2FGRA

High resolution xray structure of omp32
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
332
structure length
332
Chain Sequence
ESSVTLFGIVDTNVAYVNKDAAGDSRYGLGTSGASTSRLGLRGTEDLGGGLKAGFWLEGEIFGDDGNASGFNFKRRSTVSLSGNFGEVRLGRDLVPTSQKLTSYDLFSATGIGPFMGFRNWAAGQGADDNGIRANNLISYYTPNFGGFNAGFGYAFDEKQTIGTADSVGRYIGGYVAYDNGPLSASLGLAQQKTAVGGLATDRDEITLGASYNFGVAKLSGLLQQTKFKRDIGGDIKTNSYMLGASAPVGGVGEVKLQYALYDQKAIDSKAHQITLGYVHNLSKRTALYGNLAFLKNKDASTLGLQAKGVYAGGVQAGESQTGVQVGIRHAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structures and molecular dynamics studies reveal substrate binding in the porin omp32
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords Outer membrane porin protein 32
total genus 92
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2005-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2fgrA00
3JTYA 4LSIA 3T24A 3PORA 2ZLDA 1HXXA 4KR4A 2ODJA 4D5UA 2Y2XA 3T0SA 2Y0LA 4LSHA 3SZDA 2J4UP 4FRXA 4GCQA 4FMSA 8PRNA 3VZTX 3VY8X 3POUA 2XG6A 5DL7A 3SY9A 1PHOA 3WI4A 5DL8A 4D65A 3SYBA 3SZVA 3O0EA 1OSMA 1GFPA 1HXUA 2XE5A 2FGQX 4GCPA 3PRNA 2PORA 1GFNA 2J1NA 7PRNA 1PRNA 3NSGA 1E54A 3SYSA 4RJXA 3VY9X 4FSPA 5DL5A 2FGRA 2OMFA 3POXA 1BH3A 5JDPA 4LSFA 5PRNA 2K4TA 2Y0KA 4JFBA 3HWBA 4RJWA 1MPFA 3K19A 4LSEA 5DL6A 3SY7A 4FT6A 4FOZA 5FVNA 1HXTA 3VZWX 3EMNX 3FYXA 6PRNA 4BUMX 1GFMA 3WI5A 2PRNA 3HW9A 3POQA 1BT9A 2ZFGA 1GFQA 3A2SX 2O4VA 3T20A 2XE2A 3VZUX 2XE1A 4KR8A 4C69X 4AUIA 3UPGA 1GFOA 4GCSA 4D64A 2QTKA 2Y0HA 1H6S1 3UU2A 2XE3A 4FRTA 1OPFA 4FSOA 4KRAA
chains in the Genus database with same CATH superfamily
2M06A 4AYEC 3JTYA 3AAEB 4RLCA 4LSIA 5G39A 3PORA 3T24A 3HOLA 2ZLDA 1HXXA 2KC0A 4KR4A 2ODJA 3LK3A 4FESA 3A0BO 4AYMC 5E79O 2W81C 3DA3A 2J4UP 4N58A 4D5UA 1MM4A 4CTDA 2R4LA 3LK42 3VE2A 2Y2XA 3T0SA 4C4VB 3V8UA 4JCHA 5B5EO 2Y0LA 4LSHA 1ORMA 2K0LA 3SZDA 4FRXA 4FZMA 4FMSA 4GCQA 1T1LA 3VZTX 8PRNA 2AXTO 5GV0A 3VY8X 3POUA 2GE4A 2XG6A 2F1TA 5D5DA 2KZ7A 4RL9A 5DL7A 5G26A 1PHOA 2KZ7B 2N2LA 3SY9A 3WI4A 5DL8A 4U9CA 4D65A 3PGSA 2IWVA 2XMXA 3SYBA 4AKRB 1ZHZA 2R89A 1ZHWA 3SZVA 2ERVA 3O0EA 1OSMA 4G75A 1GFPA 1HXUA 3DZMA 2XE5A 1S5LO 4FZLA 4PUXA 5B66O 1QJ8A 2FGQX 3NJTA 3PRNA 2XTQA 4GCPA 4O4XA 3LK2B 4QQ1A 2PORA 1GFNA 2J1NA 4FZNA 5T5FA 7PRNA 2YPVA 3AA0A 4O4UA 5ADXL 4GHBA 3AA7B 3AA1A 1PRNA 4Z3TA 3NSGA 5AFUL 4FUVA 1QJ9A 4IL6O 1IZNA 5IYUA 1E54A 3WU2O 1G90A 3SYSA 2XTRA 4UB8O 3BS0A 3QRCA 5KAIO 5TISO 4RJXA 3VY9X 2Y7SA 3PQSA 4FSPA 2R8AA 4AYNA 5GTHO 5DL5A 2KXPB 4PR7A 2KXPA 2WJQA 2JQYA 3AA7A 2FGRA 2F1VA 4C00A 2F1CX 1ZHTA 2OMFA 3POXA 2N2MA 4XNLA 5GTIO 4AYDC 4E1TA 1Q9GA 1BH3A 4GF4A 2R4PA 5JDPA 4LSFA 2MHLA 2K4TA 2W80C 2Y0KA 3PGRA 4N59A 5PRNA 4JFBA 5H2FO 3HWBA 2YNKA 4FQEA 4RJWA 1BXWA 3LK41 1MPFA 3GP6A 3K19A 4LSEA 3AAEA 4C4VA 5DL6A 5G3AA 4AZLA 5AFUK 4RLBA 4FT6A 3SY7A 4AKMA 4FOZA 4UB6O 5FVNA 4E1SA 3JCUO 4O49A 3LK3B 1HXTA 3G7GA 2R4OA 2KDYA 1P4TA 3VZWX 5ADXK 3EMNX 2IWWA 3FYXA 6PRNA 3UAQA 2WJRA 3DWOX 4BUMX 1GFMA 1ZHXA 4F4BA 4AYID 4O3ZA 1T16A 2R88A 3WI5A 2PRNA 4XNKA 3HW9A 3C5OA 4N74A 1MM5A 3PQUA 4O3XB 3POQA 1BT9A 2WVPA 4AKRA 2ZFGA 3KVDD 3PGUA 4K3BA 5KAFO 1GFQA 3VE1A 3AA1B 4O3YA 3A2SX 4N75A 3PF1A 2O4VA 4B61A 1Q9FA 1IZNB 2LFUA 2XE2A 3AA6A 3DWNA 3VZUX 3T20A 3AA6B 1ZHYA 2XE1A 3KZIO 4AFKA 3BRZA 4KR8A 4C69X 2X9KA 4AUIA 3HOEA 3UPGA 1GFOA 4GCSA 4D64A 2QTKA 2Y0HA 3AA0B 4K3CA 2JMMA 1H6S1 3UU2A 3AAAB 2MNHA 2M07A 2R4NA 2XE3A 3AAAA 3DA4A 4PJ0O 5G38A 4G76A 1THQA 4FRTA 3A0HO 1OPFA 3LK2A 3RBHA 4FSOA 4O3WA 1YS5A 3BRYA 3TZGA 2X27X 1QJPA 5EE2A 3QRAA 2LHFA 4KRAA
chains in the Genus database with same CATH topology
2M06A 4AYEC 3JTYA 3AAEB 4RLCA 4LSIA 3T24A 3PORA 3HOLA 2ZLDA 1HXXA 2KC0A 4KR4A 2ODJA 3LK3A 4FESA 4AYMC 2W81C 3DA3A 4N58A 4D5UA 1MM4A 3LK42 3VE2A 2Y2XA 3T0SA 3V8UA 4JCHA 2Y0LA 4LSHA 1ORMA 2K0LA 3SZDA 4FRXA 4FZMA 4FMSA 4GCQA 3VZTX 8PRNA 2J4UP 5GV0A 3VY8X 3POUA 2GE4A 2XG6A 2F1TA 5D5DA 2KZ7A 4RL9A 5DL7A 5G26A 1PHOA 2KZ7B 2N2LA 3SY9A 3WI4A 5DL8A 4U9CA 4D65A 2XMXA 3SYBA 4AKRB 1ZHZA 1ZHWA 3SZVA 2ERVA 3O0EA 1OSMA 4G75A 1GFPA 1HXUA 2XE5A 4FZLA 4PUXA 1QJ8A 2FGQX 3PRNA 4GCPA 2XTQA 4O4XA 3LK2B 4QQ1A 2PORA 1GFNA 2J1NA 4FZNA 5T5FA 7PRNA 2YPVA 3AA0A 4O4UA 5ADXL 4GHBA 3AA7B 3AA1A 1PRNA 4Z3TA 3NSGA 5AFUL 4FUVA 1QJ9A 1IZNA 5IYUA 1E54A 1G90A 3SYSA 2XTRA 3QRCA 4RJXA 3VY9X 2Y7SA 3PQSA 4FSPA 4AYNA 5DL5A 2KXPB 2KXPA 3AA7A 2FGRA 2F1VA 4E1TA 1ZHTA 2OMFA 3POXA 2N2MA 4XNLA 4AYDC 1Q9GA 1BH3A 4GF4A 5JDPA 4LSFA 2MHLA 2K4TA 2W80C 2Y0KA 4N59A 5PRNA 4JFBA 3HWBA 2YNKA 4RJWA 1BXWA 3LK41 1MPFA 3GP6A 3K19A 4LSEA 3AAEA 5AFUK 5DL6A 4AZLA 4RLBA 4FT6A 3SY7A 4AKMA 4FOZA 5FVNA 4E1SA 4O49A 3LK3B 1HXTA 3G7GA 2KDYA 5ADXK 1P4TA 3VZWX 3EMNX 3FYXA 6PRNA 3UAQA 4BUMX 1GFMA 1ZHXA 4F4BA 4AYID 4O3ZA 3WI5A 2PRNA 4XNKA 3HW9A 3C5OA 1MM5A 3PQUA 4O3XB 3POQA 1BT9A 4AKRA 2ZFGA 3KVDD 3VE1A 1GFQA 3AA1B 4O3YA 3A2SX 2O4VA 4B61A 1Q9FA 1IZNB 2LFUA 2XE2A 3AA6A 3VZUX 3T20A 3AA6B 1ZHYA 2XE1A 4AFKA 4KR8A 4C69X 4AUIA 3UPGA 3HOEA 1GFOA 4GCSA 4D64A 2QTKA 2Y0HA 3AA0B 2JMMA 1H6S1 3UU2A 3AAAB 2MNHA 2M07A 2XE3A 3DA4A 3AAAA 4G76A 1THQA 4FRTA 1OPFA 3LK2A 3RBHA 4FSOA 4O3WA 1YS5A 3TZGA 2X27X 1QJPA 5EE2A 3QRAA 2LHFA 4KRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTY A;  4LSI A;  3T24 A;  3POR A;  2ZLD A;  1HXX A;  4KR4 A;  2ODJ A;  4D5U A;  2Y2X A;  3T0S A;  2Y0L A;  4LSH A;  3SZD A;  2J4U P;  4FRX A;  4GCQ A;  4FMS A;  8PRN A;  3VZT X;  3VY8 X;  3POU A;  2XG6 A;  5DL7 A;  3SY9 A;  1PHO A;  3WI4 A;  5DL8 A;  4D65 A;  3SYB A;  3SZV A;  3O0E A;  1OSM A;  1GFP A;  1HXU A;  2XE5 A;  2FGQ X;  4GCP A;  3PRN A;  2POR A;  1GFN A;  2J1N A;  7PRN A;  1PRN A;  3NSG A;  1E54 A;  3SYS A;  4RJX A;  3VY9 X;  4FSP A;  5DL5 A;  2FGR A;  2OMF A;  3POX A;  1BH3 A;  5JDP A;  4LSF A;  5PRN A;  2K4T A;  2Y0K A;  4JFB A;  3HWB A;  4RJW A;  1MPF A;  3K19 A;  4LSE A;  5DL6 A;  3SY7 A;  4FT6 A;  4FOZ A;  5FVN A;  1HXT A;  3VZW X;  3EMN X;  3FYX A;  6PRN A;  4BUM X;  1GFM A;  3WI5 A;  2PRN A;  3HW9 A;  3POQ A;  1BT9 A;  2ZFG A;  1GFQ A;  3A2S X;  2O4V A;  3T20 A;  2XE2 A;  3VZU X;  2XE1 A;  4KR8 A;  4C69 X;  4AUI A;  3UPG A;  1GFO A;  4GCS A;  4D64 A;  2QTK A;  2Y0H A;  1H6S 1;  3UU2 A;  2XE3 A;  4FRT A;  1OPF A;  4FSO A;  4KRA A; 
#chains in the Genus database with same CATH topology
 2M06 A;  4AYE C;  3JTY A;  3AAE B;  4RLC A;  4LSI A;  5G39 A;  3POR A;  3T24 A;  3HOL A;  2ZLD A;  1HXX A;  2KC0 A;  4KR4 A;  2ODJ A;  3LK3 A;  4FES A;  3A0B O;  4AYM C;  5E79 O;  2W81 C;  3DA3 A;  2J4U P;  4N58 A;  4D5U A;  1MM4 A;  4CTD A;  2R4L A;  3LK4 2;  3VE2 A;  2Y2X A;  3T0S A;  4C4V B;  3V8U A;  4JCH A;  5B5E O;  2Y0L A;  4LSH A;  1ORM A;  2K0L A;  3SZD A;  4FRX A;  4FZM A;  4FMS A;  4GCQ A;  1T1L A;  3VZT X;  8PRN A;  2AXT O;  5GV0 A;  3VY8 X;  3POU A;  2GE4 A;  2XG6 A;  2F1T A;  5D5D A;  2KZ7 A;  4RL9 A;  5DL7 A;  5G26 A;  1PHO A;  2KZ7 B;  2N2L A;  3SY9 A;  3WI4 A;  5DL8 A;  4U9C A;  4D65 A;  3PGS A;  2IWV A;  2XMX A;  3SYB A;  4AKR B;  1ZHZ A;  2R89 A;  1ZHW A;  3SZV A;  2ERV A;  3O0E A;  1OSM A;  4G75 A;  1GFP A;  1HXU A;  3DZM A;  2XE5 A;  1S5L O;  4FZL A;  4PUX A;  5B66 O;  1QJ8 A;  2FGQ X;  3NJT A;  3PRN A;  2XTQ A;  4GCP A;  4O4X A;  3LK2 B;  4QQ1 A;  2POR A;  1GFN A;  2J1N A;  4FZN A;  5T5F A;  7PRN A;  2YPV A;  3AA0 A;  4O4U A;  5ADX L;  4GHB A;  3AA7 B;  3AA1 A;  1PRN A;  4Z3T A;  3NSG A;  5AFU L;  4FUV A;  1QJ9 A;  4IL6 O;  1IZN A;  5IYU A;  1E54 A;  3WU2 O;  1G90 A;  3SYS A;  2XTR A;  4UB8 O;  3BS0 A;  3QRC A;  5KAI O;  5TIS O;  4RJX A;  3VY9 X;  2Y7S A;  3PQS A;  4FSP A;  2R8A A;  4AYN A;  5GTH O;  5DL5 A;  2KXP B;  4PR7 A;  2KXP A;  2WJQ A;  2JQY A;  3AA7 A;  2FGR A;  2F1V A;  4C00 A;  2F1C X;  1ZHT A;  2OMF A;  3POX A;  2N2M A;  4XNL A;  5GTI O;  4AYD C;  4E1T A;  1Q9G A;  1BH3 A;  4GF4 A;  2R4P A;  5JDP A;  4LSF A;  2MHL A;  2K4T A;  2W80 C;  2Y0K A;  3PGR A;  4N59 A;  5PRN A;  4JFB A;  5H2F O;  3HWB A;  2YNK A;  4FQE A;  4RJW A;  1BXW A;  3LK4 1;  1MPF A;  3GP6 A;  3K19 A;  4LSE A;  3AAE A;  4C4V A;  5DL6 A;  5G3A A;  4AZL A;  5AFU K;  4RLB A;  4FT6 A;  3SY7 A;  4AKM A;  4FOZ A;  4UB6 O;  5FVN A;  4E1S A;  3JCU O;  4O49 A;  3LK3 B;  1HXT A;  3G7G A;  2R4O A;  2KDY A;  1P4T A;  3VZW X;  5ADX K;  3EMN X;  2IWW A;  3FYX A;  6PRN A;  3UAQ A;  2WJR A;  3DWO X;  4BUM X;  1GFM A;  1ZHX A;  4F4B A;  4AYI D;  4O3Z A;  1T16 A;  2R88 A;  3WI5 A;  2PRN A;  4XNK A;  3HW9 A;  3C5O A;  4N74 A;  1MM5 A;  3PQU A;  4O3X B;  3POQ A;  1BT9 A;  2WVP A;  4AKR A;  2ZFG A;  3KVD D;  3PGU A;  4K3B A;  5KAF O;  1GFQ A;  3VE1 A;  3AA1 B;  4O3Y A;  3A2S X;  4N75 A;  3PF1 A;  2O4V A;  4B61 A;  1Q9F A;  1IZN B;  2LFU A;  2XE2 A;  3AA6 A;  3DWN A;  3VZU X;  3T20 A;  3AA6 B;  1ZHY A;  2XE1 A;  3KZI O;  4AFK A;  3BRZ A;  4KR8 A;  4C69 X;  2X9K A;  4AUI A;  3HOE A;  3UPG A;  1GFO A;  4GCS A;  4D64 A;  2QTK A;  2Y0H A;  3AA0 B;  4K3C A;  2JMM A;  1H6S 1;  3UU2 A;  3AAA B;  2MNH A;  2M07 A;  2R4N A;  2XE3 A;  3AAA A;  3DA4 A;  4PJ0 O;  5G38 A;  4G76 A;  1THQ A;  4FRT A;  3A0H O;  1OPF A;  3LK2 A;  3RBH A;  4FSO A;  4O3W A;  1YS5 A;  3BRY A;  3TZG A;  2X27 X;  1QJP A;  5EE2 A;  3QRA A;  2LHF A;  4KRA A; 
#chains in the Genus database with same CATH homology
 2M06 A;  4AYE C;  3JTY A;  3AAE B;  4RLC A;  4LSI A;  3T24 A;  3POR A;  3HOL A;  2ZLD A;  1HXX A;  2KC0 A;  4KR4 A;  2ODJ A;  3LK3 A;  4FES A;  4AYM C;  2W81 C;  3DA3 A;  4N58 A;  4D5U A;  1MM4 A;  3LK4 2;  3VE2 A;  2Y2X A;  3T0S A;  3V8U A;  4JCH A;  2Y0L A;  4LSH A;  1ORM A;  2K0L A;  3SZD A;  4FRX A;  4FZM A;  4FMS A;  4GCQ A;  3VZT X;  8PRN A;  2J4U P;  5GV0 A;  3VY8 X;  3POU A;  2GE4 A;  2XG6 A;  2F1T A;  5D5D A;  2KZ7 A;  4RL9 A;  5DL7 A;  5G26 A;  1PHO A;  2KZ7 B;  2N2L A;  3SY9 A;  3WI4 A;  5DL8 A;  4U9C A;  4D65 A;  2XMX A;  3SYB A;  4AKR B;  1ZHZ A;  1ZHW A;  3SZV A;  2ERV A;  3O0E A;  1OSM A;  4G75 A;  1GFP A;  1HXU A;  2XE5 A;  4FZL A;  4PUX A;  1QJ8 A;  2FGQ X;  3PRN A;  4GCP A;  2XTQ A;  4O4X A;  3LK2 B;  4QQ1 A;  2POR A;  1GFN A;  2J1N A;  4FZN A;  5T5F A;  7PRN A;  2YPV A;  3AA0 A;  4O4U A;  5ADX L;  4GHB A;  3AA7 B;  3AA1 A;  1PRN A;  4Z3T A;  3NSG A;  5AFU L;  4FUV A;  1QJ9 A;  1IZN A;  5IYU A;  1E54 A;  1G90 A;  3SYS A;  2XTR A;  3QRC A;  4RJX A;  3VY9 X;  2Y7S A;  3PQS A;  4FSP A;  4AYN A;  5DL5 A;  2KXP B;  2KXP A;  3AA7 A;  2FGR A;  2F1V A;  4E1T A;  1ZHT A;  2OMF A;  3POX A;  2N2M A;  4XNL A;  4AYD C;  1Q9G A;  1BH3 A;  4GF4 A;  5JDP A;  4LSF A;  2MHL A;  2K4T A;  2W80 C;  2Y0K A;  4N59 A;  5PRN A;  4JFB A;  3HWB A;  2YNK A;  4RJW A;  1BXW A;  3LK4 1;  1MPF A;  3GP6 A;  3K19 A;  4LSE A;  3AAE A;  5AFU K;  5DL6 A;  4AZL A;  4RLB A;  4FT6 A;  3SY7 A;  4AKM A;  4FOZ A;  5FVN A;  4E1S A;  4O49 A;  3LK3 B;  1HXT A;  3G7G A;  2KDY A;  5ADX K;  1P4T A;  3VZW X;  3EMN X;  3FYX A;  6PRN A;  3UAQ A;  4BUM X;  1GFM A;  1ZHX A;  4F4B A;  4AYI D;  4O3Z A;  3WI5 A;  2PRN A;  4XNK A;  3HW9 A;  3C5O A;  1MM5 A;  3PQU A;  4O3X B;  3POQ A;  1BT9 A;  4AKR A;  2ZFG A;  3KVD D;  3VE1 A;  1GFQ A;  3AA1 B;  4O3Y A;  3A2S X;  2O4V A;  4B61 A;  1Q9F A;  1IZN B;  2LFU A;  2XE2 A;  3AA6 A;  3VZU X;  3T20 A;  3AA6 B;  1ZHY A;  2XE1 A;  4AFK A;  4KR8 A;  4C69 X;  4AUI A;  3UPG A;  3HOE A;  1GFO A;  4GCS A;  4D64 A;  2QTK A;  2Y0H A;  3AA0 B;  2JMM A;  1H6S 1;  3UU2 A;  3AAA B;  2MNH A;  2M07 A;  2XE3 A;  3DA4 A;  3AAA A;  4G76 A;  1THQ A;  4FRT A;  1OPF A;  3LK2 A;  3RBH A;  4FSO A;  4O3W A;  1YS5 A;  3TZG A;  2X27 X;  1QJP A;  5EE2 A;  3QRA A;  2LHF A;  4KRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...