2FH4A

C-terminal half of gelsolin soaked in egta at ph 8
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
330
structure length
307
Chain Sequence
MDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMHPPRLFACEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDTPITVVKQGFEPPSFVGWFLGWDDDYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Calcium ion exchange in crystalline gelsolin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords Gelsolin
total genus 81
structure length 307
sequence length 330
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 2fh4A01
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 2fh4A03
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 2fh4A02
1WFSA 5A1MA 1ESVS 3FFKA 1RGIG 1T44G 1AK7A 1WNJA 3EGXA 5KYWA 5FAFA 1Q8GA 4PKHB 2LJ8A 3EFOB 2QTVA 3FG7A 3A5NS 2VILA 2NUTB 1QPVA 1SVQA 1CNUA 2FH4A 1AHQA 1H1VG 5KYWB 1D0NA 5KYNA 4PKIG 3A5MS 1AK6A 1CFYA 4KEDA 4JD2H 1JHWA 1PD1A 5IVUA 2FH2A 3CI5G 1VFQA 2NUPB 3FG6A 4BEX1 4KEFA 1NLVG 3EG9A 1HQZ1 1VKKA 1Q8XA 3EFOA 3EGDA 2MOTA 4PKGG 1C0GS 1MDUA 5KYYB 1P8ZG 3A5LS 1PCXA 2L72A 3L50A 1X67A 5FAEA 2NUPA 4Z94G 1NPHA 1M2OA 2LXXA 1T2LA 3Q2BA 1TMWA 5KYUA 1PD0A 5HVKD 5HVKB 5L6WC 3TU5B 1COFA 1J72A 4CBXG 1M2VA 1UDMA 2VIKA 2FF3A 3CJCG 3DAWB 1YVNG 3EGXB 3EG9B 2MV2A 2FGHA 4CBUG 1SVYA 5KYUB 3CIPG 1NM1G 1P8XA 1T3YA 3EGDB 2D8BA 5KYXA 3CJBG 5KYYA 1C0FS 1M2VB 1YAGG 1M4JA 3EH2A 2XF1A 2I2QA 1KCQA 2NUTA 1WM4A 4KEEA 1V6FA 1NMDG 2FH3A 4LIZA 1SVRA 1F7SA 2HD7A 1D4XG 2FF6G 3EH1A 2VACA 3A5OS 2KVKA 4S10C 5DD2A 2LLFA 4CBWG 2FH1A 1EQYS 1DEJS 1T3XA 3FFNA 1TVJA 2MP4A 5KYXB 2W0IA 2XFAA
chains in the Genus database with same CATH superfamily
1WFSA 5A1MA 1ESVS 3FFKA 1RGIG 1T44G 1AK7A 1WNJA 3EGXA 5KYWA 5FAFA 1Q8GA 4PKHB 2LJ8A 3EFOB 2QTVA 3FG7A 3A5NS 2VILA 2NUTB 1QPVA 1SVQA 1CNUA 2FH4A 1AHQA 1H1VG 5KYWB 1D0NA 5KYNA 4PKIG 3A5MS 1AK6A 1CFYA 4KEDA 4JD2H 1JHWA 1PD1A 5IVUA 2FH2A 3CI5G 1VFQA 2NUPB 3FG6A 4BEX1 4KEFA 1NLVG 3EG9A 1HQZ1 1VKKA 1Q8XA 3EFOA 3EGDA 2MOTA 4PKGG 1C0GS 1MDUA 5KYYB 1P8ZG 3A5LS 1PCXA 2L72A 3L50A 1X67A 5FAEA 2NUPA 4Z94G 3DA7A 1NPHA 1M2OA 2LXXA 1T2LA 3Q2BA 1TMWA 5KYUA 1PD0A 5HVKD 5HVKB 5L6WC 3TU5B 1COFA 1J72A 4CBXG 1M2VA 1UDMA 2VIKA 2FF3A 3CJCG 3DAWB 1YVNG 3EGXB 3EG9B 2MV2A 2FGHA 4CBUG 1SVYA 5KYUB 3CIPG 1NM1G 1P8XA 1T3YA 3EGDB 2D8BA 5KYXA 3CJBG 5KYYA 1C0FS 1M2VB 1YAGG 1M4JA 3EH2A 2XF1A 2I2QA 1KCQA 2NUTA 1WM4A 4KEEA 1V6FA 1NMDG 2FH3A 4LIZA 1SVRA 1F7SA 2HD7A 1D4XG 2FF6G 3EH1A 2VACA 3A5OS 2KVKA 4S10C 5DD2A 2LLFA 4CBWG 2FH1A 1EQYS 1DEJS 1T3XA 3FFNA 1TVJA 2MP4A 5KYXB 2W0IA 2XFAA
chains in the Genus database with same CATH topology
1WFSA 5A1MA 1ESVS 3FFKA 1RGIG 1T44G 1AK7A 1WNJA 3EGXA 5KYWA 5FAFA 1Q8GA 4PKHB 2LJ8A 3EFOB 2QTVA 3FG7A 3A5NS 2VILA 2NUTB 1QPVA 1SVQA 1CNUA 2FH4A 1AHQA 1H1VG 5KYWB 1D0NA 5KYNA 4PKIG 3A5MS 1AK6A 1CFYA 4KEDA 4JD2H 1JHWA 1PD1A 5IVUA 2FH2A 3CI5G 1VFQA 2NUPB 3FG6A 4BEX1 4KEFA 1NLVG 3EG9A 1HQZ1 1VKKA 1Q8XA 3EFOA 3EGDA 2MOTA 4PKGG 1C0GS 1MDUA 5KYYB 1P8ZG 3A5LS 1PCXA 2L72A 3L50A 1X67A 5FAEA 2NUPA 4Z94G 3DA7A 1NPHA 1M2OA 2LXXA 1T2LA 3Q2BA 1TMWA 5KYUA 1PD0A 5HVKD 5HVKB 5L6WC 3TU5B 1COFA 1J72A 4CBXG 1M2VA 1UDMA 2VIKA 2FF3A 3CJCG 3DAWB 1YVNG 3EGXB 3EG9B 2MV2A 2FGHA 4CBUG 1SVYA 5KYUB 3CIPG 1NM1G 1P8XA 1T3YA 3EGDB 2D8BA 5KYXA 3CJBG 5KYYA 1C0FS 1M2VB 1YAGG 1M4JA 3EH2A 2XF1A 2I2QA 1KCQA 2NUTA 1WM4A 4KEEA 1V6FA 1NMDG 2FH3A 4LIZA 1SVRA 1F7SA 2HD7A 1D4XG 2FF6G 3EH1A 2VACA 3A5OS 2KVKA 4S10C 5DD2A 2LLFA 4CBWG 2FH1A 1EQYS 1DEJS 1T3XA 3FFNA 1TVJA 2MP4A 5KYXB 2W0IA 2XFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFS A;  5A1M A;  1ESV S;  3FFK A;  1RGI G;  1T44 G;  1AK7 A;  1WNJ A;  3EGX A;  5KYW A;  5FAF A;  1Q8G A;  4PKH B;  2LJ8 A;  3EFO B;  2QTV A;  3FG7 A;  3A5N S;  2VIL A;  2NUT B;  1QPV A;  1SVQ A;  1CNU A;  2FH4 A;  1AHQ A;  1H1V G;  5KYW B;  1D0N A;  5KYN A;  4PKI G;  3A5M S;  1AK6 A;  1CFY A;  4KED A;  4JD2 H;  1JHW A;  1PD1 A;  5IVU A;  2FH2 A;  3CI5 G;  1VFQ A;  2NUP B;  3FG6 A;  4BEX 1;  4KEF A;  1NLV G;  3EG9 A;  1HQZ 1;  1VKK A;  1Q8X A;  3EFO A;  3EGD A;  2MOT A;  4PKG G;  1C0G S;  1MDU A;  5KYY B;  1P8Z G;  3A5L S;  1PCX A;  2L72 A;  3L50 A;  1X67 A;  5FAE A;  2NUP A;  4Z94 G;  1NPH A;  1M2O A;  2LXX A;  1T2L A;  3Q2B A;  1TMW A;  5KYU A;  1PD0 A;  5HVK D;  5HVK B;  5L6W C;  3TU5 B;  1COF A;  1J72 A;  4CBX G;  1M2V A;  1UDM A;  2VIK A;  2FF3 A;  3CJC G;  3DAW B;  1YVN G;  3EGX B;  3EG9 B;  2MV2 A;  2FGH A;  4CBU G;  1SVY A;  5KYU B;  3CIP G;  1NM1 G;  1P8X A;  1T3Y A;  3EGD B;  2D8B A;  5KYX A;  3CJB G;  5KYY A;  1C0F S;  1M2V B;  1YAG G;  1M4J A;  3EH2 A;  2XF1 A;  2I2Q A;  1KCQ A;  2NUT A;  1WM4 A;  4KEE A;  1V6F A;  1NMD G;  2FH3 A;  4LIZ A;  1SVR A;  1F7S A;  2HD7 A;  1D4X G;  2FF6 G;  3EH1 A;  2VAC A;  3A5O S;  2KVK A;  4S10 C;  5DD2 A;  2LLF A;  4CBW G;  2FH1 A;  1EQY S;  1DEJ S;  1T3X A;  3FFN A;  1TVJ A;  2MP4 A;  5KYX B;  2W0I A;  2XFA A; 
#chains in the Genus database with same CATH topology
 1WFS A;  5A1M A;  1ESV S;  3FFK A;  1RGI G;  1T44 G;  1AK7 A;  1WNJ A;  3EGX A;  5KYW A;  5FAF A;  1Q8G A;  4PKH B;  2LJ8 A;  3EFO B;  2QTV A;  3FG7 A;  3A5N S;  2VIL A;  2NUT B;  1QPV A;  1SVQ A;  1CNU A;  2FH4 A;  1AHQ A;  1H1V G;  5KYW B;  1D0N A;  5KYN A;  4PKI G;  3A5M S;  1AK6 A;  1CFY A;  4KED A;  4JD2 H;  1JHW A;  1PD1 A;  5IVU A;  2FH2 A;  3CI5 G;  1VFQ A;  2NUP B;  3FG6 A;  4BEX 1;  4KEF A;  1NLV G;  3EG9 A;  1HQZ 1;  1VKK A;  1Q8X A;  3EFO A;  3EGD A;  2MOT A;  4PKG G;  1C0G S;  1MDU A;  5KYY B;  1P8Z G;  3A5L S;  1PCX A;  2L72 A;  3L50 A;  1X67 A;  5FAE A;  2NUP A;  4Z94 G;  3DA7 A;  1NPH A;  1M2O A;  2LXX A;  1T2L A;  3Q2B A;  1TMW A;  5KYU A;  1PD0 A;  5HVK D;  5HVK B;  5L6W C;  3TU5 B;  1COF A;  1J72 A;  4CBX G;  1M2V A;  1UDM A;  2VIK A;  2FF3 A;  3CJC G;  3DAW B;  1YVN G;  3EGX B;  3EG9 B;  2MV2 A;  2FGH A;  4CBU G;  1SVY A;  5KYU B;  3CIP G;  1NM1 G;  1P8X A;  1T3Y A;  3EGD B;  2D8B A;  5KYX A;  3CJB G;  5KYY A;  1C0F S;  1M2V B;  1YAG G;  1M4J A;  3EH2 A;  2XF1 A;  2I2Q A;  1KCQ A;  2NUT A;  1WM4 A;  4KEE A;  1V6F A;  1NMD G;  2FH3 A;  4LIZ A;  1SVR A;  1F7S A;  2HD7 A;  1D4X G;  2FF6 G;  3EH1 A;  2VAC A;  3A5O S;  2KVK A;  4S10 C;  5DD2 A;  2LLF A;  4CBW G;  2FH1 A;  1EQY S;  1DEJ S;  1T3X A;  3FFN A;  1TVJ A;  2MP4 A;  5KYX B;  2W0I A;  2XFA A; 
#chains in the Genus database with same CATH homology
 1WFS A;  5A1M A;  1ESV S;  3FFK A;  1RGI G;  1T44 G;  1AK7 A;  1WNJ A;  3EGX A;  5KYW A;  5FAF A;  1Q8G A;  4PKH B;  2LJ8 A;  3EFO B;  2QTV A;  3FG7 A;  3A5N S;  2VIL A;  2NUT B;  1QPV A;  1SVQ A;  1CNU A;  2FH4 A;  1AHQ A;  1H1V G;  5KYW B;  1D0N A;  5KYN A;  4PKI G;  3A5M S;  1AK6 A;  1CFY A;  4KED A;  4JD2 H;  1JHW A;  1PD1 A;  5IVU A;  2FH2 A;  3CI5 G;  1VFQ A;  2NUP B;  3FG6 A;  4BEX 1;  4KEF A;  1NLV G;  3EG9 A;  1HQZ 1;  1VKK A;  1Q8X A;  3EFO A;  3EGD A;  2MOT A;  4PKG G;  1C0G S;  1MDU A;  5KYY B;  1P8Z G;  3A5L S;  1PCX A;  2L72 A;  3L50 A;  1X67 A;  5FAE A;  2NUP A;  4Z94 G;  3DA7 A;  1NPH A;  1M2O A;  2LXX A;  1T2L A;  3Q2B A;  1TMW A;  5KYU A;  1PD0 A;  5HVK D;  5HVK B;  5L6W C;  3TU5 B;  1COF A;  1J72 A;  4CBX G;  1M2V A;  1UDM A;  2VIK A;  2FF3 A;  3CJC G;  3DAW B;  1YVN G;  3EGX B;  3EG9 B;  2MV2 A;  2FGH A;  4CBU G;  1SVY A;  5KYU B;  3CIP G;  1NM1 G;  1P8X A;  1T3Y A;  3EGD B;  2D8B A;  5KYX A;  3CJB G;  5KYY A;  1C0F S;  1M2V B;  1YAG G;  1M4J A;  3EH2 A;  2XF1 A;  2I2Q A;  1KCQ A;  2NUT A;  1WM4 A;  4KEE A;  1V6F A;  1NMD G;  2FH3 A;  4LIZ A;  1SVR A;  1F7S A;  2HD7 A;  1D4X G;  2FF6 G;  3EH1 A;  2VAC A;  3A5O S;  2KVK A;  4S10 C;  5DD2 A;  2LLF A;  4CBW G;  2FH1 A;  1EQY S;  1DEJ S;  1T3X A;  3FFN A;  1TVJ A;  2MP4 A;  5KYX B;  2W0I A;  2XFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...