2FGRA

High resolution xray structure of omp32
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
332
structure length
332
Chain Sequence
b'ESSVTLFGIVDTNVAYVNKDAAGDSRYGLGTSGASTSRLGLRGTEDLGGGLKAGFWLEGEIFGDDGNASGFNFKRRSTVSLSGNFGEVRLGRDLVPTSQKLTSYDLFSATGIGPFMGFRNWAAGQGADDNGIRANNLISYYTPNFGGFNAGFGYAFDEKQTIGTADSVGRYIGGYVAYDNGPLSASLGLAQQKTAVGGLATDRDEITLGASYNFGVAKLSGLLQQTKFKRDIGGDIKTNSYMLGASAPVGGVGEVKLQYALYDQKAIDSKAHQITLGYVHNLSKRTALYGNLAFLKNKDASTLGLQAKGVYAGGVQAGESQTGVQVGIRHAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane porin protein 32
publication title High resolution crystal structures and molecular dynamics studies reveal substrate binding in the porin omp32
pubmed doi rcsb
molecule tags Membrane protein
total genus 92
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2005-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2fgrA00
2Y0KA 4FRXA 4GCPA 4D65A 4FSOA 1E54A 1GFPA 1OSMA 2Y2XA 4D64A 4KR8A 5PRNA 8PRNA 5FVNA 4BUMX 5DL5A 2OMFA 4JFBA 2XE1A 1HXXA 1GFOA 2O4VA 3POQA 3WI4A 2J1NA 4GCQA 3EMNX 4FT6A 7PRNA 4KR4A 4KRAA 2XE5A 3HW9A 3SZDA 3O0EA 3SYSA 5DL6A 3NSGA 4LSFA 2K4TA 3JTYA 4RJWA 4LSEA 1HXUA 3FYXA 3VY9X 3WI5A 3K19A 2PORA 3SY7A 2Y0LA 3PORA 3A2SX 4FRTA 1H6S1 1PHOA 1PRNA 3T0SA 3POXA 4D5UA 4FSPA 2FGRA 1BT9A 2PRNA 4RJXA 3T24A 4C69X 3UU2A 4FMSA 3T20A 5DL7A 4FOZA 1MPFA 1HXTA 2XE2A 6PRNA 3SY9A 1OPFA 3SYBA 3HWBA 2QTKA 5DL8A 3VZTX 3POUA 4AUIA 3SZVA 4GCSA 1GFNA 2XE3A 2XG6A 2ZLDA 3VY8X 3UPGA 5JDPA 2ZFGA 3PRNA 4LSHA 2Y0HA 2FGQX 1GFMA 2ODJA 4LSIA 3VZWX 1GFQA 3VZUX 1BH3A 2J4UP
chains in the Genus database with same CATH superfamily
3AA0B 2Y0KA 4CTDA 3DWOX 2XMXA 4FRXA 5TISO 2AXTO 3A0BO 3QRCA 4GCPA 4O3ZA 3TZGA 4D65A 4O3WA 5GTHO 5GTIO 4FSOA 2XTRA 4PUXA 1E54A 1GFPA 1QJPA 3VE2A 4PJ0O 1OSMA 2Y2XA 4D64A 4KR8A 2W80C 5FVNA 2JMMA 2R88A 5PRNA 2LHFA 8PRNA 4AKMA 4GF4A 2WJRA 4C00A 4JCHA 2JQYA 2M07A 2OMFA 4JFBA 2XE1A 3GP6A 4K3CA 4N59A 5DL5A 1HXXA 2Y7SA 1GFOA 3NJTA 3PGSA 4O3XB 2IWVA 2N2MA 1ZHXA 4O49A 4AYNA 2O4VA 2X9KA 2M06A 1YS5A 3POQA 4O4XA 4AYDC 3LK3A 2R4NA 3LK42 3WI4A 1THQA 5ADXK 3HOEA 4Z3TA 1MM5A 3PQUA 5H2FO 2J1NA 2XTQA 3AAEA 3EMNX 1P4TA 4FT6A 4GCQA 7PRNA 4RL9A 2LFUA 4KR4A 4KRAA 2XE5A 4XNLA 3HW9A 4AZLA 4IL6O 3SZDA 2IWWA 3O0EA 4C4VA 5G38A 5GV0A 5KAFO 5DL6A 3SYSA 4RLBA 3NSGA 4LSFA 4RLCA 2K4TA 4AKRA 3JCUO 3JTYA 4U9CA 1T1LA 5E79O 4RJWA 3LK3B 4FZMA 3V8UA 4AYEC 4LSEA 4O4UA 5B5EO 1HXUA 4E1SA 3FYXA 5EE2A 2R8AA 3VY9X 3AA7A 3WI5A 4FZNA 3K19A 5AFUK 3AAEB 2PORA 2W81C 3PGUA 2WVPA 1T16A 4FUVA 2Y0LA 3SY7A 2F1VA 3PORA 5D5DA 1QJ9A 3A2SX 4N75A 4FRTA 1H6S1 4AYID 1PHOA 1PRNA 5ADXL 3T0SA 3POXA 1Q9FA 4C4VB 4D5UA 3DWNA 2KXPA 3VE1A 4FSPA 1IZNA 5KAIO 4AKRB 2FGRA 4K3BA 4N74A 1BT9A 1QJ8A 2R4PA 2PRNA 3AA1A 4RJXA 3BRYA 3KVDD 3DA4A 3LK41 3A0HO 4UB8O 3T24A 5B66O 4C69X 4O3YA 3UU2A 4FMSA 1Q9GA 3AA7B 4AYMC 3PGRA 3T20A 5DL7A 4FQEA 3DA3A 4FZLA 2KDYA 1MM4A 2X27X 5G3AA 2K0LA 3AAAA 2R89A 4UB6O 4FOZA 2YNKA 1MPFA 1ZHWA 1HXTA 2KZ7A 1ORMA 2XE2A 6PRNA 4FESA 4G76A 5AFUL 2GE4A 3SY9A 3HOLA 2F1CX 2KXPB 4E1TA 5T5FA 4QQ1A 1IZNB 3C5OA 1ZHZA 5IYUA 4GHBA 1OPFA 3UPGA 3LK2A 3AA1B 3SYBA 2MNHA 3HWBA 2MHLA 3BS0A 2QTKA 5DL8A 3KZIO 3VZTX 3AA0A 3POUA 4N58A 3AA6B 4AUIA 3SZVA 4BUMX 1G90A 4GCSA 1GFNA 3DZMA 2XE3A 1ZHTA 2R4OA 3PF1A 5G26A 3AAAB 5G39A 2XG6A 2ZLDA 3PQSA 3VY8X 5JDPA 2ZFGA 2KZ7B 3PRNA 4G75A 4LSHA 1S5LO 3RBHA 1ZHYA 2Y0HA 3UAQA 2R4LA 3QRAA 3BRZA 2N2LA 4PR7A 2KC0A 2FGQX 3AA6A 1GFMA 2ODJA 4LSIA 3VZWX 3G7GA 4B61A 1BXWA 1GFQA 2WJQA 2F1TA 3LK2B 2ERVA 4AFKA 2YPVA 4XNKA 3VZUX 4F4BA 3WU2O 1BH3A 2J4UP
chains in the Genus database with same CATH topology
3AA0B 2Y0KA 2XMXA 4FRXA 3QRCA 4O3ZA 4GCPA 3TZGA 4D65A 4O3WA 4FSOA 2XTRA 4PUXA 1E54A 1GFPA 1QJPA 3VE2A 1OSMA 2Y2XA 4D64A 4KR8A 2W80C 2JMMA 5PRNA 2LHFA 8PRNA 4AKMA 4GF4A 4JCHA 2M07A 5DL5A 2OMFA 4JFBA 2XE1A 3GP6A 4N59A 5FVNA 4BUMX 1HXXA 2Y7SA 1GFOA 4O3XB 2N2MA 1ZHXA 4O49A 4AYNA 2O4VA 2M06A 1YS5A 3POQA 4O4XA 4AYDC 3LK3A 3LK42 3WI4A 1THQA 5ADXK 3HOEA 4Z3TA 1MM5A 3PQUA 2J1NA 2XTQA 3AAEA 3EMNX 1P4TA 4FT6A 4GCQA 7PRNA 4RL9A 2LFUA 4KR4A 4KRAA 2XE5A 4XNLA 3HW9A 4AZLA 3SZDA 3O0EA 5GV0A 3SYSA 5DL6A 4RLBA 3NSGA 4LSFA 4RLCA 2K4TA 4AKRA 4U9CA 3JTYA 4AYEC 4RJWA 3LK3B 4FZMA 3V8UA 4LSEA 4O4UA 1HXUA 4E1SA 3FYXA 5EE2A 3VY9X 3AA7A 3WI5A 4FZNA 3K19A 5AFUK 3AAEB 2PORA 2W81C 4FUVA 3SY7A 2Y0LA 2F1VA 3PORA 5D5DA 1QJ9A 3A2SX 4FRTA 1H6S1 4AYID 1PHOA 1PRNA 5ADXL 3T0SA 3POXA 1Q9FA 4D5UA 2KXPA 3VE1A 4FSPA 1IZNA 4AKRB 2FGRA 1BT9A 1QJ8A 3AA1A 2PRNA 4RJXA 3LK41 3KVDD 3DA4A 3T24A 4C69X 4O3YA 3UU2A 4FMSA 1Q9GA 3AA7B 4AYMC 3T20A 5DL7A 3DA3A 4FZLA 2KDYA 1MM4A 2X27X 2K0LA 3AAAA 4FOZA 2YNKA 1MPFA 1ZHWA 1HXTA 2KZ7A 1ORMA 2XE2A 6PRNA 4FESA 4G76A 5AFUL 2GE4A 3SY9A 3HOLA 4E1TA 2KXPB 5T5FA 4QQ1A 1IZNB 3C5OA 1ZHZA 5IYUA 4GHBA 1OPFA 3UPGA 3LK2A 3AA1B 3SYBA 2MNHA 3HWBA 2MHLA 2QTKA 5DL8A 3VZTX 3AA0A 3POUA 4N58A 3AA6B 4AUIA 3SZVA 1G90A 4GCSA 1GFNA 2XE3A 1ZHTA 5G26A 3AAAB 2XG6A 2ZLDA 3PQSA 3VY8X 5JDPA 2ZFGA 2KZ7B 3PRNA 4G75A 4LSHA 3RBHA 3UAQA 1ZHYA 2Y0HA 3QRAA 2N2LA 2KC0A 2FGQX 3AA6A 1GFMA 2ODJA 4LSIA 3VZWX 3G7GA 4B61A 1BXWA 1GFQA 2F1TA 3LK2B 2ERVA 4AFKA 2YPVA 4XNKA 3VZUX 4F4BA 1BH3A 2J4UP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0K A;  4FRX A;  4GCP A;  4D65 A;  4FSO A;  1E54 A;  1GFP A;  1OSM A;  2Y2X A;  4D64 A;  4KR8 A;  5PRN A;  8PRN A;  5FVN A;  4BUM X;  5DL5 A;  2OMF A;  4JFB A;  2XE1 A;  1HXX A;  1GFO A;  2O4V A;  3POQ A;  3WI4 A;  2J1N A;  4GCQ A;  3EMN X;  4FT6 A;  7PRN A;  4KR4 A;  4KRA A;  2XE5 A;  3HW9 A;  3SZD A;  3O0E A;  3SYS A;  5DL6 A;  3NSG A;  4LSF A;  2K4T A;  3JTY A;  4RJW A;  4LSE A;  1HXU A;  3FYX A;  3VY9 X;  3WI5 A;  3K19 A;  2POR A;  3SY7 A;  2Y0L A;  3POR A;  3A2S X;  4FRT A;  1H6S 1;  1PHO A;  1PRN A;  3T0S A;  3POX A;  4D5U A;  4FSP A;  2FGR A;  1BT9 A;  2PRN A;  4RJX A;  3T24 A;  4C69 X;  3UU2 A;  4FMS A;  3T20 A;  5DL7 A;  4FOZ A;  1MPF A;  1HXT A;  2XE2 A;  6PRN A;  3SY9 A;  1OPF A;  3SYB A;  3HWB A;  2QTK A;  5DL8 A;  3VZT X;  3POU A;  4AUI A;  3SZV A;  4GCS A;  1GFN A;  2XE3 A;  2XG6 A;  2ZLD A;  3VY8 X;  3UPG A;  5JDP A;  2ZFG A;  3PRN A;  4LSH A;  2Y0H A;  2FGQ X;  1GFM A;  2ODJ A;  4LSI A;  3VZW X;  1GFQ A;  3VZU X;  1BH3 A;  2J4U P; 
#chains in the Genus database with same CATH topology
 3AA0 B;  2Y0K A;  4CTD A;  3DWO X;  2XMX A;  4FRX A;  5TIS O;  2AXT O;  3A0B O;  3QRC A;  4GCP A;  4O3Z A;  3TZG A;  4D65 A;  4O3W A;  5GTH O;  5GTI O;  4FSO A;  2XTR A;  4PUX A;  1E54 A;  1GFP A;  1QJP A;  3VE2 A;  4PJ0 O;  1OSM A;  2Y2X A;  4D64 A;  4KR8 A;  2W80 C;  5FVN A;  2JMM A;  2R88 A;  5PRN A;  2LHF A;  8PRN A;  4AKM A;  4GF4 A;  2WJR A;  4C00 A;  4JCH A;  2JQY A;  2M07 A;  2OMF A;  4JFB A;  2XE1 A;  3GP6 A;  4K3C A;  4N59 A;  5DL5 A;  1HXX A;  2Y7S A;  1GFO A;  3NJT A;  3PGS A;  4O3X B;  2IWV A;  2N2M A;  1ZHX A;  4O49 A;  4AYN A;  2O4V A;  2X9K A;  2M06 A;  1YS5 A;  3POQ A;  4O4X A;  4AYD C;  3LK3 A;  2R4N A;  3LK4 2;  3WI4 A;  1THQ A;  5ADX K;  3HOE A;  4Z3T A;  1MM5 A;  3PQU A;  5H2F O;  2J1N A;  2XTQ A;  3AAE A;  3EMN X;  1P4T A;  4FT6 A;  4GCQ A;  7PRN A;  4RL9 A;  2LFU A;  4KR4 A;  4KRA A;  2XE5 A;  4XNL A;  3HW9 A;  4AZL A;  4IL6 O;  3SZD A;  2IWW A;  3O0E A;  4C4V A;  5G38 A;  5GV0 A;  5KAF O;  5DL6 A;  3SYS A;  4RLB A;  3NSG A;  4LSF A;  4RLC A;  2K4T A;  4AKR A;  3JCU O;  3JTY A;  4U9C A;  1T1L A;  5E79 O;  4RJW A;  3LK3 B;  4FZM A;  3V8U A;  4AYE C;  4LSE A;  4O4U A;  5B5E O;  1HXU A;  4E1S A;  3FYX A;  5EE2 A;  2R8A A;  3VY9 X;  3AA7 A;  3WI5 A;  4FZN A;  3K19 A;  5AFU K;  3AAE B;  2POR A;  2W81 C;  3PGU A;  2WVP A;  1T16 A;  4FUV A;  2Y0L A;  3SY7 A;  2F1V A;  3POR A;  5D5D A;  1QJ9 A;  3A2S X;  4N75 A;  4FRT A;  1H6S 1;  4AYI D;  1PHO A;  1PRN A;  5ADX L;  3T0S A;  3POX A;  1Q9F A;  4C4V B;  4D5U A;  3DWN A;  2KXP A;  3VE1 A;  4FSP A;  1IZN A;  5KAI O;  4AKR B;  2FGR A;  4K3B A;  4N74 A;  1BT9 A;  1QJ8 A;  2R4P A;  2PRN A;  3AA1 A;  4RJX A;  3BRY A;  3KVD D;  3DA4 A;  3LK4 1;  3A0H O;  4UB8 O;  3T24 A;  5B66 O;  4C69 X;  4O3Y A;  3UU2 A;  4FMS A;  1Q9G A;  3AA7 B;  4AYM C;  3PGR A;  3T20 A;  5DL7 A;  4FQE A;  3DA3 A;  4FZL A;  2KDY A;  1MM4 A;  2X27 X;  5G3A A;  2K0L A;  3AAA A;  2R89 A;  4UB6 O;  4FOZ A;  2YNK A;  1MPF A;  1ZHW A;  1HXT A;  2KZ7 A;  1ORM A;  2XE2 A;  6PRN A;  4FES A;  4G76 A;  5AFU L;  2GE4 A;  3SY9 A;  3HOL A;  2F1C X;  2KXP B;  4E1T A;  5T5F A;  4QQ1 A;  1IZN B;  3C5O A;  1ZHZ A;  5IYU A;  4GHB A;  1OPF A;  3UPG A;  3LK2 A;  3AA1 B;  3SYB A;  2MNH A;  3HWB A;  2MHL A;  3BS0 A;  2QTK A;  5DL8 A;  3KZI O;  3VZT X;  3AA0 A;  3POU A;  4N58 A;  3AA6 B;  4AUI A;  3SZV A;  4BUM X;  1G90 A;  4GCS A;  1GFN A;  3DZM A;  2XE3 A;  1ZHT A;  2R4O A;  3PF1 A;  5G26 A;  3AAA B;  5G39 A;  2XG6 A;  2ZLD A;  3PQS A;  3VY8 X;  5JDP A;  2ZFG A;  2KZ7 B;  3PRN A;  4G75 A;  4LSH A;  1S5L O;  3RBH A;  1ZHY A;  2Y0H A;  3UAQ A;  2R4L A;  3QRA A;  3BRZ A;  2N2L A;  4PR7 A;  2KC0 A;  2FGQ X;  3AA6 A;  1GFM A;  2ODJ A;  4LSI A;  3VZW X;  3G7G A;  4B61 A;  1BXW A;  1GFQ A;  2WJQ A;  2F1T A;  3LK2 B;  2ERV A;  4AFK A;  2YPV A;  4XNK A;  3VZU X;  4F4B A;  3WU2 O;  1BH3 A;  2J4U P; 
#chains in the Genus database with same CATH homology
 3AA0 B;  2Y0K A;  2XMX A;  4FRX A;  3QRC A;  4O3Z A;  4GCP A;  3TZG A;  4D65 A;  4O3W A;  4FSO A;  2XTR A;  4PUX A;  1E54 A;  1GFP A;  1QJP A;  3VE2 A;  1OSM A;  2Y2X A;  4D64 A;  4KR8 A;  2W80 C;  2JMM A;  5PRN A;  2LHF A;  8PRN A;  4AKM A;  4GF4 A;  4JCH A;  2M07 A;  5DL5 A;  2OMF A;  4JFB A;  2XE1 A;  3GP6 A;  4N59 A;  5FVN A;  4BUM X;  1HXX A;  2Y7S A;  1GFO A;  4O3X B;  2N2M A;  1ZHX A;  4O49 A;  4AYN A;  2O4V A;  2M06 A;  1YS5 A;  3POQ A;  4O4X A;  4AYD C;  3LK3 A;  3LK4 2;  3WI4 A;  1THQ A;  5ADX K;  3HOE A;  4Z3T A;  1MM5 A;  3PQU A;  2J1N A;  2XTQ A;  3AAE A;  3EMN X;  1P4T A;  4FT6 A;  4GCQ A;  7PRN A;  4RL9 A;  2LFU A;  4KR4 A;  4KRA A;  2XE5 A;  4XNL A;  3HW9 A;  4AZL A;  3SZD A;  3O0E A;  5GV0 A;  3SYS A;  5DL6 A;  4RLB A;  3NSG A;  4LSF A;  4RLC A;  2K4T A;  4AKR A;  4U9C A;  3JTY A;  4AYE C;  4RJW A;  3LK3 B;  4FZM A;  3V8U A;  4LSE A;  4O4U A;  1HXU A;  4E1S A;  3FYX A;  5EE2 A;  3VY9 X;  3AA7 A;  3WI5 A;  4FZN A;  3K19 A;  5AFU K;  3AAE B;  2POR A;  2W81 C;  4FUV A;  3SY7 A;  2Y0L A;  2F1V A;  3POR A;  5D5D A;  1QJ9 A;  3A2S X;  4FRT A;  1H6S 1;  4AYI D;  1PHO A;  1PRN A;  5ADX L;  3T0S A;  3POX A;  1Q9F A;  4D5U A;  2KXP A;  3VE1 A;  4FSP A;  1IZN A;  4AKR B;  2FGR A;  1BT9 A;  1QJ8 A;  3AA1 A;  2PRN A;  4RJX A;  3LK4 1;  3KVD D;  3DA4 A;  3T24 A;  4C69 X;  4O3Y A;  3UU2 A;  4FMS A;  1Q9G A;  3AA7 B;  4AYM C;  3T20 A;  5DL7 A;  3DA3 A;  4FZL A;  2KDY A;  1MM4 A;  2X27 X;  2K0L A;  3AAA A;  4FOZ A;  2YNK A;  1MPF A;  1ZHW A;  1HXT A;  2KZ7 A;  1ORM A;  2XE2 A;  6PRN A;  4FES A;  4G76 A;  5AFU L;  2GE4 A;  3SY9 A;  3HOL A;  4E1T A;  2KXP B;  5T5F A;  4QQ1 A;  1IZN B;  3C5O A;  1ZHZ A;  5IYU A;  4GHB A;  1OPF A;  3UPG A;  3LK2 A;  3AA1 B;  3SYB A;  2MNH A;  3HWB A;  2MHL A;  2QTK A;  5DL8 A;  3VZT X;  3AA0 A;  3POU A;  4N58 A;  3AA6 B;  4AUI A;  3SZV A;  1G90 A;  4GCS A;  1GFN A;  2XE3 A;  1ZHT A;  5G26 A;  3AAA B;  2XG6 A;  2ZLD A;  3PQS A;  3VY8 X;  5JDP A;  2ZFG A;  2KZ7 B;  3PRN A;  4G75 A;  4LSH A;  3RBH A;  3UAQ A;  1ZHY A;  2Y0H A;  3QRA A;  2N2L A;  2KC0 A;  2FGQ X;  3AA6 A;  1GFM A;  2ODJ A;  4LSI A;  3VZW X;  3G7G A;  4B61 A;  1BXW A;  1GFQ A;  2F1T A;  3LK2 B;  2ERV A;  4AFK A;  2YPV A;  4XNK A;  3VZU X;  4F4B A;  1BH3 A;  2J4U P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...