2FH3A

C-terminal half of gelsolin soaked in low calcium at ph 8
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
330
structure length
321
Chain Sequence
MDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDTPITVVKQGFEPPSFVGWFLGWDDDYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Calcium ion exchange in crystalline gelsolin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords Gelsolin
total genus 92
structure length 321
sequence length 330
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 2fh3A01
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 2fh3A03
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 2fh3A02
2NUPA 1NPHA 2VACA 5KYNA 2LJ8A 1PCXA 3A5NS 5KYYB 2MOTA 5FAFA 2HD7A 3EGXA 1Q8XA 1V6FA 1NM1G 3A5OS 5A1MA 1NLVG 1DEJS 3EFOB 3CJCG 5DD2A 2FH2A 5L6WC 1F7SA 1SVQA 5IVUA 3EGDA 1YAGG 3EFOA 4CBXG 1C0FS 1YVNG 1T3XA 1T3YA 3FFNA 1ESVS 3TU5B 2KVKA 1TMWA 3EGDB 2W0IA 2FH1A 1MDUA 2L72A 1T44G 4KEFA 5HVKB 3L50A 2MV2A 3FG6A 1H1VG 1M2OA 2LLFA 1AK6A 1QPVA 2D8BA 2NUTB 1WNJA 2MP4A 1M4JA 1D0NA 4LIZA 2FH4A 2FF6G 1NMDG 1UDMA 1M2VB 2QTVA 2NUTA 3A5MS 5KYXB 4PKHB 1VFQA 1KCQA 1P8XA 3FFKA 2LXXA 5FAEA 1CFYA 3EG9B 3EH2A 1D4XG 1SVYA 1WM4A 1P8ZG 3DAWB 2NUPB 1PD0A 4PKGG 4CBWG 1WFSA 4S10C 4KEEA 5KYUA 1PD1A 3CJBG 3FG7A 3EGXB 4KEDA 5HVKD 2FF3A 4JD2H 5KYUB 1SVRA 2FGHA 2I2QA 1JHWA 1HQZ1 1AK7A 2VIKA 1COFA 1T2LA 1J72A 4PKIG 5KYWA 3CIPG 3EH1A 1TVJA 2XF1A 4CBUG 2VILA 1M2VA 2FH3A 1AHQA 5KYWB 1X67A 5KYXA 1Q8GA 4Z94G 1VKKA 3CI5G 3Q2BA 1CNUA 3EG9A 4BEX1 1C0GS 3A5LS 1EQYS 5KYYA 2XFAA 1RGIG
chains in the Genus database with same CATH superfamily
2NUPA 1NPHA 2VACA 5KYNA 2LJ8A 1PCXA 3A5NS 5KYYB 2MOTA 5FAFA 2HD7A 3EGXA 1Q8XA 1V6FA 1NM1G 3A5OS 5A1MA 1NLVG 1DEJS 3EFOB 3CJCG 5DD2A 2FH2A 5L6WC 1F7SA 1SVQA 5IVUA 3EGDA 1YAGG 3EFOA 4CBXG 1C0FS 1YVNG 1T3XA 1T3YA 3FFNA 1ESVS 3TU5B 2KVKA 1TMWA 3EGDB 2W0IA 2FH1A 1MDUA 2L72A 1T44G 4KEFA 5HVKB 3L50A 2MV2A 3FG6A 1H1VG 1M2OA 2LLFA 1AK6A 1QPVA 2D8BA 2NUTB 1WNJA 2MP4A 1M4JA 1D0NA 4LIZA 2FH4A 2FF6G 1NMDG 1UDMA 1M2VB 2QTVA 2NUTA 3A5MS 5KYXB 4PKHB 1VFQA 1KCQA 1P8XA 3FFKA 2LXXA 5FAEA 1CFYA 3EG9B 3EH2A 1D4XG 1SVYA 1WM4A 1P8ZG 3DAWB 2NUPB 1PD0A 4PKGG 4CBWG 1WFSA 4S10C 4KEEA 5KYUA 1PD1A 3CJBG 3FG7A 3EGXB 4KEDA 5HVKD 2FF3A 4JD2H 5KYUB 1SVRA 2FGHA 2I2QA 1JHWA 1HQZ1 3DA7A 1AK7A 2VIKA 1COFA 1T2LA 1J72A 4PKIG 5KYWA 3CIPG 3EH1A 1TVJA 2XF1A 4CBUG 2VILA 1M2VA 2FH3A 1AHQA 5KYWB 1X67A 5KYXA 1Q8GA 4Z94G 1VKKA 3CI5G 3Q2BA 1CNUA 3EG9A 4BEX1 1C0GS 3A5LS 1EQYS 5KYYA 2XFAA 1RGIG
chains in the Genus database with same CATH topology
2NUPA 1NPHA 2VACA 5KYNA 2LJ8A 1PCXA 3A5NS 5KYYB 2MOTA 5FAFA 2HD7A 3EGXA 1Q8XA 1V6FA 1NM1G 3A5OS 5A1MA 1NLVG 1DEJS 3EFOB 3CJCG 5DD2A 2FH2A 5L6WC 1F7SA 1SVQA 5IVUA 3EGDA 1YAGG 3EFOA 4CBXG 1C0FS 1YVNG 1T3XA 1T3YA 3FFNA 1ESVS 3TU5B 2KVKA 1TMWA 3EGDB 2W0IA 2FH1A 1MDUA 2L72A 1T44G 4KEFA 5HVKB 3L50A 2MV2A 3FG6A 1H1VG 1M2OA 2LLFA 1AK6A 1QPVA 2D8BA 2NUTB 1WNJA 2MP4A 1M4JA 1D0NA 4LIZA 2FH4A 2FF6G 1NMDG 1UDMA 1M2VB 2QTVA 2NUTA 3A5MS 5KYXB 4PKHB 1VFQA 1KCQA 1P8XA 3FFKA 2LXXA 5FAEA 1CFYA 3EG9B 3EH2A 1D4XG 1SVYA 1WM4A 1P8ZG 3DAWB 2NUPB 1PD0A 4PKGG 4CBWG 1WFSA 4S10C 4KEEA 5KYUA 1PD1A 3CJBG 3FG7A 3EGXB 4KEDA 5HVKD 2FF3A 4JD2H 5KYUB 1SVRA 2FGHA 2I2QA 1JHWA 1HQZ1 3DA7A 1AK7A 2VIKA 1COFA 1T2LA 1J72A 4PKIG 5KYWA 3CIPG 3EH1A 1TVJA 2XF1A 4CBUG 2VILA 1M2VA 2FH3A 1AHQA 5KYWB 1X67A 5KYXA 1Q8GA 4Z94G 1VKKA 3CI5G 3Q2BA 1CNUA 3EG9A 4BEX1 1C0GS 3A5LS 1EQYS 5KYYA 2XFAA 1RGIG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUP A;  1NPH A;  2VAC A;  5KYN A;  2LJ8 A;  1PCX A;  3A5N S;  5KYY B;  2MOT A;  5FAF A;  2HD7 A;  3EGX A;  1Q8X A;  1V6F A;  1NM1 G;  3A5O S;  5A1M A;  1NLV G;  1DEJ S;  3EFO B;  3CJC G;  5DD2 A;  2FH2 A;  5L6W C;  1F7S A;  1SVQ A;  5IVU A;  3EGD A;  1YAG G;  3EFO A;  4CBX G;  1C0F S;  1YVN G;  1T3X A;  1T3Y A;  3FFN A;  1ESV S;  3TU5 B;  2KVK A;  1TMW A;  3EGD B;  2W0I A;  2FH1 A;  1MDU A;  2L72 A;  1T44 G;  4KEF A;  5HVK B;  3L50 A;  2MV2 A;  3FG6 A;  1H1V G;  1M2O A;  2LLF A;  1AK6 A;  1QPV A;  2D8B A;  2NUT B;  1WNJ A;  2MP4 A;  1M4J A;  1D0N A;  4LIZ A;  2FH4 A;  2FF6 G;  1NMD G;  1UDM A;  1M2V B;  2QTV A;  2NUT A;  3A5M S;  5KYX B;  4PKH B;  1VFQ A;  1KCQ A;  1P8X A;  3FFK A;  2LXX A;  5FAE A;  1CFY A;  3EG9 B;  3EH2 A;  1D4X G;  1SVY A;  1WM4 A;  1P8Z G;  3DAW B;  2NUP B;  1PD0 A;  4PKG G;  4CBW G;  1WFS A;  4S10 C;  4KEE A;  5KYU A;  1PD1 A;  3CJB G;  3FG7 A;  3EGX B;  4KED A;  5HVK D;  2FF3 A;  4JD2 H;  5KYU B;  1SVR A;  2FGH A;  2I2Q A;  1JHW A;  1HQZ 1;  1AK7 A;  2VIK A;  1COF A;  1T2L A;  1J72 A;  4PKI G;  5KYW A;  3CIP G;  3EH1 A;  1TVJ A;  2XF1 A;  4CBU G;  2VIL A;  1M2V A;  2FH3 A;  1AHQ A;  5KYW B;  1X67 A;  5KYX A;  1Q8G A;  4Z94 G;  1VKK A;  3CI5 G;  3Q2B A;  1CNU A;  3EG9 A;  4BEX 1;  1C0G S;  3A5L S;  1EQY S;  5KYY A;  2XFA A;  1RGI G; 
#chains in the Genus database with same CATH topology
 2NUP A;  1NPH A;  2VAC A;  5KYN A;  2LJ8 A;  1PCX A;  3A5N S;  5KYY B;  2MOT A;  5FAF A;  2HD7 A;  3EGX A;  1Q8X A;  1V6F A;  1NM1 G;  3A5O S;  5A1M A;  1NLV G;  1DEJ S;  3EFO B;  3CJC G;  5DD2 A;  2FH2 A;  5L6W C;  1F7S A;  1SVQ A;  5IVU A;  3EGD A;  1YAG G;  3EFO A;  4CBX G;  1C0F S;  1YVN G;  1T3X A;  1T3Y A;  3FFN A;  1ESV S;  3TU5 B;  2KVK A;  1TMW A;  3EGD B;  2W0I A;  2FH1 A;  1MDU A;  2L72 A;  1T44 G;  4KEF A;  5HVK B;  3L50 A;  2MV2 A;  3FG6 A;  1H1V G;  1M2O A;  2LLF A;  1AK6 A;  1QPV A;  2D8B A;  2NUT B;  1WNJ A;  2MP4 A;  1M4J A;  1D0N A;  4LIZ A;  2FH4 A;  2FF6 G;  1NMD G;  1UDM A;  1M2V B;  2QTV A;  2NUT A;  3A5M S;  5KYX B;  4PKH B;  1VFQ A;  1KCQ A;  1P8X A;  3FFK A;  2LXX A;  5FAE A;  1CFY A;  3EG9 B;  3EH2 A;  1D4X G;  1SVY A;  1WM4 A;  1P8Z G;  3DAW B;  2NUP B;  1PD0 A;  4PKG G;  4CBW G;  1WFS A;  4S10 C;  4KEE A;  5KYU A;  1PD1 A;  3CJB G;  3FG7 A;  3EGX B;  4KED A;  5HVK D;  2FF3 A;  4JD2 H;  5KYU B;  1SVR A;  2FGH A;  2I2Q A;  1JHW A;  1HQZ 1;  3DA7 A;  1AK7 A;  2VIK A;  1COF A;  1T2L A;  1J72 A;  4PKI G;  5KYW A;  3CIP G;  3EH1 A;  1TVJ A;  2XF1 A;  4CBU G;  2VIL A;  1M2V A;  2FH3 A;  1AHQ A;  5KYW B;  1X67 A;  5KYX A;  1Q8G A;  4Z94 G;  1VKK A;  3CI5 G;  3Q2B A;  1CNU A;  3EG9 A;  4BEX 1;  1C0G S;  3A5L S;  1EQY S;  5KYY A;  2XFA A;  1RGI G; 
#chains in the Genus database with same CATH homology
 2NUP A;  1NPH A;  2VAC A;  5KYN A;  2LJ8 A;  1PCX A;  3A5N S;  5KYY B;  2MOT A;  5FAF A;  2HD7 A;  3EGX A;  1Q8X A;  1V6F A;  1NM1 G;  3A5O S;  5A1M A;  1NLV G;  1DEJ S;  3EFO B;  3CJC G;  5DD2 A;  2FH2 A;  5L6W C;  1F7S A;  1SVQ A;  5IVU A;  3EGD A;  1YAG G;  3EFO A;  4CBX G;  1C0F S;  1YVN G;  1T3X A;  1T3Y A;  3FFN A;  1ESV S;  3TU5 B;  2KVK A;  1TMW A;  3EGD B;  2W0I A;  2FH1 A;  1MDU A;  2L72 A;  1T44 G;  4KEF A;  5HVK B;  3L50 A;  2MV2 A;  3FG6 A;  1H1V G;  1M2O A;  2LLF A;  1AK6 A;  1QPV A;  2D8B A;  2NUT B;  1WNJ A;  2MP4 A;  1M4J A;  1D0N A;  4LIZ A;  2FH4 A;  2FF6 G;  1NMD G;  1UDM A;  1M2V B;  2QTV A;  2NUT A;  3A5M S;  5KYX B;  4PKH B;  1VFQ A;  1KCQ A;  1P8X A;  3FFK A;  2LXX A;  5FAE A;  1CFY A;  3EG9 B;  3EH2 A;  1D4X G;  1SVY A;  1WM4 A;  1P8Z G;  3DAW B;  2NUP B;  1PD0 A;  4PKG G;  4CBW G;  1WFS A;  4S10 C;  4KEE A;  5KYU A;  1PD1 A;  3CJB G;  3FG7 A;  3EGX B;  4KED A;  5HVK D;  2FF3 A;  4JD2 H;  5KYU B;  1SVR A;  2FGH A;  2I2Q A;  1JHW A;  1HQZ 1;  3DA7 A;  1AK7 A;  2VIK A;  1COF A;  1T2L A;  1J72 A;  4PKI G;  5KYW A;  3CIP G;  3EH1 A;  1TVJ A;  2XF1 A;  4CBU G;  2VIL A;  1M2V A;  2FH3 A;  1AHQ A;  5KYW B;  1X67 A;  5KYX A;  1Q8G A;  4Z94 G;  1VKK A;  3CI5 G;  3Q2B A;  1CNU A;  3EG9 A;  4BEX 1;  1C0G S;  3A5L S;  1EQY S;  5KYY A;  2XFA A;  1RGI G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...