3IRXA 5GADU 5HP1B 2ADCA 3HF5A 4NX9A 1RAFB 4HLBA 4A8OA 4KFBA 2R2RA 4LREA 4AUKA 1W25A 3NG8A 5HVGA
chains in the Genus database with same CATH topology
3NRBA 1Q1KA 4PG8A 2VQFF 3QO9B 4RBUA 1YI2S 1FRIA 1C0UB 1H6KX 4PUOB 3FMWA 3BO3A 5DG7A 3LGNA 1BC6A 2DGVA 2M5YA 4KTQA 2HHWA 2GGPA 1KFSA 2XC9A 3VAKA 5FJ4A 2Q43A 4A47A 1S9GA 2RH3A 1NK9A 3A8EA 4HTIA 1Q8LA 2ZH8A 4QU6A 5G0RB 3G6VA 2APOA 1DJ0A 2C3OA 1FRJA 3GV8B 4JBCA 2DGUA 2FDNA 5JJBA 1Q8BA 2CPDA 5C24A 3WBZA 3HXMA 3DC2A 1FXRA 1NKBA 3I56S 3MEGA 1L5UA 1A6LA 1QUPA 3HKZD 1N54B 2RU9A 3MGJA 1IQZA 4NL5A 1Y9OA 1IKWA 1WHWA 2EFOA 5GAGU 4DQIA 2ZITA 1VQMS 3UE2A 4MKYA 1D8ZA 2BRKA 4O3SA 5BYSA 2RE1A 4XK8C 4EEYA 1YIJS 2VASA 2CQ1A 3B8HA 4O44A 4PG4A 4AL6A 4AL5A 3DLEA 1X9SA 1UEUA 2GA7A 1C1BA 2RJZA 1HNIA 4ED8A 1Q79A 4DR7F 3L7PA 2KG1A 2AX1A 2B51A 3TUJC 1RT5A 3FSYA 3K57A 4MYUA 3TRGA 4I6AA 2PDAA 2JL9A 4XDCA 2K1RA 4A8MP 4UY8T 2Q3PA 3KHLA 1JXEA 1WHYA 4LVNP 5KFQA 3F73A 1VBYA 4XO0A 2FJWA 2XO7A 1HWJA 2CJ9A 4ETZA 1GX5A 3LO3A 1SJ1A 4X4OA 4IUFA 4G1QA 3OL7A 1R8PA 2GIRA 3MCSA 3CC2S 2H9ZA 4R5PB 5F8GA 4ECUA 1S6PA 1VQ8S 3IAS9 3R5DA 1PSDA 2NSBA 3V6KA 4B08A 1S9FA 2RB7A 2ZHAA 3WC2A 2EVZA 2R7XA 1H0HB 2YNIB 5C25A 3C6TA 4X65F 3MM7A 3MPVA 1N6QA 2HHVA 3J7Z5 1TR0A 2C3PA 1G7CB 5DETA 3DHXA 4I67A 1HBNB 1VQOS 2BZ2A 3ZZ0A 3X1LB 4KQZA 3PIPQ 2DHXA 3KG0A 4YUDA 2QMWA 1RWUA 1S4FA 1SV5B 4TLRA 5L8RC 1ZTWA 5KOWA 2YNFA 3OR1B 3IC1A 5EDWA 3V6DA 1XR5A 1WD6A 2VKZG 2X3GA 4TQRA 4F2SA 4KHPF 1IM4A 3KMSA 3QLHA 1OWXA 4UQGA 5F8MA 2DHAA 1OSCA 4B3OB 4DSIA 1H2TZ 1Y5IB 3TOQA 3S1TA 3HVRA 2CQBA 3I9ZA 3M8QA 3TW0A 4ECVA 4QW8A 2PMHA 3RB4A 1U26A 2DTJA 2B3TB 2FLLA 3FNNA 3JSYA 3V81B 3DU6A 4GO5X 3RYLA 2CPHA 2I1RA 3PR4A 4Q0BA 1FDDA 1R0AA 3OSPA 3IFEA 5D6GA 3PKYA 4ZPTR 3CD0A 1AROP 4NA2A 3GMGA 1FERA 3M8RA 4KO0A 3BGRB 1S6UA 3Q0AA 4F4YA 3MM6B 2RDIA 5DDQC 1KOOA 2CQGA 4YDDB 2R2SA 4YOEA 4ZPWR 4KKOB 2J7WA 3GG0A 4OJGA 4QIWD 4MK9A 4DR1F 3VAIA 2QEXS 3ENQA 1Z4UA 1Y4ZB 1RTHB 4H4MB 2AWZA 2YKMB 1DQAA 3EGNA 3MDFA 3SDEB 4EO6A 1AUDA 3RRGA 1S99A 4OI6A 2ASJA 4OHYA 3PZPA 5DDOC 3PFEA 1DARA 3FSXA 1QAJA 4F4KA 3DRSB 3ZZPA 1N5QA 3NGDA 3OL6A 1JLFA 2PIIA 1JIHA 4B9VA 3W2WB 3M05A 3S01A 1UMJA 3TAPA 3BR9A 4L3NA 1ZZFA 4AFFA 1IN0A 3QYYA 4ATNA 1VFJA 2OPPA 1FDBA 2IC3A 4WFBQ 3GIKA 3CCQS 1JLBB 3B78A 3LP0B 1Q82T 2DRBA 3DM2B 4K0KF 2VOPA 1RA6A 3LALA 5GMKa 2WRMA 4RUCA 4YMEA 4PXCA 2BJDA 1KLNA 4N56A 1URNA 2LXFA 2OKQA 4IG3B 5KFDA 3NNCA 2J7KA 3HP6A 3OJUA 2O66A 1R7IA 4NLQA 3W3SA 5F8JA 5KG0A 2UVUA 4KHRA 4DBQA 3ISZA 1RT6A 2ZOGA 4DL0C 2MGZB 1TFWA 1K0TA 1ZYQA 2XS2A 4JI1F 2QMXA 1S1UA 2HHUA 4D3GA 1VJWA 2KH9A 2ZC4A 2DNYA 1K1SA 2GJ2A 2KTQA 2HGMA 3SMZA 1FHTA 1R8BA 3DFEA 3DYAA 1JB0C 4LVOP 2L9DA 4E8UA 3PR5B 4I6YA 4RBVA 4YB1P 5IZHA 4ED6A 2K7JA 4B02A 3CB4A 1BD6A 3HFKA 4NLUA 2NUHA 2LXUA 3GIIA 2OMLA 4ECYA 3I55S 4EZ6A 3K2YA 5K5MA 2OIHA 4LQ3A 3HHLA 1HBOA 1LWEA 2BOPA 1IR0A 3KG4A 4JV0A 4MYTA 3TUZC 3R5BA 2Y1IA 3P3DA 3UR3C 3KK2A 3KNGA 1FRMA 5GAEI 2FHKA 3HVAA 2J6SA 1RT2B 4I2PB 4KE5A 3MMCA 3SCKE 3M6UA 5G4DA 4DG1A 3OLAA 3QJPA 3CCRS 2LEAA 1O51A 4O23A 1OO0B 1WEYA 2KT2A 3CWJA 4WK3A 4MH8A 3TA0A 2I5JA 5CA5A 1FEHA 5A8KA 4NRUA 4ZK7M 4MKBA 2C3YA 2ZJRQ 5HO4A 5DM6Q 1G2EA 5JXSA 5KG6A 4PR6A 5CYMB 4DR5F 4DV1F 4PWDB 3H5UA 4WTYA 2ROGA 4A48A 1UVIA 2KHCA 1KHVA 2DH9A 5CXTA 3GV7B 4OLPA 3LUYA 3U1MA 2ROPA 4IG0A 1OQ6A 4KC5A 3PO5A 3BQ0A 4Q8EA 3OVAA 1LK5A 2XHWA 3AA8A 1KTVA 1VIXA 2OPSA 4ITSA 1FJGF 2CPXA 3N5FA 4FF3A 4KGKA 3CCVS 1KVJA 3DI6B 2Z2LA 3N28A 1KQSR 2R8KA 2VFRA 5EX0A 2P6TA 2DGQA 4KIAA 3V2UC 5J1EA 2N82B 4RU2A 2IAJB 2MKJA 4BBYA 4FXVA 5HP1A 3I4HX 1Q8IA 4ZVEA 3MAHA 2XCAA 1GTHA 1JKHB 4OZ0A 3FZ2A 5F3ZA 1HI1A 2QYCA 3ENVA 2MKCA 4HH1A 2RKIA 4C11B 2IBKA 3PJWA 1V9OA 3FMBA 1FESA 1Z2ZA 4PUOA 2LXIA 2HFZA 2BUNA 1TK0A 4DV0F 5E7OB 1S1VB 4BWMA 4WFYA 4Y65A 3KLHB 3K8WA 2MJNA 1GXLA 3VWSA 2NUUG 4DX8H 3LWLA 2YTCA 4DUZF 1O0PA 4LF9F 3DN9A 1TL1A 4DUYF 4M1KA 5I3UB 2I9SA 5EHHA 4R8UB 1MWYA 1U25A 1UJ4A 4ES2A 4RZRA 3KLGB 2VBZA 3QMQA 2HNZA 2HZCA 3OTDA 1N5YB 3WX4A 1O8BA 2DGOA 5KFLA 4WZQA 5C24B 3PW4A 1KC8T 1VQ6S 2JEGA 2DGTA 2OTLS 3B4DA 3CD5A 3AH6A 4BWJA 2N3OA 2LQJA 2NPIA 3GIMA 2D3OR 4URGA 3THTA 2F1FA 3NGKA 1XERA 2FJAB 3FGVA 1JLEA 3MUTP 1FNMA 5H1SV 3CCLS 3RB6A 1T05A 5EWFA 1FNXH 3QJLA 3ZFVA 2OFHX 5EWGA 1OQ3A 1S0OA 3ZZOA 1QSYA 3HHNB 3FZBA 4OX9F 5GAEU 4NA3A 1B0VA 5T41A 1SJFA 2XMTA 1TV6A 2E44A 4O44B 3T9NA 1S6OA 4KJIA 4Y00A 5L39A 1HPZB 3FQKA 3BR8A 1C1BB 2XS5A 2IRXA 3HMJG 1SH0A 4RW9A 1DHMA 3VQTA 1S97A 3TI0A 4QU7A 3FRYA 1L3KA 3SI8A 4QIEA 3POTA 4Q2LA 5KG4A 2SXLA 4JI3F 4I68A 3RAXA 3IG1B 2RNEA 4N77A 1JNZB 3DGPA 1TAQA 5LXRA 2HVHA 4QWBA 2O3DA 2YWFA 5EUHA 2ZOFA 1TP7A 5F0UA 1S72S 2D1CA 2W7OA 4NCBA 3K5OA 3S7RA 4FF2A 2J0XA 4DFKA 5EGYA 3QGPA 4DLGA 2HMIB 4IR1A 2NREA 3NNHA 3O8WA 2JLFA 2YNGA 1S6PB 2POKA 2G9OA 2XULA 2WHOA 4TXSA 4I64A 3KNAA 2CYYA 4KRWA 4J9QA 4GKJF 2GMLA 2JOQA 5F8NA 1G3OA 5KFSA 1F5AA 2CQHA 3M4XA 3G8SA 3KKFA 2R4FA 3VAFA 3O44A 1HI8A 5C25B 2ZH4A 3MR3A 1FXLA 2QA4S 1UJ5A 2OSQA 4BCAA 5LSRA 1CQNA 5LSLA 4HYKA 2IHR1 1YJUA 2OP5A 1VQNS 5KFKA 4Y2CA 3OHAA 4K4TA 4L72B 3K5LA 2VL1A 1MNEA 3MR5A 3HVWA 1FDNA 1SUQB 3US5A 2EG2A 2HQ3A 1T8EA 5ITHA 4RW7A 5IT9Y 2XMVA 1UA1A 1SV5A 4WZMA 2I8EA 2ZBCA 2GFFA 2YNFB 3OR1A 1C4AA 2AQ4A 3HT3A 1U6BA 1NJXA 3I31A 2MQLA 3W7BA 2MZTA 3BDEA 3HPOA 1F0XA 2ZDPA 2R2UA 2HLUA 3R5AA 5DJBA 3CDBA 5LXYA 1WHXA 2IM3A 4NXNF 3OFGA 4M94A 4B9SA 1HNVB 4OX7A 5L1JA 1Q7YT 3DRYA 3MUVP 2CQDA 3OTOF 1ULRA 3EUNA 3MM8B 3LW5C 4DFJA 4O3PA 1UFLA 3I0SB 3OR2B 1MWZA 5CYJA 3DMJA 2KYZA 3K5MA 1SKRA 3QJJA 2RS2A 3BGUA 2QA1A 2YWHA 5FDLB 4N8NA 4DMZA 1N5SA 4AXJA 4DQSA 4RW6A 3OFHA 4X4TA 2OFGX 1LOUA 5L9XA 2E1AA 4HI2A 4I7FA 2E7XA 4OHZA 4F8RA 1TKZA 2J9DA 4LSLA 5BYQA 2VA2A 1MSWD 1RTHA 4H4MA 4C8ZA 2AP6A 2L3MA 3R3TA 3QZ7A 4RX6A 2ZKTA 4X84A 3UWTA 2V5HG 3CGIA 2IYGA 2V4QA 1U09A 2A10A 2UV8A 5HBMA 5M2PA 2PT0A 3LH2S 3M1VA 2RRBA 3PRDA 2MZRA 2V2KA 4LT6A 3MMAB 1SBRA 2EKYA 5KFYA 5HQ8A 4C8OA 2KXFA 4OQJA 2P5VA 4F26A 4V19X 1RDRA 3SEOA 1GT8A 4P6QA 1TKDA 2OPPB 3KK1B 1TAUA 4JOUA 1TQLA 2WB4A 2DHSA 3CDWA 2GC8A 2D7SA 1NKEA 5E41A 1W2BR 2LQBA 4DQPA 5GAGI 4X4PA 2JWNA 1S0VA 3LQVA 2FVCA 3GFYA 2E5GA 2QV6A 3DLKB 3GR0A 3IWLA 3TP2A 5LMNF 2V4RA 2ZFHA 2HNYB 2AGQA 1VQYA 3F44A 3HJFA 4DEZA 1U1RA 4LIWA 2YX4A 2MGZA 3SXLA 2Z2MA 4ED1A 2FY1A 1VC5A 2C42A 4CZCA 1X0FA 1K8AT 1YJWS 3D28A 2JX2A 2WBRA 2DR9A 4U9RA 5KFJA 2ILYA 2JZ5A 4QIVA 3BSCA 4KV8B 2GO8A 4NPOA 3MEEA 2D3UA 3VF0B 2CPIA 2E1MC 1X4BA 4USIA 1U1QA 2HWTA 4M63A 1MW7A 3IS9B 4IH6A 5F8HA 3FRZA 3MTKA 6FDRA 2DNPA 2RVJA 2VBYA 3I9V9 4K4SA 4JUZA 4O3NA 1Q16B 3U02A 4FS1A 1UVJA 1IKVA 3UQSA 1OPIA 1HR0F 4FBTA 2E5IA 4IR9A 4WIIA 2GIQA 3F56A 2J9EA 2R7RA 4ZHRB 1S48A 2HRYA 1Y3KA 3M32A 1XMBA 5SUHA 4MFBB 5CCMA 3OVSA 3KK2B 4F3QA 1UWBB 3RU0A 2F3JA 1F5CA 3K59A 5C42A 3BO4A 1N5TA 2QA4G 2M9KA 3KFWX 4ZPVR 2OPQA 3THPA 2UXDF 5LMUF 1HWIA 4G6VB 2GNKA 4ZLPA 3K7RA 2EFQA 4DPOA 2BYCA 4QQBA 1FO1A 5A2QY 1S9EB 1OPZA 3QZ8A 4C8KA 1U8SA 2WOMB 2R8IA 2J8AA 3VAMA 3UD4P 1RA7A 1NH8A 2ZVSA 4HT5A 2VOOA 1X4AA 1JLCB 4WYLA 2X1AA 1L3TA 4A8YA 2Q1LA 4FBUA 3Q2SC 2E1RA 4IG0B 1RT7A 1YRXA 1HWLA 3HX9A 4ID8A 2HWHA 2PEHA 4PG5A 3CJKA 2G1DA 2CPEA 1FJCA 3Q8PB 1RQ0A 4UOCA 1ZOTA 3S8SA 1KTQA 1X4GA 5J2NB 5I42B 4O3RA 3K8VA 5KAKA 3VAGA 3MOJB 3I6PA 3LP2A 4TU7A 3DOKA 1DZ5A 2DGSA 4N41A 2VC0A 3NP5A 5D3GA 2RUGA 3EGZA 4WJBA 1I6JA 1QJHA 4C11A 4EWTA 3SQGB 3TAQA 3PHEA 2XMWA 2GQ2A 4L6V3 1R8AA 3MD3A 3PNIA 4Q43A 4A8WA 4UQTA 3KLFA 3MPWA 3MF5A 2VG6A 2A3JA 4FVCA 5AXNA 1WACA 1SL1A 3JAMY 5KFFA 4K2XA 4BS2A 1TL1B 3NMRA 2KDOA 5I3UA 3DLJA 4MK8A 1DRZA 4PQAA 5KG7A 4RUAA 3J7YI 3HVTA 1XTZA 3DRXA 5D77A 2AGPA 5B0BA 4OZ1A 4XDDA 2HNZB 2ZE2A 2OMOA 4U7CA 3TVKA 2NZ4A 3KLIA 4YP3A 4NCAA 3Q24A 1KSPA 4WFAQ 2I38A 4KSEB 2EK6A 3J80Y 3G8QA 4X62F 2MY8A 5A8RA 2IFXA 4EBDA 2Y1RI 1N36F 2F4VF 2CZ4A 2GW8A 1WELA 4URQU 2AYBA 2D74B 2AD9A 3C6UA 1MROB 2IYIA