2FGRA

High resolution xray structure of omp32
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
332
structure length
332
Chain Sequence
ESSVTLFGIVDTNVAYVNKDAAGDSRYGLGTSGASTSRLGLRGTEDLGGGLKAGFWLEGEIFGDDGNASGFNFKRRSTVSLSGNFGEVRLGRDLVPTSQKLTSYDLFSATGIGPFMGFRNWAAGQGADDNGIRANNLISYYTPNFGGFNAGFGYAFDEKQTIGTADSVGRYIGGYVAYDNGPLSASLGLAQQKTAVGGLATDRDEITLGASYNFGVAKLSGLLQQTKFKRDIGGDIKTNSYMLGASAPVGGVGEVKLQYALYDQKAIDSKAHQITLGYVHNLSKRTALYGNLAFLKNKDASTLGLQAKGVYAGGVQAGESQTGVQVGIRHAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structures and molecular dynamics studies reveal substrate binding in the porin omp32
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords Outer membrane porin protein 32
total genus 92
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2005-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2fgrA00
3T0SA 2PORA 3FYXA 3POQA 1PRNA 3HW9A 3A2SX 4RJWA 2FGQX 2O4VA 3SYBA 3HWBA 4AUIA 3VZWX 1MPFA 7PRNA 2OMFA 3EMNX 4LSFA 3SZDA 4FSPA 5DL6A 2PRNA 1GFPA 2ZLDA 4JFBA 3SY9A 2ODJA 2XE3A 4FOZA 1GFMA 3SY7A 4LSHA 1BH3A 6PRNA 4D65A 4D64A 8PRNA 4FMSA 4FRTA 4D5UA 2J1NA 4KR8A 2Y2XA 4GCSA 4RJXA 3VY9X 5JDPA 4FT6A 3PORA 3SYSA 4GCQA 3WI4A 1HXXA 1GFNA 2Y0HA 3O0EA 3UPGA 5FVNA 1HXTA 3VZUX 1OPFA 1GFQA 2XG6A 3PRNA 5PRNA 4C69X 1OSMA 2Y0KA 4KRAA 2Y0LA 1BT9A 5DL8A 4LSEA 3UU2A 2J4UP 3JTYA 3POUA 1H6S1 2QTKA 5DL7A 4KR4A 2XE5A 3WI5A 4LSIA 1E54A 3VY8X 3VZTX 4GCPA 2FGRA 3NSGA 2ZFGA 3SZVA 4FSOA 3T24A 2XE2A 3T20A 2K4TA 4FRXA 4BUMX 2XE1A 3K19A 5DL5A 1PHOA 1HXUA 1GFOA 3POXA
chains in the Genus database with same CATH superfamily
3T0SA 1MM5A 5GTIO 3C5OA 4E1SA 2PORA 3FYXA 3POQA 4FZLA 2R4OA 2GE4A 3LK3A 4N74A 3VE2A 1PRNA 2MHLA 5GTHO 3HW9A 5H2FO 3A2SX 4F4BA 3PGSA 4RJWA 1ZHXA 3AAAB 2FGQX 3V8UA 3AAEB 4XNLA 3TZGA 4C4VB 2O4VA 4Z3TA 2N2LA 3LK3B 3SYBA 5TISO 3HWBA 4AUIA 3NJTA 4FUVA 4PUXA 4FZNA 3VZWX 4PR7A 1MPFA 7PRNA 4AKMA 2OMFA 3AA7A 4N75A 3EMNX 4C00A 5G38A 2AXTO 5T5FA 4AKRB 4LSFA 3PF1A 3SZDA 4O49A 4FSPA 5DL6A 2PRNA 1GFPA 2ZLDA 4JFBA 3SY9A 4AYEC 3AA0B 3AA7B 5GV0A 2ODJA 2XE3A 4FOZA 1T16A 4U9CA 2R4NA 1GFMA 2JMMA 3BS0A 3SY7A 4CTDA 4AYDC 4LSHA 2X27X 1P4TA 4QQ1A 3PQUA 3HOLA 1YS5A 2KXPB 1IZNB 1BH3A 2K0LA 6PRNA 3LK41 2W80C 4O3ZA 2WJRA 4AYMC 4D65A 4E1TA 1BXWA 4D64A 4FMSA 8PRNA 4FRTA 4D5UA 3DA4A 2J1NA 1ORMA 4KR8A 4RLBA 2Y2XA 5ADXK 4GCSA 4RJXA 3VY9X 5JDPA 2X9KA 4FT6A 4IL6O 3DWOX 3LK2A 3PORA 2LHFA 4UB6O 1QJPA 3SYSA 2IWWA 3KZIO 1ZHTA 4GCQA 4B61A 3WI4A 3AA1A 4AYID 3G7GA 1HXXA 2KZ7B 5D5DA 3AAAA 4FQEA 4RL9A 1GFNA 1T1LA 1ZHYA 2R88A 2Y0HA 3AA1B 3HOEA 3O0EA 5FVNA 3UPGA 1HXTA 5G26A 2KC0A 4FZMA 1OPFA 3VZUX 3AA0A 5IYUA 2R4LA 1GFQA 2JQYA 5KAFO 2XG6A 4FESA 3PRNA 5B66O 1ZHZA 4O3XB 5PRNA 3RBHA 3QRCA 4C69X 3AAEA 4JCHA 1OSMA 2LFUA 5EE2A 2KDYA 2Y0KA 5KAIO 2N2MA 4O3YA 2XTRA 4GHBA 1Q9GA 4KRAA 4N58A 4AYNA 2Y0LA 1BT9A 3UAQA 3AA6A 2ERVA 5DL8A 3GP6A 2IWVA 4LSEA 1QJ8A 5E79O 3UU2A 2J4UP 2WVPA 3JTYA 1THQA 3POUA 3LK2B 1ZHWA 2F1TA 1H6S1 5ADXL 2QTKA 5DL7A 2KZ7A 2M06A 3PGUA 3KVDD 3LK42 4KR4A 2M07A 4GF4A 5G3AA 2R89A 2Y7SA 3PGRA 1S5LO 2XE5A 3BRZA 3WI5A 4LSIA 2F1CX 2MNHA 1E54A 3DA3A 2W81C 5G39A 3VY8X 4K3CA 1G90A 2WJQA 2XTQA 3VZTX 3A0HO 4GCPA 2FGRA 3NSGA 2ZFGA 4UB8O 4XNKA 3SZVA 2KXPA 3VE1A 4C4VA 4FSOA 2F1VA 4O4UA 1QJ9A 3JCUO 4PJ0O 3DWNA 3T24A 2XE2A 4AKRA 1IZNA 1Q9FA 4AFKA 3AA6B 3T20A 2K4TA 3A0BO 4FRXA 4RLCA 2YPVA 4BUMX 4O3WA 2XE1A 3WU2O 5AFUL 3K19A 5DL5A 1MM4A 1PHOA 2R4PA 2XMXA 2R8AA 4AZLA 1HXUA 5AFUK 4G75A 4O4XA 4N59A 5B5EO 2YNKA 3PQSA 3DZMA 4G76A 1GFOA 3BRYA 3QRAA 3POXA 4K3BA
chains in the Genus database with same CATH topology
3T0SA 1MM5A 3C5OA 4E1SA 2PORA 3FYXA 3POQA 4FZLA 3VE2A 2GE4A 3LK3A 1PRNA 2MHLA 3HW9A 3A2SX 4F4BA 4RJWA 1ZHXA 3AAAB 2FGQX 3V8UA 3AAEB 4XNLA 3TZGA 4Z3TA 2O4VA 2N2LA 3LK3B 3SYBA 3HWBA 4AUIA 4FUVA 4PUXA 4FZNA 3VZWX 1MPFA 7PRNA 4AKMA 2OMFA 3AA7A 3EMNX 5T5FA 4AKRB 4LSFA 3SZDA 4O49A 4FSPA 5DL6A 2PRNA 1GFPA 2ZLDA 4JFBA 3SY9A 4AYEC 3AA0B 3AA7B 5GV0A 2ODJA 2XE3A 4FOZA 4U9CA 1GFMA 2JMMA 3SY7A 4AYDC 4LSHA 2X27X 1P4TA 4QQ1A 3PQUA 3HOLA 1YS5A 2KXPB 1IZNB 1BH3A 2K0LA 6PRNA 3LK41 2W80C 4O3ZA 4AYMC 4D65A 4E1TA 1BXWA 4D64A 4FMSA 8PRNA 4FRTA 4D5UA 3DA4A 2J1NA 1ORMA 4KR8A 4RLBA 2Y2XA 5ADXK 4GCSA 4RJXA 3VY9X 5JDPA 4FT6A 3LK2A 3PORA 2LHFA 1QJPA 3SYSA 1ZHTA 4GCQA 4B61A 3WI4A 3AA1A 4AYID 3G7GA 1HXXA 2KZ7B 5D5DA 3AAAA 4RL9A 1GFNA 1ZHYA 2Y0HA 3HOEA 3O0EA 3AA1B 3UPGA 5FVNA 1HXTA 5G26A 2KC0A 4FZMA 1OPFA 3VZUX 3AA0A 5IYUA 1GFQA 2XG6A 4FESA 3PRNA 1ZHZA 4O3XB 5PRNA 3RBHA 3QRCA 4C69X 3AAEA 4JCHA 1OSMA 2LFUA 5EE2A 2KDYA 2Y0KA 2N2MA 4O3YA 2XTRA 4GHBA 1Q9GA 4KRAA 4N58A 4AYNA 2Y0LA 1BT9A 3UAQA 3AA6A 2ERVA 5DL8A 3GP6A 4LSEA 1QJ8A 3UU2A 2J4UP 3JTYA 1THQA 3POUA 3LK2B 1ZHWA 2F1TA 1H6S1 5ADXL 2QTKA 5DL7A 2KZ7A 2M06A 3KVDD 3LK42 4KR4A 2M07A 4GF4A 2Y7SA 2XE5A 3WI5A 4LSIA 2MNHA 1E54A 3DA3A 2W81C 3VY8X 1G90A 2XTQA 3VZTX 4GCPA 2FGRA 3NSGA 2ZFGA 4XNKA 3VE1A 3SZVA 2KXPA 4FSOA 2F1VA 4O4UA 1QJ9A 3T24A 4AKRA 2XE2A 1IZNA 1Q9FA 4AFKA 3AA6B 3T20A 2K4TA 4FRXA 4RLCA 2YPVA 4BUMX 4O3WA 2XE1A 5AFUL 3K19A 5DL5A 1MM4A 1PHOA 2XMXA 4AZLA 1HXUA 5AFUK 4G75A 4O4XA 4N59A 2YNKA 3PQSA 4G76A 1GFOA 3QRAA 3POXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T0S A;  2POR A;  3FYX A;  3POQ A;  1PRN A;  3HW9 A;  3A2S X;  4RJW A;  2FGQ X;  2O4V A;  3SYB A;  3HWB A;  4AUI A;  3VZW X;  1MPF A;  7PRN A;  2OMF A;  3EMN X;  4LSF A;  3SZD A;  4FSP A;  5DL6 A;  2PRN A;  1GFP A;  2ZLD A;  4JFB A;  3SY9 A;  2ODJ A;  2XE3 A;  4FOZ A;  1GFM A;  3SY7 A;  4LSH A;  1BH3 A;  6PRN A;  4D65 A;  4D64 A;  8PRN A;  4FMS A;  4FRT A;  4D5U A;  2J1N A;  4KR8 A;  2Y2X A;  4GCS A;  4RJX A;  3VY9 X;  5JDP A;  4FT6 A;  3POR A;  3SYS A;  4GCQ A;  3WI4 A;  1HXX A;  1GFN A;  2Y0H A;  3O0E A;  3UPG A;  5FVN A;  1HXT A;  3VZU X;  1OPF A;  1GFQ A;  2XG6 A;  3PRN A;  5PRN A;  4C69 X;  1OSM A;  2Y0K A;  4KRA A;  2Y0L A;  1BT9 A;  5DL8 A;  4LSE A;  3UU2 A;  2J4U P;  3JTY A;  3POU A;  1H6S 1;  2QTK A;  5DL7 A;  4KR4 A;  2XE5 A;  3WI5 A;  4LSI A;  1E54 A;  3VY8 X;  3VZT X;  4GCP A;  2FGR A;  3NSG A;  2ZFG A;  3SZV A;  4FSO A;  3T24 A;  2XE2 A;  3T20 A;  2K4T A;  4FRX A;  4BUM X;  2XE1 A;  3K19 A;  5DL5 A;  1PHO A;  1HXU A;  1GFO A;  3POX A; 
#chains in the Genus database with same CATH topology
 3T0S A;  1MM5 A;  5GTI O;  3C5O A;  4E1S A;  2POR A;  3FYX A;  3POQ A;  4FZL A;  2R4O A;  2GE4 A;  3LK3 A;  4N74 A;  3VE2 A;  1PRN A;  2MHL A;  5GTH O;  3HW9 A;  5H2F O;  3A2S X;  4F4B A;  3PGS A;  4RJW A;  1ZHX A;  3AAA B;  2FGQ X;  3V8U A;  3AAE B;  4XNL A;  3TZG A;  4C4V B;  2O4V A;  4Z3T A;  2N2L A;  3LK3 B;  3SYB A;  5TIS O;  3HWB A;  4AUI A;  3NJT A;  4FUV A;  4PUX A;  4FZN A;  3VZW X;  4PR7 A;  1MPF A;  7PRN A;  4AKM A;  2OMF A;  3AA7 A;  4N75 A;  3EMN X;  4C00 A;  5G38 A;  2AXT O;  5T5F A;  4AKR B;  4LSF A;  3PF1 A;  3SZD A;  4O49 A;  4FSP A;  5DL6 A;  2PRN A;  1GFP A;  2ZLD A;  4JFB A;  3SY9 A;  4AYE C;  3AA0 B;  3AA7 B;  5GV0 A;  2ODJ A;  2XE3 A;  4FOZ A;  1T16 A;  4U9C A;  2R4N A;  1GFM A;  2JMM A;  3BS0 A;  3SY7 A;  4CTD A;  4AYD C;  4LSH A;  2X27 X;  1P4T A;  4QQ1 A;  3PQU A;  3HOL A;  1YS5 A;  2KXP B;  1IZN B;  1BH3 A;  2K0L A;  6PRN A;  3LK4 1;  2W80 C;  4O3Z A;  2WJR A;  4AYM C;  4D65 A;  4E1T A;  1BXW A;  4D64 A;  4FMS A;  8PRN A;  4FRT A;  4D5U A;  3DA4 A;  2J1N A;  1ORM A;  4KR8 A;  4RLB A;  2Y2X A;  5ADX K;  4GCS A;  4RJX A;  3VY9 X;  5JDP A;  2X9K A;  4FT6 A;  4IL6 O;  3DWO X;  3LK2 A;  3POR A;  2LHF A;  4UB6 O;  1QJP A;  3SYS A;  2IWW A;  3KZI O;  1ZHT A;  4GCQ A;  4B61 A;  3WI4 A;  3AA1 A;  4AYI D;  3G7G A;  1HXX A;  2KZ7 B;  5D5D A;  3AAA A;  4FQE A;  4RL9 A;  1GFN A;  1T1L A;  1ZHY A;  2R88 A;  2Y0H A;  3AA1 B;  3HOE A;  3O0E A;  5FVN A;  3UPG A;  1HXT A;  5G26 A;  2KC0 A;  4FZM A;  1OPF A;  3VZU X;  3AA0 A;  5IYU A;  2R4L A;  1GFQ A;  2JQY A;  5KAF O;  2XG6 A;  4FES A;  3PRN A;  5B66 O;  1ZHZ A;  4O3X B;  5PRN A;  3RBH A;  3QRC A;  4C69 X;  3AAE A;  4JCH A;  1OSM A;  2LFU A;  5EE2 A;  2KDY A;  2Y0K A;  5KAI O;  2N2M A;  4O3Y A;  2XTR A;  4GHB A;  1Q9G A;  4KRA A;  4N58 A;  4AYN A;  2Y0L A;  1BT9 A;  3UAQ A;  3AA6 A;  2ERV A;  5DL8 A;  3GP6 A;  2IWV A;  4LSE A;  1QJ8 A;  5E79 O;  3UU2 A;  2J4U P;  2WVP A;  3JTY A;  1THQ A;  3POU A;  3LK2 B;  1ZHW A;  2F1T A;  1H6S 1;  5ADX L;  2QTK A;  5DL7 A;  2KZ7 A;  2M06 A;  3PGU A;  3KVD D;  3LK4 2;  4KR4 A;  2M07 A;  4GF4 A;  5G3A A;  2R89 A;  2Y7S A;  3PGR A;  1S5L O;  2XE5 A;  3BRZ A;  3WI5 A;  4LSI A;  2F1C X;  2MNH A;  1E54 A;  3DA3 A;  2W81 C;  5G39 A;  3VY8 X;  4K3C A;  1G90 A;  2WJQ A;  2XTQ A;  3VZT X;  3A0H O;  4GCP A;  2FGR A;  3NSG A;  2ZFG A;  4UB8 O;  4XNK A;  3SZV A;  2KXP A;  3VE1 A;  4C4V A;  4FSO A;  2F1V A;  4O4U A;  1QJ9 A;  3JCU O;  4PJ0 O;  3DWN A;  3T24 A;  2XE2 A;  4AKR A;  1IZN A;  1Q9F A;  4AFK A;  3AA6 B;  3T20 A;  2K4T A;  3A0B O;  4FRX A;  4RLC A;  2YPV A;  4BUM X;  4O3W A;  2XE1 A;  3WU2 O;  5AFU L;  3K19 A;  5DL5 A;  1MM4 A;  1PHO A;  2R4P A;  2XMX A;  2R8A A;  4AZL A;  1HXU A;  5AFU K;  4G75 A;  4O4X A;  4N59 A;  5B5E O;  2YNK A;  3PQS A;  3DZM A;  4G76 A;  1GFO A;  3BRY A;  3QRA A;  3POX A;  4K3B A; 
#chains in the Genus database with same CATH homology
 3T0S A;  1MM5 A;  3C5O A;  4E1S A;  2POR A;  3FYX A;  3POQ A;  4FZL A;  3VE2 A;  2GE4 A;  3LK3 A;  1PRN A;  2MHL A;  3HW9 A;  3A2S X;  4F4B A;  4RJW A;  1ZHX A;  3AAA B;  2FGQ X;  3V8U A;  3AAE B;  4XNL A;  3TZG A;  4Z3T A;  2O4V A;  2N2L A;  3LK3 B;  3SYB A;  3HWB A;  4AUI A;  4FUV A;  4PUX A;  4FZN A;  3VZW X;  1MPF A;  7PRN A;  4AKM A;  2OMF A;  3AA7 A;  3EMN X;  5T5F A;  4AKR B;  4LSF A;  3SZD A;  4O49 A;  4FSP A;  5DL6 A;  2PRN A;  1GFP A;  2ZLD A;  4JFB A;  3SY9 A;  4AYE C;  3AA0 B;  3AA7 B;  5GV0 A;  2ODJ A;  2XE3 A;  4FOZ A;  4U9C A;  1GFM A;  2JMM A;  3SY7 A;  4AYD C;  4LSH A;  2X27 X;  1P4T A;  4QQ1 A;  3PQU A;  3HOL A;  1YS5 A;  2KXP B;  1IZN B;  1BH3 A;  2K0L A;  6PRN A;  3LK4 1;  2W80 C;  4O3Z A;  4AYM C;  4D65 A;  4E1T A;  1BXW A;  4D64 A;  4FMS A;  8PRN A;  4FRT A;  4D5U A;  3DA4 A;  2J1N A;  1ORM A;  4KR8 A;  4RLB A;  2Y2X A;  5ADX K;  4GCS A;  4RJX A;  3VY9 X;  5JDP A;  4FT6 A;  3LK2 A;  3POR A;  2LHF A;  1QJP A;  3SYS A;  1ZHT A;  4GCQ A;  4B61 A;  3WI4 A;  3AA1 A;  4AYI D;  3G7G A;  1HXX A;  2KZ7 B;  5D5D A;  3AAA A;  4RL9 A;  1GFN A;  1ZHY A;  2Y0H A;  3HOE A;  3O0E A;  3AA1 B;  3UPG A;  5FVN A;  1HXT A;  5G26 A;  2KC0 A;  4FZM A;  1OPF A;  3VZU X;  3AA0 A;  5IYU A;  1GFQ A;  2XG6 A;  4FES A;  3PRN A;  1ZHZ A;  4O3X B;  5PRN A;  3RBH A;  3QRC A;  4C69 X;  3AAE A;  4JCH A;  1OSM A;  2LFU A;  5EE2 A;  2KDY A;  2Y0K A;  2N2M A;  4O3Y A;  2XTR A;  4GHB A;  1Q9G A;  4KRA A;  4N58 A;  4AYN A;  2Y0L A;  1BT9 A;  3UAQ A;  3AA6 A;  2ERV A;  5DL8 A;  3GP6 A;  4LSE A;  1QJ8 A;  3UU2 A;  2J4U P;  3JTY A;  1THQ A;  3POU A;  3LK2 B;  1ZHW A;  2F1T A;  1H6S 1;  5ADX L;  2QTK A;  5DL7 A;  2KZ7 A;  2M06 A;  3KVD D;  3LK4 2;  4KR4 A;  2M07 A;  4GF4 A;  2Y7S A;  2XE5 A;  3WI5 A;  4LSI A;  2MNH A;  1E54 A;  3DA3 A;  2W81 C;  3VY8 X;  1G90 A;  2XTQ A;  3VZT X;  4GCP A;  2FGR A;  3NSG A;  2ZFG A;  4XNK A;  3VE1 A;  3SZV A;  2KXP A;  4FSO A;  2F1V A;  4O4U A;  1QJ9 A;  3T24 A;  4AKR A;  2XE2 A;  1IZN A;  1Q9F A;  4AFK A;  3AA6 B;  3T20 A;  2K4T A;  4FRX A;  4RLC A;  2YPV A;  4BUM X;  4O3W A;  2XE1 A;  5AFU L;  3K19 A;  5DL5 A;  1MM4 A;  1PHO A;  2XMX A;  4AZL A;  1HXU A;  5AFU K;  4G75 A;  4O4X A;  4N59 A;  2YNK A;  3PQS A;  4G76 A;  1GFO A;  3QRA A;  3POX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...