2FH3A

C-terminal half of gelsolin soaked in low calcium at ph 8
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
330
structure length
321
Chain Sequence
MDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDTPITVVKQGFEPPSFVGWFLGWDDDYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Calcium ion exchange in crystalline gelsolin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords Gelsolin
total genus 92
structure length 321
sequence length 330
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 2fh3A01
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 2fh3A03
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 2fh3A02
4S10C 5DD2A 2FGHA 1M2VB 1P8ZG 2MV2A 3FG7A 5KYYA 1UDMA 5IVUA 2LLFA 3CIPG 2FF3A 1QPVA 1M2OA 1SVYA 1T44G 2NUPB 1YVNG 3EGDA 1MDUA 2FH2A 1NPHA 3EFOB 1AK6A 1CNUA 3EG9A 1EQYS 1NM1G 2D8BA 1D0NA 3TU5B 3EH1A 5L6WC 5KYXB 1JHWA 1ESVS 3FFNA 1NLVG 3L50A 4Z94G 2FH1A 3EH2A 5KYUA 2HD7A 2NUTB 2NUTA 4PKIG 4PKGG 3EGXB 2KVKA 3EGDB 4KEEA 1RGIG 4CBWG 1TVJA 2MP4A 1M2VA 5KYYB 1H1VG 1T2LA 3EG9B 2XF1A 3A5OS 1Q8XA 2VIKA 1P8XA 5KYWB 5KYXA 1AK7A 2QTVA 4PKHB 5FAEA 5FAFA 2I2QA 4KEDA 5HVKD 3CI5G 1X67A 5KYNA 1PD0A 4LIZA 2L72A 1YAGG 1CFYA 4KEFA 1C0FS 2LXXA 5KYUB 3FFKA 1PD1A 1WM4A 2XFAA 1HQZ1 5A1MA 2W0IA 2FF6G 1SVRA 1VFQA 1F7SA 1COFA 1J72A 3CJCG 4CBUG 4JD2H 2LJ8A 1WFSA 2NUPA 3A5LS 4CBXG 1D4XG 3EGXA 3FG6A 3A5MS 4BEX1 1TMWA 2MOTA 1WNJA 1DEJS 1AHQA 1NMDG 5KYWA 5HVKB 3DAWB 1VKKA 1T3YA 3CJBG 2VACA 1KCQA 1SVQA 3EFOA 1M4JA 1Q8GA 2FH3A 1C0GS 1T3XA 1V6FA 3Q2BA 3A5NS 1PCXA 2FH4A 2VILA
chains in the Genus database with same CATH superfamily
4S10C 5DD2A 2FGHA 1M2VB 1P8ZG 2MV2A 3FG7A 5KYYA 1UDMA 5IVUA 2LLFA 3CIPG 2FF3A 1QPVA 1M2OA 1SVYA 1T44G 2NUPB 1YVNG 3EGDA 1MDUA 2FH2A 1NPHA 3EFOB 1AK6A 1CNUA 3EG9A 1EQYS 1NM1G 2D8BA 1D0NA 3TU5B 3EH1A 5L6WC 5KYXB 1JHWA 1ESVS 3FFNA 1NLVG 3L50A 4Z94G 2FH1A 3EH2A 5KYUA 2HD7A 2NUTB 2NUTA 4PKIG 4PKGG 3EGXB 2KVKA 3EGDB 4KEEA 1RGIG 4CBWG 1TVJA 2MP4A 1M2VA 5KYYB 1H1VG 1T2LA 3EG9B 2XF1A 3A5OS 1Q8XA 2VIKA 1P8XA 5KYWB 5KYXA 1AK7A 2QTVA 4PKHB 5FAEA 5FAFA 2I2QA 3DA7A 4KEDA 5HVKD 3CI5G 1X67A 5KYNA 1PD0A 4LIZA 2L72A 1YAGG 1CFYA 4KEFA 1C0FS 2LXXA 5KYUB 3FFKA 1PD1A 1WM4A 2XFAA 1HQZ1 5A1MA 2W0IA 2FF6G 1SVRA 1VFQA 1F7SA 1COFA 1J72A 3CJCG 4CBUG 4JD2H 2LJ8A 1WFSA 2NUPA 3A5LS 4CBXG 1D4XG 3EGXA 3FG6A 3A5MS 4BEX1 1TMWA 2MOTA 1WNJA 1DEJS 1AHQA 1NMDG 5KYWA 5HVKB 3DAWB 1VKKA 1T3YA 3CJBG 2VACA 1KCQA 1SVQA 3EFOA 1M4JA 1Q8GA 2FH3A 1C0GS 1T3XA 1V6FA 3Q2BA 3A5NS 1PCXA 2FH4A 2VILA
chains in the Genus database with same CATH topology
4S10C 5DD2A 2FGHA 1M2VB 1P8ZG 2MV2A 3FG7A 5KYYA 1UDMA 5IVUA 2LLFA 3CIPG 2FF3A 1QPVA 1M2OA 1SVYA 1T44G 2NUPB 1YVNG 3EGDA 1MDUA 2FH2A 1NPHA 3EFOB 1AK6A 1CNUA 3EG9A 1EQYS 1NM1G 2D8BA 1D0NA 3TU5B 3EH1A 5L6WC 5KYXB 1JHWA 1ESVS 3FFNA 1NLVG 3L50A 4Z94G 2FH1A 3EH2A 5KYUA 2HD7A 2NUTB 2NUTA 4PKIG 4PKGG 3EGXB 2KVKA 3EGDB 4KEEA 1RGIG 4CBWG 1TVJA 2MP4A 1M2VA 5KYYB 1H1VG 1T2LA 3EG9B 2XF1A 3A5OS 1Q8XA 2VIKA 1P8XA 5KYWB 5KYXA 1AK7A 2QTVA 4PKHB 5FAEA 5FAFA 2I2QA 3DA7A 4KEDA 5HVKD 3CI5G 1X67A 5KYNA 1PD0A 4LIZA 2L72A 1YAGG 1CFYA 4KEFA 1C0FS 2LXXA 5KYUB 3FFKA 1PD1A 1WM4A 2XFAA 1HQZ1 5A1MA 2W0IA 2FF6G 1SVRA 1VFQA 1F7SA 1COFA 1J72A 3CJCG 4CBUG 4JD2H 2LJ8A 1WFSA 2NUPA 3A5LS 4CBXG 1D4XG 3EGXA 3FG6A 3A5MS 4BEX1 1TMWA 2MOTA 1WNJA 1DEJS 1AHQA 1NMDG 5KYWA 5HVKB 3DAWB 1VKKA 1T3YA 3CJBG 2VACA 1KCQA 1SVQA 3EFOA 1M4JA 1Q8GA 2FH3A 1C0GS 1T3XA 1V6FA 3Q2BA 3A5NS 1PCXA 2FH4A 2VILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S10 C;  5DD2 A;  2FGH A;  1M2V B;  1P8Z G;  2MV2 A;  3FG7 A;  5KYY A;  1UDM A;  5IVU A;  2LLF A;  3CIP G;  2FF3 A;  1QPV A;  1M2O A;  1SVY A;  1T44 G;  2NUP B;  1YVN G;  3EGD A;  1MDU A;  2FH2 A;  1NPH A;  3EFO B;  1AK6 A;  1CNU A;  3EG9 A;  1EQY S;  1NM1 G;  2D8B A;  1D0N A;  3TU5 B;  3EH1 A;  5L6W C;  5KYX B;  1JHW A;  1ESV S;  3FFN A;  1NLV G;  3L50 A;  4Z94 G;  2FH1 A;  3EH2 A;  5KYU A;  2HD7 A;  2NUT B;  2NUT A;  4PKI G;  4PKG G;  3EGX B;  2KVK A;  3EGD B;  4KEE A;  1RGI G;  4CBW G;  1TVJ A;  2MP4 A;  1M2V A;  5KYY B;  1H1V G;  1T2L A;  3EG9 B;  2XF1 A;  3A5O S;  1Q8X A;  2VIK A;  1P8X A;  5KYW B;  5KYX A;  1AK7 A;  2QTV A;  4PKH B;  5FAE A;  5FAF A;  2I2Q A;  4KED A;  5HVK D;  3CI5 G;  1X67 A;  5KYN A;  1PD0 A;  4LIZ A;  2L72 A;  1YAG G;  1CFY A;  4KEF A;  1C0F S;  2LXX A;  5KYU B;  3FFK A;  1PD1 A;  1WM4 A;  2XFA A;  1HQZ 1;  5A1M A;  2W0I A;  2FF6 G;  1SVR A;  1VFQ A;  1F7S A;  1COF A;  1J72 A;  3CJC G;  4CBU G;  4JD2 H;  2LJ8 A;  1WFS A;  2NUP A;  3A5L S;  4CBX G;  1D4X G;  3EGX A;  3FG6 A;  3A5M S;  4BEX 1;  1TMW A;  2MOT A;  1WNJ A;  1DEJ S;  1AHQ A;  1NMD G;  5KYW A;  5HVK B;  3DAW B;  1VKK A;  1T3Y A;  3CJB G;  2VAC A;  1KCQ A;  1SVQ A;  3EFO A;  1M4J A;  1Q8G A;  2FH3 A;  1C0G S;  1T3X A;  1V6F A;  3Q2B A;  3A5N S;  1PCX A;  2FH4 A;  2VIL A; 
#chains in the Genus database with same CATH topology
 4S10 C;  5DD2 A;  2FGH A;  1M2V B;  1P8Z G;  2MV2 A;  3FG7 A;  5KYY A;  1UDM A;  5IVU A;  2LLF A;  3CIP G;  2FF3 A;  1QPV A;  1M2O A;  1SVY A;  1T44 G;  2NUP B;  1YVN G;  3EGD A;  1MDU A;  2FH2 A;  1NPH A;  3EFO B;  1AK6 A;  1CNU A;  3EG9 A;  1EQY S;  1NM1 G;  2D8B A;  1D0N A;  3TU5 B;  3EH1 A;  5L6W C;  5KYX B;  1JHW A;  1ESV S;  3FFN A;  1NLV G;  3L50 A;  4Z94 G;  2FH1 A;  3EH2 A;  5KYU A;  2HD7 A;  2NUT B;  2NUT A;  4PKI G;  4PKG G;  3EGX B;  2KVK A;  3EGD B;  4KEE A;  1RGI G;  4CBW G;  1TVJ A;  2MP4 A;  1M2V A;  5KYY B;  1H1V G;  1T2L A;  3EG9 B;  2XF1 A;  3A5O S;  1Q8X A;  2VIK A;  1P8X A;  5KYW B;  5KYX A;  1AK7 A;  2QTV A;  4PKH B;  5FAE A;  5FAF A;  2I2Q A;  3DA7 A;  4KED A;  5HVK D;  3CI5 G;  1X67 A;  5KYN A;  1PD0 A;  4LIZ A;  2L72 A;  1YAG G;  1CFY A;  4KEF A;  1C0F S;  2LXX A;  5KYU B;  3FFK A;  1PD1 A;  1WM4 A;  2XFA A;  1HQZ 1;  5A1M A;  2W0I A;  2FF6 G;  1SVR A;  1VFQ A;  1F7S A;  1COF A;  1J72 A;  3CJC G;  4CBU G;  4JD2 H;  2LJ8 A;  1WFS A;  2NUP A;  3A5L S;  4CBX G;  1D4X G;  3EGX A;  3FG6 A;  3A5M S;  4BEX 1;  1TMW A;  2MOT A;  1WNJ A;  1DEJ S;  1AHQ A;  1NMD G;  5KYW A;  5HVK B;  3DAW B;  1VKK A;  1T3Y A;  3CJB G;  2VAC A;  1KCQ A;  1SVQ A;  3EFO A;  1M4J A;  1Q8G A;  2FH3 A;  1C0G S;  1T3X A;  1V6F A;  3Q2B A;  3A5N S;  1PCX A;  2FH4 A;  2VIL A; 
#chains in the Genus database with same CATH homology
 4S10 C;  5DD2 A;  2FGH A;  1M2V B;  1P8Z G;  2MV2 A;  3FG7 A;  5KYY A;  1UDM A;  5IVU A;  2LLF A;  3CIP G;  2FF3 A;  1QPV A;  1M2O A;  1SVY A;  1T44 G;  2NUP B;  1YVN G;  3EGD A;  1MDU A;  2FH2 A;  1NPH A;  3EFO B;  1AK6 A;  1CNU A;  3EG9 A;  1EQY S;  1NM1 G;  2D8B A;  1D0N A;  3TU5 B;  3EH1 A;  5L6W C;  5KYX B;  1JHW A;  1ESV S;  3FFN A;  1NLV G;  3L50 A;  4Z94 G;  2FH1 A;  3EH2 A;  5KYU A;  2HD7 A;  2NUT B;  2NUT A;  4PKI G;  4PKG G;  3EGX B;  2KVK A;  3EGD B;  4KEE A;  1RGI G;  4CBW G;  1TVJ A;  2MP4 A;  1M2V A;  5KYY B;  1H1V G;  1T2L A;  3EG9 B;  2XF1 A;  3A5O S;  1Q8X A;  2VIK A;  1P8X A;  5KYW B;  5KYX A;  1AK7 A;  2QTV A;  4PKH B;  5FAE A;  5FAF A;  2I2Q A;  3DA7 A;  4KED A;  5HVK D;  3CI5 G;  1X67 A;  5KYN A;  1PD0 A;  4LIZ A;  2L72 A;  1YAG G;  1CFY A;  4KEF A;  1C0F S;  2LXX A;  5KYU B;  3FFK A;  1PD1 A;  1WM4 A;  2XFA A;  1HQZ 1;  5A1M A;  2W0I A;  2FF6 G;  1SVR A;  1VFQ A;  1F7S A;  1COF A;  1J72 A;  3CJC G;  4CBU G;  4JD2 H;  2LJ8 A;  1WFS A;  2NUP A;  3A5L S;  4CBX G;  1D4X G;  3EGX A;  3FG6 A;  3A5M S;  4BEX 1;  1TMW A;  2MOT A;  1WNJ A;  1DEJ S;  1AHQ A;  1NMD G;  5KYW A;  5HVK B;  3DAW B;  1VKK A;  1T3Y A;  3CJB G;  2VAC A;  1KCQ A;  1SVQ A;  3EFO A;  1M4J A;  1Q8G A;  2FH3 A;  1C0G S;  1T3X A;  1V6F A;  3Q2B A;  3A5N S;  1PCX A;  2FH4 A;  2VIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...