2FGRA

High resolution xray structure of omp32
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
332
structure length
332
Chain Sequence
ESSVTLFGIVDTNVAYVNKDAAGDSRYGLGTSGASTSRLGLRGTEDLGGGLKAGFWLEGEIFGDDGNASGFNFKRRSTVSLSGNFGEVRLGRDLVPTSQKLTSYDLFSATGIGPFMGFRNWAAGQGADDNGIRANNLISYYTPNFGGFNAGFGYAFDEKQTIGTADSVGRYIGGYVAYDNGPLSASLGLAQQKTAVGGLATDRDEITLGASYNFGVAKLSGLLQQTKFKRDIGGDIKTNSYMLGASAPVGGVGEVKLQYALYDQKAIDSKAHQITLGYVHNLSKRTALYGNLAFLKNKDASTLGLQAKGVYAGGVQAGESQTGVQVGIRHAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane porin protein 32
publication title High resolution crystal structures and molecular dynamics studies reveal substrate binding in the porin omp32
pubmed doi rcsb
molecule tags Membrane protein
total genus 92
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2005-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2fgrA00
2XG6A 4D64A 4FT6A 3FYXA 3PRNA 4RJXA 4FOZA 2PRNA 4LSHA 8PRNA 2ODJA 4C69X 4D5UA 4FMSA 2XE2A 1OPFA 3HW9A 3PORA 3WI5A 2J4UP 4FRXA 5DL6A 4LSIA 6PRNA 5DL7A 1GFNA 2XE3A 3JTYA 3POXA 2OMFA 1HXUA 3VY9X 3VZWX 3SYSA 2Y0KA 2O4VA 3SY9A 3UPGA 2Y0HA 2PORA 5PRNA 7PRNA 4JFBA 2Y2XA 4FRTA 3POUA 4GCSA 3T24A 5DL5A 2FGQX 1GFQA 1MPFA 1E54A 4FSOA 3POQA 4LSFA 2Y0LA 2ZFGA 3O0EA 3SZVA 5JDPA 3K19A 4LSEA 3A2SX 2FGRA 3WI4A 2ZLDA 3VZUX 1HXXA 1OSMA 4D65A 1H6S1 5DL8A 2XE5A 4AUIA 4KR8A 1GFPA 3EMNX 3VZTX 2J1NA 2XE1A 5FVNA 2K4TA 4KR4A 3SY7A 4FSPA 4RJWA 3SZDA 1GFMA 1GFOA 1PHOA 3UU2A 4BUMX 1BT9A 3T20A 3VY8X 3HWBA 4GCPA 3NSGA 3T0SA 4GCQA 2QTKA 1PRNA 1HXTA 1BH3A 4KRAA 3SYBA
chains in the Genus database with same CATH superfamily
1ZHTA 2F1TA 3BRZA 4RLBA 1QJ9A 2GE4A 2MHLA 1G90A 2MNHA 2XG6A 4D64A 2AXTO 4FZLA 4JCHA 5H2FO 2M07A 4XNLA 3PGSA 2XTRA 4FT6A 5B66O 3V8UA 4AKRA 4PUXA 1YS5A 3FYXA 3PRNA 3AA0B 4RJXA 3G7GA 4FOZA 4CTDA 2PRNA 3BRYA 4GF4A 4LSHA 8PRNA 2ODJA 3SYBA 3BS0A 4C69X 5B5EO 1ZHXA 3JCUO 3PQSA 3AAAB 4O4XA 4G75A 3AAAA 5E79O 4D5UA 4FMSA 2XE2A 1OPFA 4N74A 4O3YA 4FUVA 3HW9A 3PORA 4O3XB 3WI5A 4C00A 2J4UP 4FRXA 5DL6A 4LSIA 1ZHZA 2X9KA 4N58A 6PRNA 3LK42 3AAEB 4FZMA 3UAQA 2XTQA 3AAEA 2LHFA 5DL7A 2JQYA 1GFNA 3AA1B 2F1CX 2XE3A 3AA1A 3JTYA 2N2LA 3POXA 2OMFA 4O3ZA 1HXUA 4QQ1A 5T5FA 3VY9X 5IYUA 1IZNA 4N75A 3VZWX 5EE2A 1T1LA 3SYSA 2KXPB 2Y0KA 2O4VA 2KXPA 3SY9A 2WJRA 4PJ0O 3LK2B 3UPGA 3LK2A 2WJQA 1MM4A 2Y0HA 3DA4A 1Q9GA 4AYDC 4F4BA 4Z3TA 4XNKA 5GTHO 4FESA 3AA0A 2PORA 5PRNA 7PRNA 3AA7B 1Q9FA 4UB8O 4JFBA 3TZGA 2Y2XA 3KVDD 4FRTA 4FQEA 2W80C 3POUA 4GCSA 1ORMA 4GHBA 2M06A 3PQUA 5G39A 3T24A 5ADXK 2N2MA 2KZ7B 1ZHYA 2KZ7A 5G3AA 2WVPA 3PGUA 4AYID 3QRCA 3DA3A 5DL5A 4AZLA 4U9CA 2FGQX 3DWNA 1GFQA 2X27X 1MPFA 1E54A 4AYEC 5G38A 3VE2A 4AKMA 2K0LA 5ADXL 2LFUA 2R8AA 4AYMC 4FSOA 5G26A 2YPVA 3POQA 2R88A 2Y7SA 4LSFA 3HOLA 3QRAA 2Y0LA 2ZFGA 3A0HO 3KZIO 3O0EA 1P4TA 5GTIO 3DWOX 4K3BA 3SZVA 5JDPA 3K19A 3LK3B 2W81C 3A2SX 3AA7A 3LK3A 3LK41 2FGRA 3A0BO 4LSEA 2ZLDA 3WI4A 2ERVA 4C4VB 4RLCA 3VZUX 1HXXA 2R89A 5D5DA 3RBHA 1OSMA 3HOEA 4D65A 1H6S1 4G76A 2KC0A 1MM5A 4O49A 3AA6B 2XE5A 5DL8A 3AA6A 5TISO 4AUIA 4KR8A 1GFPA 1QJPA 3EMNX 1T16A 4IL6O 3VE1A 5GV0A 3PF1A 2J1NA 2JMMA 2K4TA 2XE1A 5FVNA 4KR4A 3VZTX 3SY7A 2YNKA 4E1SA 4O4UA 4N59A 2R4PA 4FSPA 3PGRA 2IWVA 4AKRB 4RJWA 4O3WA 4RL9A 2IWWA 3DZMA 4FZNA 5AFUK 1QJ8A 2R4LA 3SZDA 4AYNA 5KAFO 5KAIO 1GFMA 4B61A 4K3CA 4PR7A 2R4NA 3C5OA 1GFOA 1PHOA 3UU2A 3WU2O 4C4VA 1THQA 3NJTA 4E1TA 4BUMX 2F1VA 1BT9A 3T20A 5AFUL 1S5LO 3HWBA 2KDYA 3GP6A 4GCPA 3VY8X 2R4OA 3NSGA 4GCQA 2QTKA 2XMXA 1PRNA 3T0SA 1BXWA 1HXTA 1ZHWA 4AFKA 1BH3A 4KRAA 4UB6O 1IZNB
chains in the Genus database with same CATH topology
1ZHTA 2F1TA 4RLBA 1QJ9A 2GE4A 2MHLA 1G90A 2MNHA 2XG6A 4D64A 4JCHA 4FZLA 2M07A 4XNLA 2XTRA 4FT6A 3V8UA 4AKRA 4PUXA 1YS5A 3FYXA 3PRNA 3AA0B 4RJXA 3G7GA 4FOZA 2PRNA 4LSHA 4GF4A 8PRNA 2ODJA 4C69X 1ZHXA 3PQSA 3AAAB 4O4XA 4G75A 3AAAA 4D5UA 4FMSA 2XE2A 1OPFA 4O3YA 4FUVA 3HW9A 3PORA 4O3XB 3WI5A 2J4UP 4FRXA 5DL6A 4LSIA 1ZHZA 4N58A 6PRNA 3LK42 3AAEB 4FZMA 3UAQA 2XTQA 3AAEA 2LHFA 5DL7A 3AA1B 1GFNA 4E1SA 2XE3A 3AA1A 3JTYA 4O3ZA 2N2LA 3POXA 2OMFA 4QQ1A 1HXUA 5T5FA 3VY9X 5IYUA 1IZNA 3VZWX 5EE2A 3SYSA 2KXPB 2Y0KA 2O4VA 2KXPA 3SY9A 3LK2B 3UPGA 3LK2A 4F4BA 1MM4A 2Y0HA 3DA4A 1Q9GA 4AYDC 4Z3TA 4XNKA 4FESA 3AA0A 2PORA 5PRNA 7PRNA 3AA7B 1Q9FA 3TZGA 4JFBA 2Y2XA 3KVDD 4FRTA 2W80C 3POUA 4GCSA 1ORMA 4GHBA 2M06A 3PQUA 3T24A 5ADXK 2N2MA 2KZ7B 1ZHYA 2KZ7A 4AYID 3QRCA 3DA3A 5DL5A 4AZLA 4U9CA 2FGQX 1GFQA 2X27X 1MPFA 1E54A 4AYEC 3VE2A 4AKMA 2K0LA 5ADXL 2LFUA 4AYMC 4FSOA 5G26A 2YPVA 3POQA 2Y7SA 4LSFA 3HOLA 3QRAA 2Y0LA 2ZFGA 3O0EA 1P4TA 3SZVA 5JDPA 3K19A 3LK3B 2W81C 3A2SX 3AA7A 3LK3A 3LK41 2FGRA 4LSEA 3WI4A 2ZLDA 2ERVA 4RLCA 3VZUX 1HXXA 5D5DA 3RBHA 1OSMA 3HOEA 4D65A 1H6S1 4G76A 2KC0A 1MM5A 4O49A 3AA6B 2XE5A 5DL8A 3AA6A 4AUIA 4KR8A 1GFPA 1QJPA 3EMNX 3VE1A 5GV0A 3VZTX 2J1NA 2JMMA 2XE1A 2K4TA 5FVNA 4KR4A 3SY7A 2YNKA 4O4UA 4N59A 4FSPA 4AKRB 4RJWA 4O3WA 4RL9A 4FZNA 5AFUK 1QJ8A 3SZDA 4AYNA 1GFMA 4B61A 3C5OA 1GFOA 1PHOA 3UU2A 1THQA 4E1TA 4BUMX 2F1VA 1BT9A 3T20A 5AFUL 3VY8X 3HWBA 2KDYA 3GP6A 4GCPA 3NSGA 3T0SA 4GCQA 2QTKA 2XMXA 1PRNA 4AFKA 1BXWA 1HXTA 1ZHWA 1BH3A 4KRAA 3SYBA 1IZNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XG6 A;  4D64 A;  4FT6 A;  3FYX A;  3PRN A;  4RJX A;  4FOZ A;  2PRN A;  4LSH A;  8PRN A;  2ODJ A;  4C69 X;  4D5U A;  4FMS A;  2XE2 A;  1OPF A;  3HW9 A;  3POR A;  3WI5 A;  2J4U P;  4FRX A;  5DL6 A;  4LSI A;  6PRN A;  5DL7 A;  1GFN A;  2XE3 A;  3JTY A;  3POX A;  2OMF A;  1HXU A;  3VY9 X;  3VZW X;  3SYS A;  2Y0K A;  2O4V A;  3SY9 A;  3UPG A;  2Y0H A;  2POR A;  5PRN A;  7PRN A;  4JFB A;  2Y2X A;  4FRT A;  3POU A;  4GCS A;  3T24 A;  5DL5 A;  2FGQ X;  1GFQ A;  1MPF A;  1E54 A;  4FSO A;  3POQ A;  4LSF A;  2Y0L A;  2ZFG A;  3O0E A;  3SZV A;  5JDP A;  3K19 A;  4LSE A;  3A2S X;  2FGR A;  3WI4 A;  2ZLD A;  3VZU X;  1HXX A;  1OSM A;  4D65 A;  1H6S 1;  5DL8 A;  2XE5 A;  4AUI A;  4KR8 A;  1GFP A;  3EMN X;  3VZT X;  2J1N A;  2XE1 A;  5FVN A;  2K4T A;  4KR4 A;  3SY7 A;  4FSP A;  4RJW A;  3SZD A;  1GFM A;  1GFO A;  1PHO A;  3UU2 A;  4BUM X;  1BT9 A;  3T20 A;  3VY8 X;  3HWB A;  4GCP A;  3NSG A;  3T0S A;  4GCQ A;  2QTK A;  1PRN A;  1HXT A;  1BH3 A;  4KRA A;  3SYB A; 
#chains in the Genus database with same CATH topology
 1ZHT A;  2F1T A;  3BRZ A;  4RLB A;  1QJ9 A;  2GE4 A;  2MHL A;  1G90 A;  2MNH A;  2XG6 A;  4D64 A;  2AXT O;  4FZL A;  4JCH A;  5H2F O;  2M07 A;  4XNL A;  3PGS A;  2XTR A;  4FT6 A;  5B66 O;  3V8U A;  4AKR A;  4PUX A;  1YS5 A;  3FYX A;  3PRN A;  3AA0 B;  4RJX A;  3G7G A;  4FOZ A;  4CTD A;  2PRN A;  3BRY A;  4GF4 A;  4LSH A;  8PRN A;  2ODJ A;  3SYB A;  3BS0 A;  4C69 X;  5B5E O;  1ZHX A;  3JCU O;  3PQS A;  3AAA B;  4O4X A;  4G75 A;  3AAA A;  5E79 O;  4D5U A;  4FMS A;  2XE2 A;  1OPF A;  4N74 A;  4O3Y A;  4FUV A;  3HW9 A;  3POR A;  4O3X B;  3WI5 A;  4C00 A;  2J4U P;  4FRX A;  5DL6 A;  4LSI A;  1ZHZ A;  2X9K A;  4N58 A;  6PRN A;  3LK4 2;  3AAE B;  4FZM A;  3UAQ A;  2XTQ A;  3AAE A;  2LHF A;  5DL7 A;  2JQY A;  1GFN A;  3AA1 B;  2F1C X;  2XE3 A;  3AA1 A;  3JTY A;  2N2L A;  3POX A;  2OMF A;  4O3Z A;  1HXU A;  4QQ1 A;  5T5F A;  3VY9 X;  5IYU A;  1IZN A;  4N75 A;  3VZW X;  5EE2 A;  1T1L A;  3SYS A;  2KXP B;  2Y0K A;  2O4V A;  2KXP A;  3SY9 A;  2WJR A;  4PJ0 O;  3LK2 B;  3UPG A;  3LK2 A;  2WJQ A;  1MM4 A;  2Y0H A;  3DA4 A;  1Q9G A;  4AYD C;  4F4B A;  4Z3T A;  4XNK A;  5GTH O;  4FES A;  3AA0 A;  2POR A;  5PRN A;  7PRN A;  3AA7 B;  1Q9F A;  4UB8 O;  4JFB A;  3TZG A;  2Y2X A;  3KVD D;  4FRT A;  4FQE A;  2W80 C;  3POU A;  4GCS A;  1ORM A;  4GHB A;  2M06 A;  3PQU A;  5G39 A;  3T24 A;  5ADX K;  2N2M A;  2KZ7 B;  1ZHY A;  2KZ7 A;  5G3A A;  2WVP A;  3PGU A;  4AYI D;  3QRC A;  3DA3 A;  5DL5 A;  4AZL A;  4U9C A;  2FGQ X;  3DWN A;  1GFQ A;  2X27 X;  1MPF A;  1E54 A;  4AYE C;  5G38 A;  3VE2 A;  4AKM A;  2K0L A;  5ADX L;  2LFU A;  2R8A A;  4AYM C;  4FSO A;  5G26 A;  2YPV A;  3POQ A;  2R88 A;  2Y7S A;  4LSF A;  3HOL A;  3QRA A;  2Y0L A;  2ZFG A;  3A0H O;  3KZI O;  3O0E A;  1P4T A;  5GTI O;  3DWO X;  4K3B A;  3SZV A;  5JDP A;  3K19 A;  3LK3 B;  2W81 C;  3A2S X;  3AA7 A;  3LK3 A;  3LK4 1;  2FGR A;  3A0B O;  4LSE A;  2ZLD A;  3WI4 A;  2ERV A;  4C4V B;  4RLC A;  3VZU X;  1HXX A;  2R89 A;  5D5D A;  3RBH A;  1OSM A;  3HOE A;  4D65 A;  1H6S 1;  4G76 A;  2KC0 A;  1MM5 A;  4O49 A;  3AA6 B;  2XE5 A;  5DL8 A;  3AA6 A;  5TIS O;  4AUI A;  4KR8 A;  1GFP A;  1QJP A;  3EMN X;  1T16 A;  4IL6 O;  3VE1 A;  5GV0 A;  3PF1 A;  2J1N A;  2JMM A;  2K4T A;  2XE1 A;  5FVN A;  4KR4 A;  3VZT X;  3SY7 A;  2YNK A;  4E1S A;  4O4U A;  4N59 A;  2R4P A;  4FSP A;  3PGR A;  2IWV A;  4AKR B;  4RJW A;  4O3W A;  4RL9 A;  2IWW A;  3DZM A;  4FZN A;  5AFU K;  1QJ8 A;  2R4L A;  3SZD A;  4AYN A;  5KAF O;  5KAI O;  1GFM A;  4B61 A;  4K3C A;  4PR7 A;  2R4N A;  3C5O A;  1GFO A;  1PHO A;  3UU2 A;  3WU2 O;  4C4V A;  1THQ A;  3NJT A;  4E1T A;  4BUM X;  2F1V A;  1BT9 A;  3T20 A;  5AFU L;  1S5L O;  3HWB A;  2KDY A;  3GP6 A;  4GCP A;  3VY8 X;  2R4O A;  3NSG A;  4GCQ A;  2QTK A;  2XMX A;  1PRN A;  3T0S A;  1BXW A;  1HXT A;  1ZHW A;  4AFK A;  1BH3 A;  4KRA A;  4UB6 O;  1IZN B; 
#chains in the Genus database with same CATH homology
 1ZHT A;  2F1T A;  4RLB A;  1QJ9 A;  2GE4 A;  2MHL A;  1G90 A;  2MNH A;  2XG6 A;  4D64 A;  4JCH A;  4FZL A;  2M07 A;  4XNL A;  2XTR A;  4FT6 A;  3V8U A;  4AKR A;  4PUX A;  1YS5 A;  3FYX A;  3PRN A;  3AA0 B;  4RJX A;  3G7G A;  4FOZ A;  2PRN A;  4LSH A;  4GF4 A;  8PRN A;  2ODJ A;  4C69 X;  1ZHX A;  3PQS A;  3AAA B;  4O4X A;  4G75 A;  3AAA A;  4D5U A;  4FMS A;  2XE2 A;  1OPF A;  4O3Y A;  4FUV A;  3HW9 A;  3POR A;  4O3X B;  3WI5 A;  2J4U P;  4FRX A;  5DL6 A;  4LSI A;  1ZHZ A;  4N58 A;  6PRN A;  3LK4 2;  3AAE B;  4FZM A;  3UAQ A;  2XTQ A;  3AAE A;  2LHF A;  5DL7 A;  3AA1 B;  1GFN A;  4E1S A;  2XE3 A;  3AA1 A;  3JTY A;  4O3Z A;  2N2L A;  3POX A;  2OMF A;  4QQ1 A;  1HXU A;  5T5F A;  3VY9 X;  5IYU A;  1IZN A;  3VZW X;  5EE2 A;  3SYS A;  2KXP B;  2Y0K A;  2O4V A;  2KXP A;  3SY9 A;  3LK2 B;  3UPG A;  3LK2 A;  4F4B A;  1MM4 A;  2Y0H A;  3DA4 A;  1Q9G A;  4AYD C;  4Z3T A;  4XNK A;  4FES A;  3AA0 A;  2POR A;  5PRN A;  7PRN A;  3AA7 B;  1Q9F A;  3TZG A;  4JFB A;  2Y2X A;  3KVD D;  4FRT A;  2W80 C;  3POU A;  4GCS A;  1ORM A;  4GHB A;  2M06 A;  3PQU A;  3T24 A;  5ADX K;  2N2M A;  2KZ7 B;  1ZHY A;  2KZ7 A;  4AYI D;  3QRC A;  3DA3 A;  5DL5 A;  4AZL A;  4U9C A;  2FGQ X;  1GFQ A;  2X27 X;  1MPF A;  1E54 A;  4AYE C;  3VE2 A;  4AKM A;  2K0L A;  5ADX L;  2LFU A;  4AYM C;  4FSO A;  5G26 A;  2YPV A;  3POQ A;  2Y7S A;  4LSF A;  3HOL A;  3QRA A;  2Y0L A;  2ZFG A;  3O0E A;  1P4T A;  3SZV A;  5JDP A;  3K19 A;  3LK3 B;  2W81 C;  3A2S X;  3AA7 A;  3LK3 A;  3LK4 1;  2FGR A;  4LSE A;  3WI4 A;  2ZLD A;  2ERV A;  4RLC A;  3VZU X;  1HXX A;  5D5D A;  3RBH A;  1OSM A;  3HOE A;  4D65 A;  1H6S 1;  4G76 A;  2KC0 A;  1MM5 A;  4O49 A;  3AA6 B;  2XE5 A;  5DL8 A;  3AA6 A;  4AUI A;  4KR8 A;  1GFP A;  1QJP A;  3EMN X;  3VE1 A;  5GV0 A;  3VZT X;  2J1N A;  2JMM A;  2XE1 A;  2K4T A;  5FVN A;  4KR4 A;  3SY7 A;  2YNK A;  4O4U A;  4N59 A;  4FSP A;  4AKR B;  4RJW A;  4O3W A;  4RL9 A;  4FZN A;  5AFU K;  1QJ8 A;  3SZD A;  4AYN A;  1GFM A;  4B61 A;  3C5O A;  1GFO A;  1PHO A;  3UU2 A;  1THQ A;  4E1T A;  4BUM X;  2F1V A;  1BT9 A;  3T20 A;  5AFU L;  3VY8 X;  3HWB A;  2KDY A;  3GP6 A;  4GCP A;  3NSG A;  3T0S A;  4GCQ A;  2QTK A;  2XMX A;  1PRN A;  4AFK A;  1BXW A;  1HXT A;  1ZHW A;  1BH3 A;  4KRA A;  3SYB A;  1IZN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...