2FGQX

High resolution x-ray structure of omp32 in complex with malate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
330
structure length
330
Chain Sequence
SVTLFGIVDTNVAYVNKDAAGDSRYGLGTSGASTSRLGLRGTEDLGGGLKAGFWLEGEIFGDDGNASGFNFKRRSTVSLSGNFGEVRLGRDLVPTSQKLTSYDLFSATGIGPFMGFRNWAAGQGADDNGIRANNLISYYTPNFGGFNAGFGYAFDEKQTIGTADSVGRYIGGYVAYDNGPLSASLGLAQQKTAVGGLATDRDEITLGASYNFGVAKLSGLLQQTKFKRDIGGDIKTNSYMLGASAPVGGVGEVKLQYALYDQKAIDSKAHQITLGYVHNLSKRTALYGNLAFLKNKDASTLGLQAKGVYAGGVQAGESQTGVQVGIRHAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane porin protein 32
publication title High resolution crystal structures and molecular dynamics studies reveal substrate binding in the porin omp32
pubmed doi rcsb
molecule tags Membrane protein
total genus 92
structure length 330
sequence length 330
ec nomenclature
pdb deposition date 2005-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2fgqX00
3VZWX 4KR8A 5DL5A 2Y0LA 3FYXA 2PORA 3HWBA 4D64A 2Y2XA 4JFBA 2Y0KA 4RJXA 1HXXA 3K19A 5FVNA 2XE1A 3T20A 3POUA 2XE3A 3UU2A 3EMNX 3SZVA 4FSOA 1MPFA 3A2SX 3PRNA 3T24A 4LSFA 3WI4A 3VZUX 1PRNA 3VY9X 3SYBA 2XE5A 2OMFA 1GFOA 2QTKA 1BH3A 1HXUA 2ZLDA 4KRAA 2ZFGA 4LSEA 4LSIA 3NSGA 4FMSA 3VZTX 4D5UA 4GCPA 2K4TA 2XG6A 7PRNA 1GFPA 3SY7A 4AUIA 1GFQA 3SYSA 5DL6A 3T0SA 2FGQX 1E54A 4LSHA 3POXA 3UPGA 3JTYA 3SY9A 5PRNA 4KR4A 1GFNA 1OPFA 1H6S1 4RJWA 5JDPA 2ODJA 4BUMX 4FRXA 1PHOA 3PORA 4FT6A 1HXTA 3POQA 2J4UP 3WI5A 8PRNA 2XE2A 3VY8X 4D65A 2O4VA 4GCQA 5DL7A 4FRTA 3HW9A 2FGRA 3O0EA 1OSMA 2Y0HA 4C69X 4FOZA 3SZDA 4FSPA 2PRNA 4GCSA 2J1NA 1BT9A 5DL8A 1GFMA 6PRNA
chains in the Genus database with same CATH superfamily
3VZWX 4KR8A 4O3ZA 2M06A 3PGUA 5DL5A 3V8UA 1IZNB 3VE2A 2Y0LA 3FYXA 2R88A 3AA6A 4O49A 5AFUK 2F1TA 1THQA 4GHBA 3UAQA 3DA3A 2PORA 4N59A 2N2LA 3HWBA 4D64A 2R4PA 2Y2XA 4O4XA 4JFBA 4N75A 2Y0KA 4RJXA 1HXXA 3AAEB 3K19A 3BRZA 4XNKA 2XE1A 2WJQA 5D5DA 5FVNA 3T20A 4U9CA 2JMMA 4XNLA 3PGSA 4F4BA 2AXTO 2M07A 3POUA 1BXWA 1IZNA 3VE1A 2XE3A 1Q9GA 3UU2A 3EMNX 5G38A 3SZVA 3DA4A 3DWNA 4FSOA 4K3CA 1MPFA 3A2SX 3LK42 3DZMA 2R8AA 2F1CX 3PRNA 3T24A 3KZIO 3AA0A 2IWVA 4B61A 3LK2B 5KAFO 4LSFA 4GF4A 1ZHXA 3BS0A 2JQYA 2W80C 3WI4A 3VZUX 1PRNA 3PGRA 3VY9X 2X9KA 4FZLA 4O3XB 3JCUO 1ZHZA 3LK3B 4E1TA 4Z3TA 4PJ0O 5EE2A 1T16A 5H2FO 3SYBA 2XE5A 4FUVA 4AYID 5GTIO 5IYUA 2KXPB 3DWOX 2OMFA 2LFUA 1GFOA 2QTKA 3AAAB 3AA7A 1BH3A 1HXUA 2IWWA 2ZLDA 2XTQA 4KRAA 2ZFGA 3GP6A 3PQSA 3QRCA 4IL6O 4LSIA 4LSEA 5G39A 2KC0A 5T5FA 3C5OA 3NSGA 4FMSA 3VZTX 5B66O 2KZ7B 4AFKA 4D5UA 3A0HO 1T1LA 4FESA 4GCPA 5KAIO 2LHFA 3AAEA 1QJ9A 4AKMA 4AKRB 4C4VB 2K4TA 2XG6A 4O4UA 4PUXA 7PRNA 1MM4A 2GE4A 1GFPA 3A0BO 3SY7A 4AUIA 1GFQA 5GTHO 3AA1B 3SYSA 5TISO 5GV0A 5DL6A 4AYNA 4JCHA 2WJRA 3T0SA 4RLBA 2FGQX 1E54A 5E79O 4LSHA 1ORMA 3POXA 3PF1A 4G76A 2YNKA 4K3BA 5ADXL 3UPGA 3JTYA 3SY9A 1ZHTA 2R4LA 5PRNA 3NJTA 4KR4A 3AA6B 1GFNA 4C4VA 1OPFA 2KDYA 4G75A 3RBHA 1H6S1 2F1VA 4RJWA 5JDPA 3LK2A 4AYMC 2ODJA 4BUMX 5ADXK 4FRXA 4UB6O 5AFUL 1PHOA 3PORA 4FT6A 3WU2O 1Q9FA 1HXTA 4FZMA 3LK3A 2X27X 2MNHA 3POQA 4N58A 2N2MA 2J4UP 3WI5A 8PRNA 1S5LO 2XE2A 5G26A 2KXPA 5G3AA 3VY8X 4D65A 4FQEA 4FZNA 4O3YA 4E1SA 4RL9A 1YS5A 4AYEC 2O4VA 4GCQA 3AAAA 4PR7A 5DL7A 4O3WA 3TZGA 3G7GA 1G90A 2R4NA 4FRTA 4QQ1A 2W81C 2Y7SA 3HW9A 3BRYA 2FGRA 3AA0B 3PQUA 3O0EA 4UB8O 1OSMA 2YPVA 2KZ7A 1P4TA 2Y0HA 2XTRA 2WVPA 2ERVA 2K0LA 4AKRA 5B5EO 3HOLA 4C69X 4FOZA 4CTDA 1ZHYA 2R4OA 3LK41 4FSPA 3SZDA 3AA1A 1MM5A 2PRNA 2MHLA 2R89A 3KVDD 4RLCA 4AZLA 4GCSA 2J1NA 4AYDC 4C00A 1BT9A 3HOEA 5DL8A 2XMXA 1QJPA 4N74A 1GFMA 6PRNA 3QRAA 1QJ8A 1ZHWA 3AA7B
chains in the Genus database with same CATH topology
3VZWX 4KR8A 4O3ZA 2M06A 3VE2A 5DL5A 3V8UA 1IZNB 2Y0LA 3FYXA 4O49A 3AA6A 5AFUK 2F1TA 1THQA 4GHBA 3UAQA 3DA3A 2PORA 4N59A 2N2LA 3HWBA 4D64A 2Y2XA 4O4XA 4JFBA 2Y0KA 4RJXA 1HXXA 3AAEB 3K19A 4XNKA 5FVNA 2XE1A 5D5DA 3T20A 4U9CA 2JMMA 4XNLA 4F4BA 2M07A 3POUA 1BXWA 1IZNA 3VE1A 2XE3A 1Q9GA 3UU2A 3EMNX 3SZVA 3DA4A 4FSOA 1MPFA 3A2SX 3LK42 3PRNA 3T24A 3AA0A 4B61A 3LK2B 4LSFA 4GF4A 1ZHXA 2W80C 3WI4A 3VZUX 1PRNA 3VY9X 4FZLA 4O3XB 4E1TA 3LK3B 1ZHZA 4Z3TA 5EE2A 5IYUA 3SYBA 2XE5A 4FUVA 4AYID 2KXPB 2OMFA 2LFUA 1GFOA 2QTKA 3AAAB 3AA7A 1BH3A 1HXUA 2ZLDA 2XTQA 4KRAA 2ZFGA 3GP6A 3PQSA 3QRCA 4LSEA 4LSIA 5T5FA 2KC0A 3C5OA 3NSGA 4FMSA 3VZTX 2KZ7B 4AFKA 4D5UA 4FESA 4GCPA 2LHFA 3AAEA 1QJ9A 4AKMA 4AKRB 2K4TA 2XG6A 4O4UA 4PUXA 7PRNA 1MM4A 2GE4A 1GFPA 3SY7A 4AUIA 1GFQA 3AA1B 3SYSA 5GV0A 5DL6A 4AYNA 4JCHA 3T0SA 4RLBA 2FGQX 1E54A 4LSHA 1ORMA 3POXA 4G76A 5ADXL 2YNKA 3UPGA 3JTYA 3SY9A 1ZHTA 5PRNA 4KR4A 3AA6B 1GFNA 1OPFA 2KDYA 4G75A 3RBHA 1H6S1 2F1VA 4RJWA 5JDPA 3LK2A 4AYMC 2ODJA 4BUMX 5ADXK 4FRXA 5AFUL 1PHOA 3PORA 4FT6A 1Q9FA 1HXTA 4FZMA 3LK3A 2X27X 2MNHA 3POQA 4N58A 2N2MA 2J4UP 3WI5A 8PRNA 2XE2A 5G26A 2KXPA 3VY8X 4D65A 4FZNA 4O3YA 4E1SA 4RL9A 1YS5A 4AYEC 2O4VA 4GCQA 3AAAA 5DL7A 4O3WA 3TZGA 3G7GA 1G90A 4FRTA 4QQ1A 2W81C 2Y7SA 3HW9A 2FGRA 3AA0B 3PQUA 3O0EA 1OSMA 2YPVA 2KZ7A 1P4TA 2Y0HA 2XTRA 4AKRA 2ERVA 2K0LA 3HOLA 4C69X 4FOZA 1ZHYA 3LK41 4FSPA 3SZDA 3AA1A 1MM5A 2PRNA 2MHLA 3KVDD 4RLCA 4AZLA 4GCSA 2J1NA 4AYDC 1BT9A 3HOEA 5DL8A 2XMXA 1QJPA 1GFMA 6PRNA 3QRAA 1QJ8A 1ZHWA 3AA7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VZW X;  4KR8 A;  5DL5 A;  2Y0L A;  3FYX A;  2POR A;  3HWB A;  4D64 A;  2Y2X A;  4JFB A;  2Y0K A;  4RJX A;  1HXX A;  3K19 A;  5FVN A;  2XE1 A;  3T20 A;  3POU A;  2XE3 A;  3UU2 A;  3EMN X;  3SZV A;  4FSO A;  1MPF A;  3A2S X;  3PRN A;  3T24 A;  4LSF A;  3WI4 A;  3VZU X;  1PRN A;  3VY9 X;  3SYB A;  2XE5 A;  2OMF A;  1GFO A;  2QTK A;  1BH3 A;  1HXU A;  2ZLD A;  4KRA A;  2ZFG A;  4LSE A;  4LSI A;  3NSG A;  4FMS A;  3VZT X;  4D5U A;  4GCP A;  2K4T A;  2XG6 A;  7PRN A;  1GFP A;  3SY7 A;  4AUI A;  1GFQ A;  3SYS A;  5DL6 A;  3T0S A;  2FGQ X;  1E54 A;  4LSH A;  3POX A;  3UPG A;  3JTY A;  3SY9 A;  5PRN A;  4KR4 A;  1GFN A;  1OPF A;  1H6S 1;  4RJW A;  5JDP A;  2ODJ A;  4BUM X;  4FRX A;  1PHO A;  3POR A;  4FT6 A;  1HXT A;  3POQ A;  2J4U P;  3WI5 A;  8PRN A;  2XE2 A;  3VY8 X;  4D65 A;  2O4V A;  4GCQ A;  5DL7 A;  4FRT A;  3HW9 A;  2FGR A;  3O0E A;  1OSM A;  2Y0H A;  4C69 X;  4FOZ A;  3SZD A;  4FSP A;  2PRN A;  4GCS A;  2J1N A;  1BT9 A;  5DL8 A;  1GFM A;  6PRN A; 
#chains in the Genus database with same CATH topology
 3VZW X;  4KR8 A;  4O3Z A;  2M06 A;  3PGU A;  5DL5 A;  3V8U A;  1IZN B;  3VE2 A;  2Y0L A;  3FYX A;  2R88 A;  3AA6 A;  4O49 A;  5AFU K;  2F1T A;  1THQ A;  4GHB A;  3UAQ A;  3DA3 A;  2POR A;  4N59 A;  2N2L A;  3HWB A;  4D64 A;  2R4P A;  2Y2X A;  4O4X A;  4JFB A;  4N75 A;  2Y0K A;  4RJX A;  1HXX A;  3AAE B;  3K19 A;  3BRZ A;  4XNK A;  2XE1 A;  2WJQ A;  5D5D A;  5FVN A;  3T20 A;  4U9C A;  2JMM A;  4XNL A;  3PGS A;  4F4B A;  2AXT O;  2M07 A;  3POU A;  1BXW A;  1IZN A;  3VE1 A;  2XE3 A;  1Q9G A;  3UU2 A;  3EMN X;  5G38 A;  3SZV A;  3DA4 A;  3DWN A;  4FSO A;  4K3C A;  1MPF A;  3A2S X;  3LK4 2;  3DZM A;  2R8A A;  2F1C X;  3PRN A;  3T24 A;  3KZI O;  3AA0 A;  2IWV A;  4B61 A;  3LK2 B;  5KAF O;  4LSF A;  4GF4 A;  1ZHX A;  3BS0 A;  2JQY A;  2W80 C;  3WI4 A;  3VZU X;  1PRN A;  3PGR A;  3VY9 X;  2X9K A;  4FZL A;  4O3X B;  3JCU O;  1ZHZ A;  3LK3 B;  4E1T A;  4Z3T A;  4PJ0 O;  5EE2 A;  1T16 A;  5H2F O;  3SYB A;  2XE5 A;  4FUV A;  4AYI D;  5GTI O;  5IYU A;  2KXP B;  3DWO X;  2OMF A;  2LFU A;  1GFO A;  2QTK A;  3AAA B;  3AA7 A;  1BH3 A;  1HXU A;  2IWW A;  2ZLD A;  2XTQ A;  4KRA A;  2ZFG A;  3GP6 A;  3PQS A;  3QRC A;  4IL6 O;  4LSI A;  4LSE A;  5G39 A;  2KC0 A;  5T5F A;  3C5O A;  3NSG A;  4FMS A;  3VZT X;  5B66 O;  2KZ7 B;  4AFK A;  4D5U A;  3A0H O;  1T1L A;  4FES A;  4GCP A;  5KAI O;  2LHF A;  3AAE A;  1QJ9 A;  4AKM A;  4AKR B;  4C4V B;  2K4T A;  2XG6 A;  4O4U A;  4PUX A;  7PRN A;  1MM4 A;  2GE4 A;  1GFP A;  3A0B O;  3SY7 A;  4AUI A;  1GFQ A;  5GTH O;  3AA1 B;  3SYS A;  5TIS O;  5GV0 A;  5DL6 A;  4AYN A;  4JCH A;  2WJR A;  3T0S A;  4RLB A;  2FGQ X;  1E54 A;  5E79 O;  4LSH A;  1ORM A;  3POX A;  3PF1 A;  4G76 A;  2YNK A;  4K3B A;  5ADX L;  3UPG A;  3JTY A;  3SY9 A;  1ZHT A;  2R4L A;  5PRN A;  3NJT A;  4KR4 A;  3AA6 B;  1GFN A;  4C4V A;  1OPF A;  2KDY A;  4G75 A;  3RBH A;  1H6S 1;  2F1V A;  4RJW A;  5JDP A;  3LK2 A;  4AYM C;  2ODJ A;  4BUM X;  5ADX K;  4FRX A;  4UB6 O;  5AFU L;  1PHO A;  3POR A;  4FT6 A;  3WU2 O;  1Q9F A;  1HXT A;  4FZM A;  3LK3 A;  2X27 X;  2MNH A;  3POQ A;  4N58 A;  2N2M A;  2J4U P;  3WI5 A;  8PRN A;  1S5L O;  2XE2 A;  5G26 A;  2KXP A;  5G3A A;  3VY8 X;  4D65 A;  4FQE A;  4FZN A;  4O3Y A;  4E1S A;  4RL9 A;  1YS5 A;  4AYE C;  2O4V A;  4GCQ A;  3AAA A;  4PR7 A;  5DL7 A;  4O3W A;  3TZG A;  3G7G A;  1G90 A;  2R4N A;  4FRT A;  4QQ1 A;  2W81 C;  2Y7S A;  3HW9 A;  3BRY A;  2FGR A;  3AA0 B;  3PQU A;  3O0E A;  4UB8 O;  1OSM A;  2YPV A;  2KZ7 A;  1P4T A;  2Y0H A;  2XTR A;  2WVP A;  2ERV A;  2K0L A;  4AKR A;  5B5E O;  3HOL A;  4C69 X;  4FOZ A;  4CTD A;  1ZHY A;  2R4O A;  3LK4 1;  4FSP A;  3SZD A;  3AA1 A;  1MM5 A;  2PRN A;  2MHL A;  2R89 A;  3KVD D;  4RLC A;  4AZL A;  4GCS A;  2J1N A;  4AYD C;  4C00 A;  1BT9 A;  3HOE A;  5DL8 A;  2XMX A;  1QJP A;  4N74 A;  1GFM A;  6PRN A;  3QRA A;  1QJ8 A;  1ZHW A;  3AA7 B; 
#chains in the Genus database with same CATH homology
 3VZW X;  4KR8 A;  4O3Z A;  2M06 A;  3VE2 A;  5DL5 A;  3V8U A;  1IZN B;  2Y0L A;  3FYX A;  4O49 A;  3AA6 A;  5AFU K;  2F1T A;  1THQ A;  4GHB A;  3UAQ A;  3DA3 A;  2POR A;  4N59 A;  2N2L A;  3HWB A;  4D64 A;  2Y2X A;  4O4X A;  4JFB A;  2Y0K A;  4RJX A;  1HXX A;  3AAE B;  3K19 A;  4XNK A;  5FVN A;  2XE1 A;  5D5D A;  3T20 A;  4U9C A;  2JMM A;  4XNL A;  4F4B A;  2M07 A;  3POU A;  1BXW A;  1IZN A;  3VE1 A;  2XE3 A;  1Q9G A;  3UU2 A;  3EMN X;  3SZV A;  3DA4 A;  4FSO A;  1MPF A;  3A2S X;  3LK4 2;  3PRN A;  3T24 A;  3AA0 A;  4B61 A;  3LK2 B;  4LSF A;  4GF4 A;  1ZHX A;  2W80 C;  3WI4 A;  3VZU X;  1PRN A;  3VY9 X;  4FZL A;  4O3X B;  4E1T A;  3LK3 B;  1ZHZ A;  4Z3T A;  5EE2 A;  5IYU A;  3SYB A;  2XE5 A;  4FUV A;  4AYI D;  2KXP B;  2OMF A;  2LFU A;  1GFO A;  2QTK A;  3AAA B;  3AA7 A;  1BH3 A;  1HXU A;  2ZLD A;  2XTQ A;  4KRA A;  2ZFG A;  3GP6 A;  3PQS A;  3QRC A;  4LSE A;  4LSI A;  5T5F A;  2KC0 A;  3C5O A;  3NSG A;  4FMS A;  3VZT X;  2KZ7 B;  4AFK A;  4D5U A;  4FES A;  4GCP A;  2LHF A;  3AAE A;  1QJ9 A;  4AKM A;  4AKR B;  2K4T A;  2XG6 A;  4O4U A;  4PUX A;  7PRN A;  1MM4 A;  2GE4 A;  1GFP A;  3SY7 A;  4AUI A;  1GFQ A;  3AA1 B;  3SYS A;  5GV0 A;  5DL6 A;  4AYN A;  4JCH A;  3T0S A;  4RLB A;  2FGQ X;  1E54 A;  4LSH A;  1ORM A;  3POX A;  4G76 A;  5ADX L;  2YNK A;  3UPG A;  3JTY A;  3SY9 A;  1ZHT A;  5PRN A;  4KR4 A;  3AA6 B;  1GFN A;  1OPF A;  2KDY A;  4G75 A;  3RBH A;  1H6S 1;  2F1V A;  4RJW A;  5JDP A;  3LK2 A;  4AYM C;  2ODJ A;  4BUM X;  5ADX K;  4FRX A;  5AFU L;  1PHO A;  3POR A;  4FT6 A;  1Q9F A;  1HXT A;  4FZM A;  3LK3 A;  2X27 X;  2MNH A;  3POQ A;  4N58 A;  2N2M A;  2J4U P;  3WI5 A;  8PRN A;  2XE2 A;  5G26 A;  2KXP A;  3VY8 X;  4D65 A;  4FZN A;  4O3Y A;  4E1S A;  4RL9 A;  1YS5 A;  4AYE C;  2O4V A;  4GCQ A;  3AAA A;  5DL7 A;  4O3W A;  3TZG A;  3G7G A;  1G90 A;  4FRT A;  4QQ1 A;  2W81 C;  2Y7S A;  3HW9 A;  2FGR A;  3AA0 B;  3PQU A;  3O0E A;  1OSM A;  2YPV A;  2KZ7 A;  1P4T A;  2Y0H A;  2XTR A;  4AKR A;  2ERV A;  2K0L A;  3HOL A;  4C69 X;  4FOZ A;  1ZHY A;  3LK4 1;  4FSP A;  3SZD A;  3AA1 A;  1MM5 A;  2PRN A;  2MHL A;  3KVD D;  4RLC A;  4AZL A;  4GCS A;  2J1N A;  4AYD C;  1BT9 A;  3HOE A;  5DL8 A;  2XMX A;  1QJP A;  1GFM A;  6PRN A;  3QRA A;  1QJ8 A;  1ZHW A;  3AA7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...