2FHBA

Crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltose
Total Genus 340
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
340
sequence length
1052
structure length
1052
Chain Sequence
DVVVRLPDVAVPGEAVQASARQAVIHLVDIAGITSSTPADYATKNLYLWNNETCDALSAPVADWNDVSTTPTGSDKYGPYWVIPLTKESGCINVIVRDGTNKLIDSDLRVSFSDFTDRTVSVIAGNSAVYDSRADAFRAAFGVALADAHWVDKTTLLWPGGENKPIVRLYYSHSSKVAADSNGEFSDKYVKLTPTTVNQQVSMRFPHLASYPAFKLPDDVNVDELLQGETVAIAAESDGILSSATQVQTAGVLDDTYAAAAEALSYGAQLTDSGVTFRVWAPTAQQVELVIYSADKKVIASHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPEGWDGLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAQESNMVQHLKQLSASGVTHIELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLTQLKQNDSKDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMLYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDAVRGGGPFDSGDALRQNQGVGSGAGVLPNELTTLSDDQARHLADLTRLGMAGNLADFVLIDKDGAVKRGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRSSDDGSNYDIIARVKDAVATPGETELKQMTAFYQELTALRKSSPLFTLGDGATVMKRVDFRNTGADQQTGLLVMTIDDGMQAGASLDSRVDGIVVAINAAPESRTLQDFAGTSLQLSAIQQAAGDRSLASGVQVAADGSVTLPAWSVAVLELPQGESQGAGLPVSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords pullulanase
publication title Crystal structure of pullulanase: evidence for parallel binding of oligosaccharides in the active site
pubmed doi rcsb
molecule tags Hydrolase
total genus 340
structure length 1052
sequence length 1052
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2005-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fhbA03
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2fhbA01
2.60.40.1130 Mainly Beta Sandwich Immunoglobulin-like Rab geranylgeranyltransferase alpha-subunit, insert domain 2fhbA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fhbA05
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2fhbA04
2YRLA 1NMCC 1KV3A 3ROOB 5BV7L 4YX2L 3KPSB 3RA7L 3B2UD 2YD9A 4O4YL 2I24N 3L5WA 2P5ED 1MAJA 3MREB 5DFVC 5TE4H 1HQRA 3MLSL 3AM8A 3AIQA 1UB5B 4M56A 1V02E 2CBUA 3EO0A 3TO2A 1FH7A 5KSAC 4HAFA 2YC1B 3AOFA 3LIZL 4JO4H 3BJLA 3RNQB 4DVRH 2QQKL 5D96C 3RWCB 1DWHM 3KPRB 3U0PA 4NKQB 4U3XA 3WD0A 2BJML 3TBYA 1EAPA 2C5DC 1FL6A 4PJ8A 2HT2C 3QI9C 5HYJB 5JHDE 4HDIA 5C8BB 5DFAA 1S9VB 3U2SA 4N5UA 4ZNEE 1ZVSB 3L95B 4LEXL 4XCEB 1UQYA 3MROB 2E6QA 4LCWA 4JN1H 5E6YA 5EH1A 1NM9A 1W9XA 3LKOB 1RURH 5DD6A 1PQZB 4PGDA 1HOCA 4Z8FL 5KVDH 3BAXA 4JCLA 2J7EA 4HA4A 4X9HA 4KHXL 2WB5A 1V8HA 1U6AH 3L3OA 3LAFA 1KPUA 3RY4A 3U0WH 3MJ6A 1YMMA 4Q6IB 1NC4B 4U3HA 4PMUA 4L4TA 3AMCA 1M03A 1KFWA 2YLLA 3D0LA 3RFZC 3GHEL 5IG7B 1V0NA 2EPKX 1RJLA 1D5IL 2E7MA 5A2AA 3QB7C 4LKCB 5EN2B 2XN9D 1D6EA 2CKNA 3MGTA 2FNBA 4PRHB 4YQXL 5E6ID 1CT8A 2GK0A 3VFOB 1KGXA 1BYCA 4ETYA 1M53A 1JGLL 2DS4A 1B4JL 4MJ2A 1T20A 3TH3T 12E8H 3CK0H 1LQ0A 3DIFB 3ALGA 3UJTH 4PB0H 1KIRB 3TJEL 1PEZA 1XZ0B 5C6WH 4FP8L 3P0YL 3M8OL 2DMKA 5MI0C 2N7AA 4GZEA 4HU0A 4KH2A 3L3IB 4HIHA 1JMXA 5GRUH 1V3IA 3ARWA 3P4OB 3EFDL 3SDAA 5T1MB 1Z5LB 4QWWC 1J5OH 4XNMA 5DJZA 5K9JH 4HKJA 2X70A 4JB9H 4KTEL 3H9YA 3O11B 1H5BA 1U58B 4LPYA 4EXPX 1HYSD 4OZOA 4KQ3L 5ICZA 5E24E 3AYSA 4Z7VB 5I1GL 4WWKB 4BZ1H 3AXIA 4XGZB 1URLA 2IPUG 2Z92A 3BRDA 3EOBB 4WUKL 3BSGA 1S46A 5AD0A 4KKAC 1DBAH 4Z7OF 3V0VB 5DQ9A 2EEDA 4O9HH 3P0GB 3B4NA 2E3VA 2Q3AA 1IAKA 4POZC 4XCNB 1REIA 4IRJD 4JREB 3STLB 2WNGA 1ND0B 3BKYL 1NCDL 4MDJA 2D7TL 4Y2DC 3WDIA 4PJIB 1S8DA 2QSVA 3V5KA 1NMBH 5C0DB 2V5MA 5J89A 3GI8H 2XQBH 4OLWL 3AY4C 3LSOA 4JFQB 4WW2B 1CLVA 5BYWA 3VFUB 4ZUTA 5F9DC 3GMOA 2BNUB 3WQ5A 1HXMB 1CLYL 1KCRL 4G8EA 2V5TA 3IDNA 2WUCH 3RVWD 2ZUQB 4BH7B 4CN1A 4CD7A 3DX6B 3BO8B 3W0WB 2YL5A 1T1ZB 3AICA 4QGTA 2WSKA 3HZYA 1OAQL 5JA9A 3WHXA 4FN0A 3WIFA 1OT1A 1I8KB 1SVZA 3OKLA 3H2WA 2CIKB 1A3QA 5BXPA 2EPMX 1Y6KR 3FNDA 5KS9B 1UCBH 1IEHA 4XV0A 4JZOA 5C0CA 4GAYA 2HFGL 2DWEA 4W93A 3W6LA 3MV8D 2QQLL 3QPQD 5IOPB 1EDGA 4YHOL 4JFZH 3FOLA 3UTSE 5ABEA 3CMOL 5LA2A 4PJXF 1KB5B 1IEAA 4YFDB 4ZSOA 1J10A 5FOOA 3I6KB 1VERA 1VPOH 2D1ZA 1BVKA 1Q0XL 3V6OE 3IFPA 5CXPA 2HTLD 2B8OT 4WLCA 2E8ZA 1LG1A 2HLFC 1FRGL 1NC2A 2OR9L 3Q0HA 4Z18A 4XXDA 3LKRB 1YNLL 4JAMB 2UY5A 1LDPH 3MOAL 1WUNT 5FKAB 4HZ7A 2MCPL 3DETD 5C0EA 2EJ1A 3OZ9H 1QX1A 1LK2B 3GKZA 1A7PL 3VXSD 2ICWA 3DHJA 3N1MC 4KY1L 3VRIB 3H7LA 3G5XA 1A14L 5A2IH 3BGMB 1RULL 2B0SL 4I3RH 5TDOB 2Z4QB 2XGIA 4OLEA 1WTGT 1XF4A 3BH8B 1GOKA 4PJIF 4UQBA 5CEYA 2H32A 3R1GL 3IGAB 1DJSA 3SHSA 3ECQA 3MLXL 3Q3GA 1JRHL 3TNNB 3L4TA 4CVXB 4ETQA 3MRHA 1MCDA 5F9WB 3D3VD 1G6RL 4ALAH 1Y7VA 1PYWA 4NZCA 5A3ID 3WNOA 1BX2A 3K8KA 1KTKE 1UD2A 2DT3A 4TVPL 1JYVA 5JXAH 4N1HB 3L3DB 2NX5E 1INQA 2X2JA 3L5JA 2VABB 2DQGL 1KCLA 3QHFH 3WO4B 3L1OL 2XZQH 4WV1A 1QA9B 1EEQA 5B8CA 1U8LA 1TTFA 2DQTH 4LGRB 1RZIA 3E6HA 4MDIA 5FYJL 4CW1A 1UD6A 4P7LA 3OJDA 1FPTL 2NZ9C 1UM5H 1JF1A 5I15L 3A6BH 4X6BA 5I8KL 3IDYB 2A6KA 5HNNA 5CEZL 5IFAL 1KXQE 1I85C 2HJFA 2Q7NA 3EJYD 4XZUB 1P9MC 2OX5A 3MO4A 1KJ2A 5E9DB 3KYNA 2BXYA 4D6IA 5AY7A 3VXRA 4OV5B 4ML4A 4JM2F 3ARPA 4NBXB 2HJKA 1S7UA 3A6OA 4PFEA 2O5XL 1EO8L 3AS3A 4AYSA 4Z2IA 4R26H 4L4JA 5I71B 3VE0A 3GH4A 3DXAB 4RAVA 5E2WH 2YUXA 5GRYA 4NJAH 4ZYKA 4UZUA 1IFHH 1WAWA 5FUZH 1ZT4A 4PGBB 5ESQA 5D7LA 4DZ8A 4YLQT 4OTXH 2X4TA 3LKQA 4HS3B 4LSSL 2A0LD 3WEZA 1TQTA 1FP5A 2HN7A 1T6WA 4CMMB 1ROWA 4U6YB 2CEQA 4UOZA 2B5IB 4NWUH 1MFDH 4PJGE 4XHJD 1OAKL 4O2EB 5T1LD 1EA9C 1GGIL 4Z95L 3N15A 5D2LE 4LSQH 5IJKC 4DK3A 4JFED 3QIBC 5HSFA 1II4E 2DI9A 5HYQA 4AG4H 1PSKH 3PNWA 3L3JA 4M61B 4MXWH 5I23A 1H41A 1GQKA 5FEBA 2XY2A 4YJZL 1JPSL 3NZ8A 4HC1L 3OSKA 2JIXA 4P59H 1PZ3A 2CBIA 3K8LA 4XCYB 4QY8B 1ISVA 3AIWA 1L9MA 1X5JA 2AAVA 3QFJE 5I1AB 3BHBB 4ONGL 1AQDA 4P4KD 1W1TA 4NM8L 5EU3B 1PZUB 1AP2B 1VGKA 2A9MH 5IHUL 5E6ZA 3IVKA 2O9RA 3FFCB 5ISZE 3BVUA 3OAZH 5ESVB 1TA3A 3H42H 4POYA 1CFSA 5C3TA 1E1FA 1YYLH 2ADJA 5KSAA 3RI5F 3LEVL 4XB8A 5MP6H 3T4YA 3CTTA 1OTUC 5E8EB 4ZFOB 1VADA 2H6PB 4NPYA 5B38A 3Q6FA 4I48B 3V0FA 4JDZA 1ZANL 1NGPL 4CU6A 4RAUB 3MRIB 5DRZB 5IGXH 1TZ7A 3BUDA 3QI9A 5AAWA 1WF5A 4XX6A 2W9LA 3CX5K 3GSXA 1XGTA 5KTEL 4NQDE 5FXCH 1DANU 4H1LG 4BFIB 1WISA 4E41E 4XMKL 5J4MA 4CKQA 2YPLD 5ILTL 3MMEB 2HMID 3GJEB 5GJTH 4LVHB 1ZEAH 3IJSB 4HUMB 4G9DB 4HUNB 5D1ZD 3BKCH 5FUCE 2R69L 2DQIL 3GIZL 1NJ9B 1KTLB 2HKFH 1G0CA 1I9RH 4CCDA 4AZIA 3OTTA 4EK7A 2CXGA 3OKNB 5IV2B 2IUZA 3ILQC 2P49B 4DK6A 2H9GB 2VXUH 4XVSH 4MAYD 4JDTL 2QR0A 5A6BA 1EHNA 4KDVA 2H1PL 5CILH 3IDGA 4G6JH 4HIXL 1QO3A 5DRNA 4CJ0A 4KXZI 3WFZA 4DN3L 4XNXH 1Q1JL 4N0UE 1A7BA 2YDSA 3GNML 3V4VL 3QDGB 4JFPA 5I1EH 4PJAF 4N9GB 5LJYH 1HHIB 2MOVA 2VIRB 3TZVB 4UOW0 3DYMA 4PLKD 4ZUUA 3TCXA 3KG5A 2YUWA 1JZ8A 1J11A 2BHZA 1ES0A 3QA3B 2F19H 2GTZA 4S10A 5C6TL 4KZDH 3OGCB 4W4OC 4AEEA 1OGGA 3UTOA 3VXME 4ZO7A 4NQUA 3WNNA 1KT2B 5BVJB 1AGFB 3GJFK 1U95A 4LSPL 2P7TB 1W3KA 3DX1A 4RISL 5DFTA 1RI8A 3MUZ1 4F7PB 1OPGL 5DK0B 5I1DA 4KJQC 4NO0B 3RAJL 2OTWB 1J01A 1H49A 5EPMA 4CVWA 4HUKB 2YKLL 1F4HA 2VYRE 3NACL 3OKEA 3OMZA 4L1HA 4M8QB 3NOIA 4C4KT 2Q8XA 5FYLD 4YO0A 4GH7B 3D87B 1TJIL 3BZ4B 1QI3A 1OVZA 5I1LA 1NWUA 2ZOKA 4G6AD 4Q7NA 3QEHA 1AO7D 4HUVA 4YHYC 5EORH 1KENL 3TGXA 1WFOA 3OG4B 2WZHA 1U93A 1IM3A 3OKDA 3UERA 3HG5A 1JFQL 2BSRB 1PLGL 4YC2B 3GRWA 4Y2DA 1T1WB 3T2NH 3FXYA 2AK4E 5DUML 1LK3L 4PRPE 4R6UA 3MKKA 2V9TA 3WENA 4LX4A 3IU3A 4LNRA 1PX3A 1YQVH 1NPUA 2V7HB 5I30H 4KJWC 3AY4A 1Q8MA 1FNEA 3C9NB 1KCSH 4LSUL 3SCMD 4XPFL 3DO7B 1XT5A 5J0BA 3SUUA 3EJQA 1VJZA 2BNJA 4TUFA 2VL4A 4KUCD 3VH8A 1S9WA 3AYRA 5IXEA 3DX8A 5IMOA 3BX7C 1SEBA 2X10A 3WNKA 4HK3J 2G3JA 4X4XB 4YDIH 3TWCL 5F3HB 1YECH 1QR1A 1RJZA 5BRZB 1NBZB 2XRAL 4DN4H 2X9YA 1IGML 1W3LA 3LKPB 4W87A 5DJ0A 2J6EH 2NY7H 3TYGL 1G01A 2K1MA 1ZLVK 4X5XA 1CDUA 4FQ1H 2CK0H 1KBKA 3O41A 5ESAA 2CRMA 5HHPA 1A0QL 2KPNA 4M43L 3ZTJH 2ZX9A 5EIIA 1TNNA 4D9LH 1RUPL 4JL1A 3GMLA 4PJ7B 3PWLB 2HWZH 1Q94A 4M5ZH 3TA9A 2AOSA 1TPXB 3QGVA 1RUQH 4K71B 2OCFD 3PQYB 4XNQB 3B8YA 3NFNA 5DD3L 1I3VA 3PZVA 5AYUL 5LAXA 4MA7H 2A77L 1DBKH 2EXYD 2WW5A 2NY1C 1AIFB 3WH6A 1KJVA 1TCMA 2E9WA 4WCYH 4KU1A 3ZE2F 1GPFA 1KXHA 1RUKH 4HZAA 4ZXBB 2CMRH 2DKUA 5A8NA 1C5DB 1BJ1J 1US2A 5D4QA 4YXHL 5D1QB 2VRJA 3HC3H 3AB0B 2FGWL 4YR6B 4KK8D 1P7HL 5F7DB 4NO2B 4UT6L 3VXNB 5B39B 1WO2A 3PWVA 5ABFB 4HWUA 3CZFB 4DUXA 4PIRF 1OTTC 1CLZH 3M17A 1QOKA 3V6OC 1ITCA 2P43B 2VWEE 3CFIC 4DGIL 5IB3A 2B2XL 4QLRA 4OCSL 5T1DL 3SDDD 1ODZA 3OX8B 3F7VA 1GOMA 2I26N 4BUHA 2C8NA 2WWDA 2W0FA 5IFJA 4R2GC 4E4PA 3S88H 4TX8A 4LXFA 1KELL 1E6JH 3DMMB 4RE3A 2WHKA 3VM5A 2FL5B 5SWZD 1UD3A 1SYSA 1IEBA 1ETZA 4KKCD 4QTHB 1G6VK 2ARJB 3O4LA 1AXSB 4G8GE 3JWOC 4RGNB 3UJIH 3MQIA 3HI5L 4GKZA 5L8KB 4H8HA 3H55A 1XRVA 4HKZB 2OP4H 4HJJH 4EDXA 2CETA 4HPYH 4BZ2L 1NGYA 4MA1C 3QZWG 1J1PH 4CDHA 3QFDB 3OXRA 3PWPE 1I85A 3PJSB 4Z7UA 3EJZD 2OK0H 1P9MA 4UB0L 4Z0BH 5GZNC 3DVNB 5C9KA 5KN5B 1HEZB 1N5YL 1E6OL 2VLRA 4IRZL 2NY0B 3C5JB 1FZKA 3A67L 1FZJA 3LY6A 4NQED 4BQBA 2AGJH 4LMQE 1A1NA 2PW1A 2Q8BH 1HJUA 5GS2H 1Q4NX 2EPOA 2HFFA 2YWZA 5EFFA 3DBXA 4YDVB 2NW2B 2J43A 2IANE 1MCFA 3II1A 4M1GL 1YPZB 3TPKA 1M04A 4FZ8H 3O6KH 4GZIA 3ECBB 2AEQL 2IAMB 4LHUG 4PJBB 1D5ZB 5FO7B 4FQXD 4EBQH 3C08L 3RX7A 2N1KA 5DGRA 4OD1H 3R0MA 3DECA 1BQLL 3QIBA 1HQ4B 3VGFA 1QFWI 4F58H 1PFCA 4EN3C 2IBBA 2PYFA 4QOKE 2WVSA 1DQJB 1QFWM 2F5AL 5FCSH 4NYLB 3NIFE 3QDMA 3LXBA 1BQHB 1OD8A 2ICWJ 1H8SA 5EBGA 3S4SA 4XVUC 1U8OA 2F58H 4QRPB 2GTWA 2YFOA 2AW2A 2ZUUA 4ZOAA 2ZUTA 2NXZD 1T22B 1UQSA 3EOTL 1ACYH 2WBKA 4L3AA 1T5WB 5FYKE 3HE6B 1P7KB 2FRGP 4XXCC 5FHAL 2CKSA 1WZMA 3T0EB 1UKTA 4LVNC 3BI9X 4JFHD 2DT0A 5EBWA 1YNKL 2F18A 4L4PA 1V05A 4GKSA 1PIGA 4EOWL 1TCRB 4X7CC 4MHHI 5ICYA 1H3WM 4Z0XA 5AG9A 1W9BM 3SDXF 5EOQL 4FNPA 3HE7C 4LCYA 1LL6A 2NQCA 1WWAX 4EUPB 3QH3B 1N64L 3MCLH 2WBGA 1PG7W 1YEKL 4MB1A 1WC7A 1ZXQA 1F90L 3MRMA 4K3GA 1CGVA 1BQCA 4ZAKD 4JFFE 2R0KH 1F97A 1OM3H 4NNXB 3KR3H 2ZX6A 4QFUA 1KYOJ 1PDKA 3HB3C 2BVQA 4RMRA 1D9KC 3BP6A 4L8BB 3WFDH 8CGTA 3VM7A 1JCKA 2F8XC 1V02A 4GI9A 4EVNB 1MVUB 1H15B 1KLUA 2ZCKL 3W11C 5GS0D 1GHSA 3MC0A 1G94A 1D5XB 2DICA 3BD3A 1Y18A 4IOSD 4M7JH 1KEML 2ERJB 3TNMA 1MJ7L 4D9RE 3D18A 1HE7A 2GSIA 2PW2B 2Q7YA 3KPTA 4YBLB 4CRPA 2R8SH 1HH9A 2V2TB 2IBZX 4D0CA 3O2DH 3WLBB 4ZNEA 4PJ9D 3MRJA 5C7XH 1RJCA 1K8DB 4X8JB 3F7YB 1FO0A 1RJYB 5E1HB 3NCEB 2XZAH 1QG3A 2I07A 5INCB 2VQTA 3PGDA 2IXVA 4XBGA 3KLDA 1R3HB 4YWGH 4W4OA 2VSDA 2AJVL 4PRDA 5GHWL 3LEYL 5FUCC 3ESVF 5HDOA 3RKDD 1CE1H 3WJJC 4ZXLA 3JTTA 1MHEA 2IJ0C 4GQ9L 5J13B 2W67A 4HIJB 4YXLH 2MANA 4EDWH 1T04B 5EO1B 2BVYA 2ZWLT 3CFKB 1R24A 1FE8H 3VD7A 4ZFFB 3FO2A 5BZDA 1MFAH 3FB6B 3RGVC 5J1TC 5DJDA 3FT2A 3BW9B 2ZXDA 1NCAH 5EUKB 3WH9A 2KQNA 2OBGA 3K46A 3NSMA 2PYEB 4PP2A 2IXUA 1QSFE 4H26A 1F3DH 1GPOH 1BZ9B 4PMZA 4ZDHB 1ZJBA 4P2QB 4QT5A 3WXWH 2E3ZA 3MZGB 2EKSB 3LS5L 3CC5B 4PBVC 2AKRB 4D9QD 2HTKC 2GY7B 2YK1L 3FQTA 5AZ2H 4HWEL 1YC7A 3O3UN 3FN3A 5B22A 1JWUA 3QO1A 4NKDB 1R5WA 1DBML 3HLAA 5I8CA 1A6TA 1I9EA 1TETH 4NT6B 1UR2A 3LPFA 1I9JL 2Z91B 3INUH 5IT2L 4BQ9A 1NFDF 4UU9B 2VL5A 3CFCL 1NSNL 1XR8A 4HEPG 2X40A 3ZQ9A 5CD3A 2V5SA 3WDPP 4XWOC 4Z7OE 4QRSA 2WCAA 5FUOL 4LQFL 1XGPA 4JO1L 3RWGA 4ODTH 3X14A 3MRQB 4HJ0C 1IAIL 3GMMB 3RUGF 4WUUB 4WJXA 2ZCLH 1A6UH 2P24A 2RFXA 3MR9B 1XIWD 1CDIA 2F54D 3WL9A 2W9EH 2J5LB 1V0MA 1AC0A 1UZ8A 3CDCA 3IFOB 4XRCA 3VI3F 1ISXA 1CDHA 3WH8A 1BFNA 2RGSA 3RX5A 1TZHA 2DTMH 4MNQB 2Z31C 3ULVL 3CD4A 4PS4L 4JG0H 4NQCD 4WW1B 1S7TB 3O81A 3H3PL 1N6QL 1A1MB 3CVHH 3V5HB 4LRNL 1TXKA 3WFEH 4K7PL 5IMKA 3WKNA 4BQCA 2ICES 4JPIA 3MRCB 5FGBC 4JLRA 2A73A 1MFEH 2YD3A 1CZ8H 1CFTB 4CDGC 3LRLA 5HOSA 3WIHA 1G7IA 3BMWA 4M9PA 3MRDA 4FG6D 4L9LB 1FFNB 3BLBA 1N5AA 1T7ZA 5ANMB 4IISA 5IW1A 2AJZA 3SCTA 3QNYA 3QRFM 4KRLB 1HXJA 2ZX7A 4QRRD 2XV6B 1U91B 3QG7L 4GZJA 2XI9A 2AXHA 2UYLB 4LIQL 4Q6YA 1FNSL 3FQNB 3P77B 5EFIA 5KSBB 3P9MA 5EC1A 3C5SA 4S1RH 1MFCH 2J8UB 4FQJL 2P48B 1E40A 2W60A 5JPNA 2NLJA 5E5MA 3QQ9C 2QLVB 1A7OL 3G5VB 1S7RA 3C09B 5CP7A 1VB9A 3BISA 5JQ6H 1G9NC 4ODBD 1UWXK 4TUKH 3X11B 4P2OD 3SJVE 5F9AC 3LKNA 3NAAL 4YE4H 5C9JA 4KMQA 2GIYA 5E9AA 4QLJA 3QAZC 4B0MM 3R8QA 3DOSA 4U0RB 4X6EA 3UTSA 4P48A 4P8WA 1ITXA 5JLZA 3WYRA 4P7RA 1CCZA 2WWKT 4NHCH 1X9QA 2JJUA 3POHA 4P23C 4GG8B 4S2SB 1IGTA 1RZKC 2F53B 2VE6B 3QIUB 1QRND 2I9LB 3V6OA 1Y0LB 1IC1A 4PJCF 1JGVH 1GAFL 2P5WD 2A74A 3QEQD 4CVZA 3Q6GL 2FLBT 5I6XB 1V3MA 1GZPA 5IBLC 4LFHG 4BH8A 2CKBB 1E71M 2P8LA 4Z2KA 3I3DA 2VCBA 4NRYA 3UROR 1CICC 1FLRL 5FB8B 1MAML 1NANI 4BSWB 1NANH 2AJXL 2FZ3A 1T0MA 4PJIE 4FABH 4BCEA 1HYRC 3KYMA 1FP9A 5L9DL 4WFGE 1KNOB 2YSSB 1KN2L 4JQXC 4MX7A 5AYQA 4OT1H 4LLAA 2OLDA 3CUHA 4TULL 5F9OL 3L6FB 1MCLA 4ZTOH 1HHGA 2Y7QB 4IOFC 3OKYA 4X5LA 5HYIA 4E42B 3RWIB 4UFKA 5HJ3B 4Y4HC 4CD5A 3D48R 4S1QL 2MKWA 5E2UH 5GPRA 1M71B 2FATH 2VURA 1QP1A 5DEFB 2VWEC 2WWMD 5KS9E 4ZXOA 1E1EA 5CD5D 1UXWA 3TH4T 4D72A 3T0DA 1HH6A 3QUYB 3FO1B 4K7FA 3KDMA 2YXMA 1IM9A 4Q9QL 4YHZH 1WTLA 4TOYL 5C0AB 2HRLA 3VMNA 3TM6A 4WKAA 2GJZB 2NX5A 4ZMAT 2EYTB 1CVRA 3TJHC 4YPJA 1E5NA 1V3HA 2OS7A 2F9BT 1MW1A 5A6AA 4E5XA 3RWJA 1WCBA 3AXHA 1VAHA 5C86A 4EI5C 5KANI 2P5EB 2IPKB 3MGAA 3FMGH 4DKFH 4DWSD 5HVWA 5ITFB 3U82B 4HGKC 2CCRA 5ABGA 1OSPL 2ZSVB 32C2A 4P8XA 4X99A 4EN3A 1KXQA 5DZLA 2WSPA 3OR7A 4KMTH 1TTGA 2HJLB 5A6SA 2G75A 3LB6C 4P3DB 5DO2C 3BOVA 5MEPA 4AZGA 1WCGA 3T09A 2JLLA 5I18L 1W9PA 5FV1L 4ZEPA 4L3ED 1DWGM 4I0PC 2CLRB 4JRYE 2Q76A 4W81A 1AHWB 2DOCA 4FS0A 4GG6B 4XXCA 3OKOB 3ARXA 3WLWC 2X4NB 2PCPB 2VZTA 4FQQB 1XF1A 3GNPA 1NBYA 4HIIB 1TJHH 2PO6B 3ARFC 4MADA 4PJGA 3PXHA 5EZLB 3IDIB 4H25A 1V7NH 5D2LA 5EZOL 4ODHL 1QLEH 5SX4I 1ZSDB 1H11A 5EO0A 1K9TA 1E5JA 2AS5M 5DJ2B 2NNAA 5BS0B 5SWQA 2GITB 5GZOC 4DTGH 4W7WA 4TVPD 2XN9B 4L5FL 3MLZL 3WN5C 1C08A 3HE7A 3VTRA 5E6IB 2I9TB 3QFJA 5HVFB 4NC0B 2O5ZL 2B31A 3BZFB 2QPUA 4N0RA 2QQNH 5I1IL 5HHOB 5FYJD 3LS4L 1D9KA 4UNUA 2DKSA 5ISZA 4UV4H 1CDCA 5F6HI 5A94A 5LCVH 1LNUA 3G04B 2GJ6E 3ZDYE 3SKNB 5CEZD 4UAOB 4ZPVB 1UZ1A 5A2FA 1MQKL 3N1FC 3WSQH 4M7LT 2OJEA 5E9DE 4GBXC 4KAQH 1KCKA 4HOXA 1CXLA 4NQDA 3DX0A 3SCRA 5L0QC 2UY7A 5GNYA 4JPVL 2D3NA 5FDWB 4JM4H 4E41A 4JRXB 4LLVA 1IGIH 2J44A 3B43A 3E2HB 4K23L 4P5MA 3NFSH 3TA3D 2LFGA 3W81A 5GSRA 5C2BH 2OTUA 4MMXC 2CPUA 1JN6B 2JB6A 4J8RB 2DQUH 1BYDA 4UFLA 3WJJA 5J3HC 4PJAE 4IRJB 3DX7A 3S35H 1CE6A 2W0KA 3CU7A 5TGBB 1E6QM 3MLUH 4PGEA 4YHML 1MHCA 1N6UA 2IMMA 2DQHL 3VGGA 1MVFA 1AQKH 4PLNC 3RGVA 4J27A 3RVUC 2FO1A 3OB0K 2AEPH 4F9JA 2X41A 4N0UA 2J71A 2BSED 5DJXB 4PY7B 3I2CH 4F37K 4D0BA 1QBLL 2OL3H 1E43A 1CGYA 5E08H 2LU3A 2OZ4H 1A8JH 2FYYA 2DJSA 3NTCH 3IDJB 3ARDD 2DIEA 3OPZL 1XGRA 1KIQB 5EIVA 1NMAL 2CQVA 4U1LB 3QG6B 1T3FA 5D93C 1UQZA 4HKBB 3VXMA 1HN1A 2EYSA 3HG1D 3EDKA 1ZS8A 5I76B 4J3UA 2AJSL 4PP1D 4OFYA 1TVNA 1R46A 3FN0L 2DLFH 4JFOA 3C5ZC 3EJPA 1T1XA 4R7NA 2MPAH 1YEDA 3MV8B 1LD9B 2WHMA 3KPMB 1KB5L 2LTQC 3HZVB 4G42A 1YEIH 5A3HA 2NY6D 2VISA 3DTXB 4W8BA 1U8NA 4YFEA 1GIGH 3W9DB 3WUWB 1SYVB 1JXJA 4H1LA 2ZX8A 4L3CA 4WFHD 2HT3C 4YBQD 4V1DD 4ZFGH 2HKHL 3HNSH 3UTTD 3DNKA 4F2MA 1NEZB 2Z31A 5BQ7B 4XP6H 3AQUA 4R90H 1ESWA 4YGVB 4DZBB 1MCPH 4OLVH 4JEGB 4FNRA 1EQPA 4V28A 3WF4A 2CR3A 5DEGA 3IAGC 4U1IB 4XMLH 3CZ8A 1S3KH 1UVQA 3W38A 5IHZA 1BLNB 4QF1B 2HFEA 3O4OC 1HXYB 5FGBA 3U4BL 2AK4A 4PRPA 5IVNA 3RPIA 5DD5L 4W8LA 2X5PA 3NABH 4Y4KD 4WJ5B 3VXSB 3NDYA 4JHWH 1GONA 4ODSH 3UBXG 4HK0B 4AT6A 4U6HB 3F12A 1SBSL 4JG1H 1AXTH 4LRIC 4WEBH 4G9FB 3EYOB 3GMRA 1XF2A 1ITBB 1U3HC 3L7EB 1E4IA 2R23B 4W7VA 3S35X 4LKXB 5KG9B 4AZHA 3GBML 3T1WA 4UFIA 2IQAB 3TV3H 4XP4L 4RWYL 3WBEA 4Y5XB 2JKXA 3G5YA 1K6QH 4Y2OA 4NM4H 4E0RB 3S96A 3D3VB 2JIEA 3P30H 1HDMB 2DH3A 1YYMH 3BKMH 2YL8A 1G7JA 1KEGL 2IGFH 3MLRL 1I1FA 1RMFH 1HIML 4OGZA 5HHVL 1XCTB 2JIWA 3O9WC 2IC2A 5CBEB 3ZTJG 3TBVA 5GSVB 1LO4L 2FIKA 3V6FB 1JDDA 1QNOA 4P23A 3ZE2E 5H94A 1W3HA 4UR9A 1BQUA 1MJJA 25C8H 2APWA 3TN0D 4EAMA 5JA8B 4FMKA 2EPNA 4OQ1A 2BX5A 1T0PB 1Q72H 2ATKA 2FB4H 5F7EH 3KS0H 1CICA 4OZFA 4BQ4A 3T08A 3B5HA 4AZ7A 1XH1A 3FO9A 3LDBB 5E0CA 1UA6H 1T7WA 1IC5H 4K2UL 3VI4F 4QHMB 1T83C 1QOXA 4L4OA 4F57L 4Z77A 1YEGL 4HZLA 1V5JA 1PZ2A 3HN3A 1RIVH 1RVFH 3TVMD 3VXUD 4C7GA 4JQXA 4IOIA 1GGCL 3WD2A 4NHUB 4KI5F 3U1SL 1TQBC 1OP5K 4AQ1B 1NGWB 2OSYA 5DRXB 4RIRB 5KW9H 1SY6H 4FLSA 3WMSA 4Y4HA 3C6LC 3WNPA 4I18B 5JDJA 2ATPA 7FABH 1EFXA 2XTJE 4ISVB 4TRPH 5JW5B 3CFDA 1BFSA 5T1LB 4BZYA 3ZLQC 1MHHA 1YNTB 4Y7EA 5DMKA 7A3HA 4URIA 4JFEB 4JREC 3F62A 4OLYL 2Y8VA 1B31A 2QV4A 1VCAA 4OQTA 2VDOH 1CQYA 4N42A 3EZ8A 4R4BB 1HL9A 1WLHA 2R2EB 1I7ZA 1ONQB 4JY6A 5SX5K 1FL5B 2J12B 2OSLB 3H9ZA 2EYRA 2EDNA 3S36H 2DMBA 5CEXA 5I77A 4M6NL 4GIAA 1Z6JT 3MS8A 2WBJD 4W5UA 1N0XL 1YEFL 3GSWB 1KWGA 5IHBA 1R5VB 4HUWB 5IEKA 4AZCB 4XMPL 5HHXH 2ZPKL 5IFHL 4Q22A 3GI9L 1FZOB 4L8DB 1RZ7L 4XNZC 4G8GA 3MJ8B 1BECA 1DQQB 2ZOLA 3WMCA 1LGVA 2EXWD 3MUHL 2VXTH 5L2KE 1UJTA 4HHAB 4RFOL 3OAYH 1D3CA 4K3JH 1CLXA 2CDGB 5HYSB 3KLKA 1JNLL 2CLZA 3T8XA 1DDHA 3U4AA 3UETA 3VDBA 4W88A 6A3HA 1FJ1B 3PWPA 4LLMA 1D5BB 5GGRB 3IJHB 4NFBA 4P57B 4NN7C 5KZCD 4D6HA 5DK2A 3OHXA 4MNHA 2IALB 2R56H 3O6AA 3PV7A 3LQAL 1XR9A 3RP1A 3AMGA 5IP4A 5IFPA 2EC9U 1QPKA 2XG9A 4XNUH 5GRXG 5C0IB 4I0PA 4ZE4A 3PHAA 4N5EC 2XZCH 4AIZB 1MPAH 2X1QA 3CLEH 2DLTA 5K9KB 4R9HA 3KEHA 1L6ZA 3BP4B 2IPTH 3E8UH 4OCMC 1KGCE 4W7UA 4PJ8D 3ARFA 4OUUA 4MD0A 4ODUA 4JM2C 4NQVB 3CCHB 3QQ4B 4MAYB 4LCWD 1OHQA 1ZA6B 1WBYB 3IT8D 1ZLUK 1EJOL 1B1YA 1ADQH 5EFDA 3RJDA 5TJWK 4P9HH 3DV6B 4M93C 4YHIB 2X9XA 3QIWD 4NQTA 4CUCA 1FYTE 5BXTA 3WN5A 5ECUA 3KYKL 1DWJM 5CIPA 5A43C 2OMBA 1BIHA 4P99A 2D7NA 2VR5A 1RK1A 2UWEB 2D7QA 5M03A 4BK4A 4NFDA 4RMSA 3MRNA 1FH5H 3SO3B 3VFWB 4NC1E 4CADA 3WL1A 1E4XH 1LO0H 1MJ8H 1Q9OB 2VKWA 2YD1A 3PABB 1A3RL 2C3VA 4L1DA 4FQCL 4PV9B 3OGOE 4OD3L 3DSFH 3S36X 2YD6A 5EBMA 2YIHA 4GBXA 3P9WB 5EC2B 3WNMA 3BD5A 1MI5B 3N85L 5F9WC 4UFJA 4MHHG 3A6CH 1CWYA 1HJVA 1BWWA 3U30C 5I66B 1YDPB 1SJEA 3BUIA 4G8IB 3EYUH 5FYLH 2ZZUT 4M62H 1HZHH 5IEHB 3NZHL 3C6SA 4M7ZB 4JR9H 4EI6B 2C1PB 4GINA 5E7BA 1YPZE 2GT9A 1AO7B 4JFFA 2GKIA 4GAJL 4P46B 3CUPB 4TVCA 2FHBA 2V3EA 2EE3A 4PJBE 1M7DA 2J25A 1VRXA 2FJHB 1MRCL 1KTDA 4AXNA 3WFBH 1BAFL 5LGJB 4LAQL 3KXFE 4HUUB 4LHUA 1EAJA 1AFVH 4HIEB 1EHLH 1G9MH 3U46A 4PJHF 4YDLB 1TFVA 4UINH 1R3JA 1X44A 1BLIA 3U7VA 2JEPA 3RWFB 2F15A 3B83A 4C56B 3S37H 1T2JA 3FQRB 1UENA 1AQMA 1LHZA 4M1CC 1B9ZA 1I7TB 3VXPA 1A47A 5DT1L 4QRPE 4JQIL 4GRWB 3H3KA 3OBAA 1CS6A 4LLWA 1C1EH 1HNYA 3RTQD 1ZGLA 4XBPA 4JANB 5DLMH 2YEZA 2ESVE 3DROA 5BUGA 5J1AB 3ET9F 4PJ5B 5TE6L 3PZIA 4WWID 2SEBA 5IB1B 5JW4N 1BVNP 3EOAB 4XPGH 5FF6A 3LPWA 4WHDA 2RGLA 1JPGB 4EIZC 1QUNA 2D7PA 1WBXB 3C5ZA 5FO9A 4Q58C 3TBTB 1JHTB 5DSCA 2ADFL 2WW8A 3GSNA 2O5YH 3IDMA 5T1KA 1YHTA 4QRTA 1E4MM 5EOCJ 2Z1SA 1B3ZA 1IQDB 2QKIB 2XG5A 3ZHDA 9CGTA 3BXNA 1QSFA 5E1AB 3ROOA 3SDYH 4K9EH 3LN5B 1FGNL 4IM8A 4X6FB 3T0XA 2BMKA 2ZIDA 2JCCF 2Z35A 5TH2A 4KRNA 3L9RB 1AD0A 4NKIH 3P4MA 1HT6A 5IJVB 2R4RL 2YRZA 5MEOA 2KZ1B 4Q7DA 4OZIF 5D5MB 1GGUA 4FQIH 2WUBL 4M8VA 1J1OH 1T0NA 2WMKA 1N8ZB 1OW0C 2J4WL 4M82A 1NDGA 4MAUH 3CIVA 1S7VB 5E99L 3VU2A 3GIVB 4DM2A 4LRIA 2EDOA 3JBG7 1U3HA 3ARGC 2BNRB 4XCEA 5TDPB 4Z6AT 5CJBA 3MACH 4QXTB 4LSVL 2NY4D 4R7DB 3PF2A 4NSBA 2XT1B 3MU7A 3G6MA 5EOTB 5IWLC 3SDDB 1PGRB 4G7YL 3VG0L 3MBXH 3P11L 3EJRA 1BG4A 3U4EA 3SOBL 3F6IA 3FONB 1NC4A 3VD4A 5DZNA 3MXVL 2GUOA 2BSSA 2ICEA 4APQC 4Z2LA 1RUML 4M6OL 3BPOB 3NDZA 1QNPA 1L7TH 4U7SA 3WH5A 3O9WA 3MOQA 3WE6B 3OWEA 4MD5B 4P5TD 3C60C 1B3WA 5EN2A 1BD2D 1V3LA 5F3BB 1JL8A 5SWZB 4PTUB 1PY9A 3UTPD 5BO1H 1JAKA 4FNQA 1OGTB 3VFOA 4L4VB 3B5GA 5H35B 3QUZC 1DBJL 2JALA 3PGFH 4P2QE 3LH2H 4H8WH 2BFVL 3I6GA 4H88H 4ZUVA 3WIIH 1KIRA 5EOCL 4RX4A 5FGSA 1MCEA 1DEDA 3LV3A 4PJEF 2OWCA 4PJXA 3VCLB 1INDL 3N11A 4I0CC 4XP1L 3X3FH 3ALWA 3GJFB 3BH4A 5T33L 3WY1A 3MYZA 1T83A 3PWUB 1DFBL 3P4OA 5T1MA 3WD5H 2BC4B 4PJCE 5TFSH 3SJVA 2FBOJ 2YMXH 3N17A 2X4OB 1T2XA 3LHPH 1HJQA 3O11A 3DI3B 5A8QA 3CZLA 1DLFH 4PTMA 4FTVD 4X6DF 4H7VA 4ACYA 3Q5YA 4WUUE 2ORBL 1C91A 1GUVA 3QEUB 2GDUA 3O6FC 1J12A 3C6LA 1DBBL 5DMGD 4HX1A 5JW3H 4GW5A 5CJOH 4YBHA 3OQ3B 4HCRH 3PL6C 5ADPL 1N2RA 4KVCL 4MNQE 3ULVD 3SCUA 3OF6A 4FQXB 1SEQH 3VXRD 1JK8B 1U36A 3TO4B 2EH7H 2IH1B 3SDCD 1MREH 1TVBB 1FZMB 4PYSA 1M05B 2AEWA 1Z3GH 1QFWL 4QLKA 3SE3C 3WFHB 3I02B 4PJIA 4X80H 4DW2H 3MRGB 5DD0H 3QXAB 4KJPC 5LQBH 3CUIA 1CFNA 1C5BL 3BYTA 4WI3A 1OARH 3C8KB 3VX0A 4XI5C 5HGDA 3TV8A 1INEH 3MRLB 4RFEB 1GVYA 1RIHH 4GRLC 3P2TA 1QHZA 4DKEL 1HXMA 3KHQA 2Y6SC 2D3VA 4P4RB 2XSBA 4JPKH 1XH3A 5IKCB 3DX6A 4R96B 5GGSB 2W61A 4CBPA 3NCOA 4MNGB 4HZ8A 4F7MA 1MNUH 3AMKA 1V6XA 3CZKA 1AGCB 3UZEA 4KPHH 5EWIL 2XKNB 4P8UA 4Y4FD 5J9PB 2XTJC 3EAKA 2FBJH 5T5NF 1XGYH 3ZO0A 3T77A 1X6LA 1JBJA 3KPPB 5KS9A 1VFAA 5EDXA 5IR1B 2BNQD 3JSSA 4RA0C 2FR4A 2VLJB 3LKSB 2R0WL 5E2TH 3N04A 5ETUA 1CG9A 2P44B 3C87A 3KJ4C 1U8JB 4QXUL 1FFOA 3CXHK 1HWGB 2ITCA 2HLAB 3EO9L 3IJYB 3ISWA 3MLTA 4Y8AA 2Q8AL 1KCVH 5SWSE 4EEEA 1FG9C 5KSAD 5JW4M 1G5AA 4JO2H 4N8CL 5T3ZL 3LMYA 2D31A 3CH1A 1IZKA 3CVIL 4I9WE 1WITA 5I16B 2A6JB 3QCUH 4JM2A 3EYPA 1W91A 1Q9LB 4UUJB 5IBUB 3LKRA 5GS0H 5D2NB 2XWTA 2VXVL 4AYFA 4BJLA 1NAMB 5ID1B 4MB4A 1DQDL 3DUSA 4JFDE 1KPRB 1G7PA 4PMXA 1KFAH 1IC4L 4XAWH 1V6UA 1BTCA 3D3AA 1AGDB 2DQCL 3VRIA 1AI1L 3QQ3B 2FX7H 4ELMB 1LO3L 1QYGL 1UKQA 5D1QC 4EKXA 3UDWC 1JGUH 3QNXB 1O7VA 5HGHA 3ZDZF 4OBRA 1NKOA 2QPSA 3BAWA 2J7DA 4JRYA 5IB2B 5A6BD 4F8XA 1QBML 3EO1B 3FAXA 3MODL 3WS3B 1AR1C 3WNLA 4JJ5B 2EDJA 5BJTA 3A22A 1OD0A 5F7WC 6TAAA 2NT1A 3V4PH 4MA8L 1MWAH 3TNNA 4CVXA 4YHPB 1MWAB 1RD6A 1A6AA 2CHOA 2VQ1B 4J3VA 4OZGB 1YY9C 4X6CB 5D1XC 1KC5H 2DQFB 2F1BA 5ERWA 4IBLT 4R97B 5C0AE 1FORL 2RCSH 4HXAL 4OI9A 1WDPA 2G60L 1CEOA 2EZ0C 3DMMC 2C1OB 1U8HB 4C54A 5BV7H 4YX2H 2VABA 3DVFA 3RA7H 2HYMA 1U8KB 3KPSD 1W1PA 1J05B 4O4YH 1QA9A 1G9NL 3FRPA 2V2XB 4QWWD 1CGUA 1AGBB 4R5EA 2HA1A 3DRQA 5GIRA 3MLSH 1E15A 1WZLA 1UM4L 2OWXA 4NC1C 4HUXA 4FQLL 2V7NB 5DJAA 2QQKH 4X98A 2GJ6A 3ES6A 3KPRD 4PGZA 2BJMH 4U1NB 4FNSA 2D20A 4LVOC 3ZYOA 4YFLF 4MJ6B 4ZS7H 1VFUA 2QSCL 3O0RL 2W92A 5HYJD 2AJ3A 4LEXH 2R2BB 3LZFL 1ZL1A 3REWB 1U41A 5D7IB 4R4ND 1I1WA 2AV7B 1XIWB 3IXTA 1LE9A 2PTTA 1F3JA 4Z8FH 3WD1A 4Y2DD 4UV7L 1MH5A 3NCBB 6FABL 2VC9A 2OR8A 4KHXH 5DHVH 4ACPA 1CGSL 1KXVC 4GOSA 5DYOA 3AZSA 1OSZA 4PJAA 4O02L 5FECA 4U1MA 3FTGB 5KSVA 1MY7A 3FOMB 3GHEH 4ELMF 4LCUA 1D5IH 3ROLB 3ZSTA 5D70L 3WQ4A 1IE5A 2DJ4A 2B39A 3OKMB 3GSUB 1OP3H 2GCYB 4YQXH 2XN9E 5HHNA 2VZSA 4GFTB 2VCAA 4CKVX 1FIGL 3VFSB 4ZFZA 2APTA 3ARED 2R1XB 1B4JH 1UWGH 4NO5B 1CBGA 1LO2L 2FIRT 2FO4B 2E7LC 1U8MB 3VGDA 3TJEH 4XBEL 3ZSSA 2XY1A 3SUWA 4FP8H 2EC8A 4TSAL 2WC4A 3P0YH 3M8OH 3J7HA 3PIQA 1WBZA 5BXSA 1W72H 4UDUB 4N0CC 3UR7A 1VF8A 2JK5B 3EFDH 2ZNXA 2PWDA 3SCOA 2H6PA 1I7RA 1A4KA 3WY3A 1OW0A 4P2OB 4KTEH 4TUJB 2J8FA 2QQQA 5JQHC 4KQ3H 3WQ8A 1UOKA 2YA1A 3ARGA 1UB6B 5I1GH 3WN6A 2VR9A 2YFNA 4X0KB 2WMIB 4WWKD 1ZT7B 3WXVL 3QEGH 3P40A 2RHEA 4JDVA 4JL2A 1R3LB 4Z7WF 4WUKH 3KPOB 4D0DA 3DO3A 4Y19A 3MTRA 3HUJF 1QRNB 1KG0B 1OCQA 3QEQB 2P5WB 5IWLA 1MXGA 3UYPA 5JIHA 2CKBL 1KTLA 5CJXC 2NY5L 1NCDH 3DURA 2D24A 1U30A 4KQ4L 5D7IF 3GSRA 4MNLA 4J1UA 4K7PY 4APQA 4JGMA 5LWYL 5DURD 2DLIA 1JUFA 8FABB 1UASA 4WU7B 4TUOA 4U49A 4XPAL 1JZ7A 4C83B 1JVKA 3FFDB 3C60A 3FQUB 5DJ6B 1DVFC 1FNGB 2BP3A 3EGSA 2ERJC 2R2HB 4S1DC 3UC0L 1CLYH 3RPMA 1R3IL 1KCRH 2B1AL 2ID5A 1HWWA 1GJIA 2NSXA 5JDSB 3NGBC 4BUGA 2E27L 4OSUL 1UACH 1XCXA 2J8HA 1CF8L 3QUZA 2ZG1A 3W0WD 2ARJQ 1OAQH 3QA3A 2X4SB 4Y1AE 1XH0A 4YAQB 2DYPA 2HAZA 4UIMB 4XVJL 1F2QA 1TG7A 4IJ3B 3MXWH 2V3GA 4YDKL 5BVJA 2FJFB 3L3GA 3IDXL 4LF3B 3WUEA 2UZIL 3T4AA 5J13C 2HFGH 2DGAA 3O4LD 3QOKA 2QQLH 3NFPA 1T7VA 2DBLL 3KLAB 5KSUA 3UG5A 2G9HB 5E8PB 3A24A 4D71A 3MV8E 3CMOH 4UIKL 3N50A 3THML 3AWEA 3V7MA 4HT1H 3AUVA 3VXQB 3GO1L 4KTDL 4JVWA 2X7LB 5F6HJ 3VI4E 3O6FA 4M8QA 1Q0XH 5C09D 1LL4A 3QXTA 2CIIA 4GT7A 5HI3C 1FRGH 1NCBL 3PL6A 2X4RB 1I1AB 3VFPB 3BZ4A 4OGXL 3U6RB 3GUTB 1W8NA 1H8OA 1YNLH 4TNWF 2R29L 2WK2A 3KNBB 3BLKA 1RH9A 4DWSB 3U57A 1HCVA 3MOAH 2YA2A 4GW1A 4I2XA 4IMLA 4MCYB 3WUZA 4ORGA 2MCPH 2BSRA 4NRXA 4OB5L 1UWSA 2YD8A 2CITA 2Y5TB 4U1SA 3SE3A 1B2WL 2ED9A 1A7PH 2BVPA 4CN4A 3WF0A 1T0OA 4KY1H 5F1NA 3VXSE 3A23A 5DMYA 3VIFA 1A14H 4LQ1A 1RULH 4GRLA 2B0SH 2RQ8A 3FY1A 5CSUA 5H2BB 1YA5A 2X44D 1NGXB 5J6HB 4AMCA 2J7CA 4FFYL 5EZIL 3UBXA 1VESA 2I5YL 4PN2A 4CD8A 3QXDB 3ULSB 3B9VA 3LRMA 3R1GH 2B20A 1E0OB 2IG2L 3K4AA 3D0VA 3MLXH 2LAAA 1JRHI 2GUYA 4P49A 1CFQB 1ZE3C 1MFNA 2XUCA 1G6RH 2PTUA 3BFOA 3QDMD 3CFJA 3D3VE 1G6RB 2EDEA 4GUPB 3U7BA 1SHMA 4TVPH 4AIEA 5IMLB 1ZLSL 2J6EA 1VGEL 1WWCA 2DQGH 4MS8D 4MQSB 3L1OH 2ADIB 1CD1A 3DUUA 1A2YB 4D2NA 5GGTA 1J9CT 1UXSB 5FYJH 4MQ7A 5MERB 5I17A 1AQHA 1Q6EA 1FPTH 1L0XA 5D7JC 5FCZA 4NF7A 5L2KA 4PRIB 4F33A 3ZTNL 2FX9L 1KJMB 3V4UL 5CEZH 2FH6A 5CWSB 5IFAH 4R0LC 3HNVL 2BVEA 2L7UA 3T65B 3NSNA 5JUEL 3EYSL 5IMMB 4OIAA 1UWXH 3L2MA 1MQPA 2QADC 1E4WL 1S7WB 2DLEA 2Y07L 2CK2A 1Q9KA 1EO8H 2O5XH 1E72M 15C8L 4UBDC 4D3CH 3ULUH 4O2FA 5GRJH 3VMPA 2VDPL 4OZHB 4W4NA 3TA3B 5D1QA 4OCXL 1PVHA 3DXAD 3ILQD 3SGDI 3UDWA 3VWKB 1O7AA 4ZPTB 3P73A 1A7QH 4POUB 1MUJB 1J8HD 1PZ5A 3W29A 3NCFB 43CAA 1DN0A 3G6DL 3CZFA 4LSSH 3UTQB 2X6MA 3RCNA 4G6MH 5C0GA 3UP1A 1G84A 2BXZA 4V2BA 3QIUC 1OAKH 5TDNA 2Q87A 3HAEB 1GGIH 4Z95H 1VEMA 1IGCL 1IT9L 4F8TA 3LD8B 5IQ9B 3ALPA 4F7TA 5H8DA 4B7IA 7TAAA 4IPLA 2DSUA 4WSJA 5D1XA 2DIBA 1JPSH 4JN1L 4HC1H 3RKPA 3SY0B 1RFDL 3H3BC 1F5WA 5IHLB 1FYTA 1RURL 3DMMA 4ONGH 4MDOA 3IS1X 3QJFA 3MBEB 1CYGA 5KVDL 4NCDA 3FCTB 3VILA 4NM8H 3M07A 4OUEA 5DS8A 5IHUH 4X7FC 4I4WB 4UZSA 4O51B 3SE4C 1FSKC 3ZYIA 3FFCD 1PD6A 1OGAE 1KN4L 3BC9A 3VGBA 2A6DA 1HHHA 3LEVH 4MA3B 3IKCA 3FB5B 3KL0A 1FGVL 1IBGH 2DM4A 3SDXA 3RIKA 5IHSA 1ZANH 5IB5A 1LE5A 1NGPH 3HG1B 1X5YA 1HHKB 2A3EA 1A7RL 2EIBA 5KTEH 5KN5A 3C5JA 4OBSA 4XMKH 5ILTH 3HMXL 5AAMA 3T3ME 3VG9C 2NY6B 2YPLE 2Z8VC 1RIUL 4X9IA 3W82A 1CU4L 5C07D 1KIPA 1X5AA 3CSYA 3O8XD 3AHYA 4S3KA 4WDIB 2R69H 2X2YA 2DQIH 3GIZH 1KXVA 1CFVL 3SKMA 4UNTA 4PJHE 3VRJA 1UFUA 4Q9BA 3B2UC 1WEJL 1C12B 4S0SD 1BOGB 1MCRA 4KJWD 1AH1A 1V0LA 1DANT 3V0WH 1YUHB 1S7QB 4PV8B 4JDTH 5LGKA 2H1PH 4HIXH 2XICA 2GFBA 3TP4A 3ULUF 1N26A 4ACZB 4DN3H 1HQ4A 1BYBA 1Q1JH 3GNMH 2PBGA 3KXFA 3MYJB 5IM7B 3V4VH 1TMQA 2QLYA 2GK1B 4P2RE 4YZFE 3QDGD 5C8JB 1DQJA 2AP2A 1LJYA 1W32A 4U4BA 1D2KA 1XGUB 4HOWA 5IVXB 3TZVD 5ABDE 2DQEL 1VJSA 2E7LA 5C6TH 3VMOA 1MIMH 5E0QA 3DGGB 4GMTL 1Z0NA 5F8QC 4IIQB 2Q6WA 2IFFL 3PGCB 5IB4B 4KK6D 3SE8L 2ESVA 1GGYA 1KPVA 4LSPH 4RISH 2EDKA 3U36B 5ID0B 4QHLB 1P7KA 1A6PA 3MUGA 1JWSA 1VIWA 3BGAA 1SFSA 1OPGH 4HGMA 4I5BB 2HT4D 2JCCE 4HLJA 1HI6A 4HS6A 1K8IB 3RAJH 4U31A 4HP5A 2CERA 4L29A 3GBDA 4NN5C 1QFUL 2YKLH 2ZXQA 1X3DA 1TQSA 3NACH 3GGWB 5DQJA 1I8LC 3O3AB 3QUXC 1U33A 3N0AA 2XKSA 3HPJA 4OZIE 4R3SA 4QCIB 2WP3T 3GXDA 2BS9A 4UQCA 3TIDB 5FYLE 3CZNA 1NFDA 1JNEA 5FIEA 5CQ1A 4N0FB 3TN0B 1KBGL 3LN4A 1IGFL 3I50H 5F6IB 4HKXA 2XGBA 1AO7E 1UCBL 5CJXA 1JFQH 4PJDB 1XGZA 5KVGH 3RUGA 5DUMH 1LK3H 1JNDA 4YHKL 4UQ3B 4PRBB 1MVUA 2GAZB 4FQ2L 3TIEB 2IF7A 4HGWA 2UY2A 3DRTA 3PHOA 3RJXA 1IL1B 3SGEI 1DVFA 4FK9A 5I78A 4XPFH 3CFEA 3TVMB 3VXUB 4QCFA 1G7LA 3HG2A 2Z93A 1HYSC 1E0XA 4OOZA 5A8MA 1GZQA 3V6ZB 3O2DA 1G0XA 4ODXB 1JYNA 1OD9A 4Q9RL 5INCA 3TWCH 2VJXA 1VBRA 1HSAB 3DC0A 2XRAH 3RIFK 3AIUA 1I7UB 5BRZD 1MQQA 1ZJAA 3EIFA 1IGMH 2V2WA 5I75B 3L3KA 3WO3B 4IRJC 4PR5B 1W0YT 1LEGA 3TYGH 3D52A 1QEWA 4HA1A 1T04A 2X1WL 3AAZA 4RCAA 1GC1H 3O3DB 3G08B 3ARYA 4TTUA 3NIGE 3B9KC 4I3RL 1TDQA 1A0QH 4M43H 4TNVK 1NP0A 5I9QC 4PMQA 4PJEE 2YR3A 5EUKA 1RUPH 3QUKA 4DVBA 2L7JA 1P7QB 1IGJB 1T5XB 4J3OC 1EXPA 5DMJB 4C7FA 3V0HA 3ZJ8A 3JTSB 5TD4A 5I2UA 5HGAA 1EZVX 5GZND 3SE9L 1J1XL 2EDWA 5BZWA 4LBEB 3QWRA 4F7CB 5DD3H 3CPLB 1A9EB 3K3QA 3LOWA 5AYUH 3VX1A 1LEKB 3WQVA 4X6DE 1E6PA 3KYOA 4HWNA 4UMGA 2GYSA 4LASL 4NXKA 4NKDA 3QULB 1U2CA 2EDXA 2DAVA 4ZXBD 2BY1A 4PJCA 4JZJC 1GOIA 4YXHH 1FBIH 1J0JA 3F5WB 1X4XA 2FGWH 1FNFA 1HQRB 3QPQC 2G4FA 4UT6H 2AMGA 2D23A 4TPRL 1WFUA 3EO0B 3BGFB 4J3SA 3TO2B 4WUUA 3PXJA 1RZ8B 1RHHA 4XC3L 1T21A 3O45A 2F8OA 1M01A 3U0PB 3RNKA 4UNIA 2E9JA 1P84K 3IFOA 4YIQA 4DGIH 1FA2A 2B2XH 1MIEL 4OCSH 5T1DH 3CMGA 3TBYB 1FL6B 4PJ8B 4ELKA 3RVXD 3CUJA 4FOMA 4HDIB 4DGYL 3DDGA 3U2SB 5E70A 4LCWB 5DJ8A 1A1MA 5ENWA 2DWDA 2NPLX 1UD4A 1GHRA 1ORSA 1DQML 1KELH 3CVHA 5DD6B 4F15C 1U8QA 4PGDB 4GQQA 2P46B 3DETC 1A6ZA 1RUAH 4P5KB 3ZM8A 2J78A 1CFTA 3KPNA 2ZKHH 2WCSA 3BLPX 1KTRL 5SWZE 3U5UA 3L3OB 1FFNA 1KPUB 4A6YL 1YMMB 2W9DL 3HI5H 4L4TB 1AC6A 1IAMA 1TITA 5F97E 1E56A 2V5DA 5D7JA 1B0WA 1FQ9C 3B9EA 3D0LB 4BZ2H 4LSTL 5GNZA 5AYBA 3SCWA 3P77A 4R0LA 3SKOA 1KTCA 1PSKL 4M9OA 1P4LA 2B4CL 4UB0H 1D6EB 3HE7D 4Y5XC 2XPKA 1E6OH 1HSBB 4IRZH 1CT8B 3WQ6A 3I75A 2GK0B 4P59L 3A67H 3FO0L 3QFJD 1BPLB 2NY0D 4F3FA 1DQLL 2VB5A 3BCFA 4NQEE 2X1OA 3JWDL 4HEME 5A3IC 1T20B 1JZ3A 3W0KA 2XVPA 3Q5TA 2MQ0A 1H3UA 1IQWL 1D9KD 5ACZB 5AUMA 3ARBC 3H9SD 4M1GH 5SWSA 3T2QA 3U0TA 1YYLL 1E27A 3W11D 3SDAB 2AEQH 1BJ1H 3NPSC 4S2SA 5IBUG 3RL2A 2IAMD 4XNMB 5DJZB 2XVNA 4RGOL 3CX5J 4HKJB 2I9LA 2X70B 3C08H 1HJSA 3TPUA 3F5KA 3GSQB 1H5BB 3T0VA 4E2OA 1BQLH 5KOVC 5ICZB 3O3EA 4RQQA 2G8ZA 2VDML 2APFA 4JKPH 3JUZA 3ZDZE 1UH3A 3PHSA 1R3KA 4BSWA 4U6XA 2AV1A 3EJYC 2F5AH 2Z92B 3LDBC 4AY0A 3VVGA 5DJCB 1NCTA 1QI5A 2ZG3A 4JFDA 4WY7L 5AD0B 3MUAA 1PKQE 5DQ9B 5ADOL 4JHAL 3CSBA 3BKCL 1KNOA 1LMKA 1ISZA 2AABL 1K9EA 3SE4A 1MEXL 2WMHA 3OGSA 4MB5A 1ZA3B 2YD4A 3EOTH 4MDJB 3MJ7A 3S34H 5GRZA 1HTYA 2WYSA 5JOFA 4IMKC 2X2IA 3V5KB 5DMIH 3VINA 1KGWA 2FEDD 4XVSL 5FHAH 3HE6D 5HJ3A 5KZ6A 3PZMA 4I18C 1WNOA 2A0LC 1M71A 1T4KA 4HJGA 4ZUTB 3GMOB 3MZTA 3T0ED 4CAGA 1YNKH 4XHJC 4P3CL 3GB7A 4EOWH 1UWEL 4M48L 4Y16A 4I3SL 1ZTXL 3UJJL 5MHSE 5SX5H 4WNQA 1GVIA 1J88A 3HZYB 5EOQH 3WHXB 5C0AA 2HTKD 2YOCA 3FZUC 5C0BA 3GTNA 4HPGA 5BZZA 4FFZL 1N64H 1YEKH 4KHTL 3A5VA 1FHGA 4MVBD 5CJQH 3H54A 1XYZA 4P4KC 3R0NA 5DJYA 5T3ZD 2DRUA 1VFBA 3IF1A 4XWOD 1GOOA 4JZOB 1NGZA 4OFYD 5C0CB 2NR6D 3JV4B 2IBGA 4GAYB 2DWEB 4C7DA 4LVEA 1UYWL 4NZUL 5K9QI 2P45B 3FL7A 3FOLB 2ZCKH 2YPKA 5D2NE 4JKMA 1IEAB 1H3PL 2ZSVA 3WKML 3BPLB 1KEMH 1MJ7H 3GMPB 4ZSOB 4JFXA 1BVKB 5KVFL 3IFPB 3RX8A 3BUYA 1OAUL 3PTQA 2OQJB 2HG5A 1QACA 1RP9A 2V9RA 1KUMA 4XXDB 3RIAF 4AIUA 4ELME 3NJ3A 3F4VA 1OGSA 2VITA 3GZKA 4GKNB 2NY4B 1MY5A 5FHBL 4JCMA 1C5CH 2HMIC 1TIUA 1X4YA 2AJVH 5GHWH 3TT1L 3VD3A 3LEYH 4ZQKA 1EHXA 5HHQA 2H2SD 5C0EB 2ICWI 4HLZH 5D1ZC 5HD8D 5CFHA 1OL0A 1PAMA 1Z32X 3BZDA 1NOFA 4GQ9H 5KJRL 2ICWB 1S78D 5IW6B 2F1AA 2X4NA 2PCPA 2GW5A 5I1KL 1RZJL 1N3NB 3G5XB 2Z8SA 1ULVA 4HIIA 4OD2A 4PMDA 1ZLUH 4QYOA 1CECA 4PMRA 1FNAA 3IDIA 2V3DA 5EUOF 4DO4A 4OZGE 2N4IA 1XF4B 4YDJB 3ZKNC 4HULB 5C0JA 1I3GL 2ZCHL 5BRQA 1ZVYA 5CEYB 1EBAA 1H9VA 1I8LA 2H32B 3QUXA 5DR5L 2XN9A 4P9HC 2YUZA 2PYED 1JP5A 4M7KL 3U48A 1JI1A 2E9LA 1JTPA 3Q3GB 4G43A 3PV6A 5D71L 5ITBL 4ETQB 2CGRL 3MRHB 4WKHA 3V0EA 1U2HA 4UTBL 3MRKA 3LS5H 4PLKC 1PYWB 3Q48A 1BX2B 3BE1L 3AMDA 4D9QE 4U7KA 4HWEH 2AVGA 1DBMH 4RA3A 3D9AL 4E9LA 1X1NA 2J6EL 7CGTA 1I9JH 4UZGA 5E8DL 3CFCH 1INQB 1NSNH 1B3YA 5I74B 2J4GA 1QWUA 3LPGA 5GGUA 5GGTL 1MELA 3HUJE 4WV1B 3VOCA 2X4QA 3K4DA 4P23D 3GBNL 1WJ3A 1TR1A 1U8LB 1RK0A 4JO1H 1RZIB 2M2DA 3E6HB 4MDIB 4BSVA 4YHLL 4FFWC 1IAII 2X0YA 1IAIH 2MHAA 2NXYB 2HWZL 5FFLA 1MFBL 3QNZA 5D7IE 1IAIM 2F54E 4X6BB 5IROC 3HR5A 3B3IA 5DZOA 1P6WA 5C0ND 3ZJ6A 2ZUVA 2HJFB 5EA0H 4Z7QF 1DBKL 4RMTA 3ULVH 3U9UA 5FK9A 4PS4H 5CPTA 4PJFF 4XHQA 1N6QH 3H3PH 3MA7B 1B90A 4NQCE 3VXTB 3VXRB 1H3VA 4TTGA 1FCCA 4IRJA 3WDHA 2HJKB 4K7PH 1KLFA 1S7UB 3D39A 2WIIA 3N9GL 2X1XR 3H9HB 3VWJC 2PWFA 4B15A 3VE0B 4RAVB 3TC9A 3B9KA 4JO3L 3JV0A 1G0YR 3HC3L 1HP5A 5JMOC 3QHMA 5ESQB 4Y4HD 2FGLA 4YK4C 5D7LB 1BZQK 4DZ8B 1V6VA 1ZK9A 2X4TB 3LKQB 4HG4K 2HN7B 3SCMC 3VFVA 1G9MC 5DDHA 3QG7H 4QRRE 5TPWL 1LTXA 4LIQH 4PGCA 1FNSH 2OL3A 1MW2A 4LLUA 2OZ4A 2F7QA 1MRFL 1QRKA 4RMUA 3PNWB 3L3JB 4Y1AA 5F89A 5F9JA 3NZ8B 1A7OH 5HVHC 4U1HA 2JIXB 3RY5A 1MQ8A 5I8OL 2HVJA 5DWUL 3M46A 3VKKA 3TJHD 1NMCB 2VXSL 1AQDB 5IVZB 3AHVA 1KSRA 3NAAH 1JHLL 3RBGA 1E3ZA 5L8LB 2FWOB 4JZJA 1VGKB 3FHQA 3IVKB 1TA3B 3MV8A 1LD9A 3UJIL 1CFSB 1WGOA 4W6YB 2ADJB 2E8YA 5KSAB 3HZVA 3KE0A 2G5BA 3T4YB 2OP4L 4ZENA 1U3JA 3V0IA 1VADB 3IB4A 4NPYB 4HPYL 3Q6FB 5B38B 5D96B 4JDZB 5D7KD 2IBZY 1GAFH 1QRNE 5A6MA 3Q6GH 5TE7H 2PNDA 1CD0A 2P5WE 3QI9B 2OK0L 1BWMA 3GSXB 2XNAA 4PBWD 3LB6D 1A6VL 2NY3C 3CHCA 5CBAA 2C26A 3ZR6A 1FLRH 1MAMH 2EO9A 4PUBH 4KZEL 4PCSA 3SQOH 2AJXH 1R0AL 3N06B 1AJ7L 2AGJL 2ZX5A 1I3RA 3AHXA 4PRNA 1NAML 2GI7A 2EXYC 1CL7L 5A2CA 4U1GC 5FOJA 1JE6A 2M26A 3P3YA 3ZE1F 5L9DH 3IANA 4HXBL 1KN2H 4D8PA 3ULVF 4U6HA 4UQDA 4TULH 5F9OH 1H5VA 3DJ9A 5F1KC 2VDKL 3W2DL 2R23A 5I79A 4O2CA 3ZT5A 5EU6E 4OKVA 4DAGL 1T1YA 4ZOEA 2K7PA 1SYTA 4K7PX 1QO3B 4LKXA 4S1QH 5DRNB 2JJWA 1H0GA 2J73A 1EVTC 3SPVA 3HMWL 2CNCA 5GZOD 3MO1B 2O61A 4Y5XA 1JPFA 4JFPB 3HG4A 3SDDC 3S3SA 5GGVL 1ZT1B 5KAQG 4I8DA 4JN2A 1AQ0A 3QUYD 4LL9A 1K2DA 1TZIA 3DLQR 4ZUUB 4Q9QH 3BSHA 4TOYH 2EO7A 35C8L 5HDBF 2J7FA 1ES0B 2CH8A 2Y36L 2GTZB 2EABA 4NJ9L 1T2QL 4DUWA 3HG3A 3ARBA 4JGUA 2MSPA 5MI0B 3AIEA 5E56A 1ACYL 3V6FA 3B9DA 2OYLA 2C3XA 5FYKD 2DL2A 1U95B 4KKCC 5DXWA 3VA2C 3AJ7A 2X05A 1QW8A 2F5BL 5LBSL 3V52H 5JW4R 2DQXA 4Z5RA 3POCA 4W5ZA 3N1PC 4LLQA 3KWWA 5I1DB 1WSST 3HC4L 3MGOA 1OSPH 5EPMB 5F1IA 1WZKA 2EH8L 4OF6A 4YEEA 2FD6L 3WSUA 4H8WC 5FA3A 2GSGA 2D0FA 1NP2A 3WF1A 3G6AA 3OKEB 4TSBL 2AXFB 1JHKL 3HU7A 3EJZC 2GQHA 3OZOA 4ZUWA 1G7HA 5E00B 3CHDA 1SMDA 3L4WA 5I1LB 2RBLA 2ZOKB 1FN4A 3QEHB 5LG1A 4HUVB 2FSEA 1JGDA 2R0KL 5JOEA 1QSED 4NZTL 1U8PA 4L3EE 1IM3B 3OKDB 3C8DA 2VN4A 4Y2DB 1NGWA 4AYGA 3UPRA 4RIRA 4IMKA 3RHWF 2D22A 1WIUA 5E1QA 3EYFA 1SY6A 4LNRB 4I18A 4GLRI 1KGUA 1FNEB 2PO6D 2NW3B 4D9RD 5I73B 1H3GA 3WDJA 4M7JL 3EDEA 2HFTA 5HBFA 5EZOH 2KDGA 1S9YA 4ODHH 1DHKA 4X9YA 1DP0A 3IRZA 5K93A 5FIPA 1S7XA 2FJGA 2EIZA 4FMVA 2JELL 3VH8B 3DX8B 5J11C 5IMOB 5BS0D 1SEBB 1F45A 4L5FH 2D0GA 3MLZH 3N0PB 4TVPE 2C4FU 4R4BA 4XWGL 5ACLA 3IS0X 1ONQA 4PG9A 4HH9A 1VBUA 2O5ZH 3REVA 1QR1B 3AREB 1RJZB 3BQUC 4P4KA 3G6JB 5I1IH 3EFFA 2FHCA 1CE1L 3LS4H 4U33A 5HHOD 5FYJE 4CVUA 5DJ0B 3GNRA 3AXLB 1EFQA 5I6SA 1OGAA 2NXZC 4HHAA 4X5XB 1BVLA 3CU1A 4YXKL 1S7SA 5IESL 3O41B 5ESAB 1A4JA 1MFAL 4WHYH 2CDGA 2XWEA 5CEZE 3BCDA 1BZ7A 3ZKXB 2NTFA 3TF7C 2O93L 1N6VA 3GMLB 2HT3D 2CDEA 1CXHA 1EHAA 1Q94B 4S11A 1WFNA 4JPVH 2C7UA 4JY5L 4G3YL 5EU5A 4K23H 4JRXD 5JO5A 3NFNB 2GJPA 3CZGA 4OZHE 2LVEA 3ULUE 5LAXB 2YPLA 1P1ZA 3HZMA 3BEVA 3JVGC 2VRKA 1E6ZA 1KJVB 1MXDA 5LVEA 1RU9L 5D1ZA 5K9KA 3QSKB 2V5CA 4PMVA 3EYVA 4PJHA 4ZAKC 5TQ2L 2ENYA 1JAEA 3CDYA 1BQSA 5I2IA 4QCEA 5T3XL 4YHMH 2DQHH 3GFUA 1WIOA 3QQ4A 5DURB 3QXUA 1DWIM 4ONFL 3WIJA 1XF3A 4JZNA 3WF3A 2PETA 3QJHA 1PKOA 3PWVB 3RZCC 3O2WL 4LOUC 5GS0C 2ZCLL 1A6UL 5L6YL 5LA0A 1ADQA 4LP5A 4M1RA 2W9EL 3QHOA 4P2RA 4OOUA 3M17B 1QBLH 4Y88A 4FLRA 2Q3ZA 5IB3B 5J6GB 4NBZB 4PJ9C 3F7VB 4UQAA 5MEQA 1TQVA 1F4XL 4JG0L 5INDA 3OPZH 2W0FB 5IFJB 4OJYA 1ZHNA 1D5MB 1NMAH 1X4ZA 4UCFA 2VLKD 1W0VA 3TBSA 3IKKA 3O9WD 5K59E 3KGRA 3QDJA 3RI5K 1F6AB 2FHFA 3RKDC 4X7SL 2AJSH 3HG1E 4M02A 1SYSB 1IEBB 1ETZB 3FN0H 4XH2A 3O4LB 2JCCA 3PWNA 3UG3A 3RL1A 1K4DA 1KB5H 3CHEA 2OLHA 4U6VL 5MEND 3JZ7A 2RGMA 3ILPA 2R1YA 5IROA 4R97C 4G8IA 1F42A 4RX4D 4ONHB 4OZIA 5C09B 1WZ1L 3QHZL 3OXRB 4S1RL 4WFHE 4WF7A 5CZVL 4Z7UB 2GK2A 2HKHH 4V1DE 4Y0GA 3LN9A 3UTTE 4XP9L 5BV7C 2VLRB 3WFCL 4KK9D 3VSVA 1FZKB 4PPTA 1FZJB 1AO7A 1QNRA 1A1NB 1YEEL 2PW1B 3H8NA 3VDAA 4Z7VF 1NGQL 4GXUM 3WQWA 3MLVH 3VWJA 3KPQA 3U4BH 4XCCL 3T1FB 4A2LA 1X5LA 4GJTB 3DBXB 5DD5H 4UTAL 3UYRL 2FDMA 4HUUA 2BK8A 1WZAA 4OCRL 1R33A 4MQTB 5EBLA 1TVHA 1SBSH 2XA8L 2ZXBA 43C9A 5GISL 3DGCR 3SCMA 5DHYA 4G9FD 3GXFA 1HKKA 3RWFA 2BOCA 5B3JE 3OF6D 3FQRA 1JGVL 1EOMA 3GBMH 3QIBB 1N4XL 4MXQC 2WHLA 2DM3A 4J4PD 4XP4H 5GJSL 1UWRA 2H8PA 2PYFB 1OWWA 2J8OA 4WW2F 1HIZA 3OLGA 2XOTA 1OLLA 4PYGA 2WVTA 2VH5L 5B4MD 3QDMB 5HYFA 3MJ9L 3AROA 5ALBH 4FABL 1KEGH 3MLRH 3VFMA 1HIMH 5HHVH 2GTWB 3TBTA 2A3AA 1LO4H 3MCG1 4OLUL 2DLHA 4G6FD 2EADA 3OAZK 2VDQL 4PJEA 4DUVA 2EEAA 4FG6C 5KS9F 2R2CA 4AD1A 4OIBA 2UZYB 4MAZA 1IQDA 2X4UB 5E94A 5EBWB 1QFOA 4GKSB 4RMQA 3KLHD 3L9RA 1PS3A 5HHMB 3I9GL 1EMTL 4X6DA 5ICYB 4QXWA 4BS0A 4Z0XB 4K2UH 1JPTH 2W65A 1ISYA 4JFYA 2HH0L 1YMHA 4F57H 5KVEL 1NLDL 5CSZA 4ZO6A 3MRMB 5CP3A 3BAKA 1N8ZA 1HKIA 1LEIA 1HX0A 1GGCH 5GRWA 3GIVA 3U1SH 5DTFA 4NQXA 1GOHA 3BP6B 3A4XA 4MD4A 5FV2A 3OLEA 1J8HB 3RDTD 1JTTA 3DHUA 1KLUB 1L6XA 1XSIA 1Y18B 2E0PA 4LFHD 3TNMB 3KYAA 3D18B 3SKJL 2GSIB 3MV9D 2Q7YB 3SDDA 1HH9B 2Z1KA 2XJ7A 1QSZA 4D0CB 4IRSC 4OLYH 3MRJB 5GRVL 1B0IA 2X1PA 4J23A 3E6FA 1AKJA 2J47A 1FO0B 3AZRA 2YHGA 2I07B 1CQKA 3PGDB 4MQXC 3VJ6A 4M6NH 4XBGB 3Q5OA 1TLKA 1L7IL 4PRDB 3WE6A 1N0XH 1YEFH 3N1QC 1B3JA 3QYCA 4XMPH 5IFHH 2ZPKH 1MHEB 3JTTB 1PW3A 3BZEB 5F1SA 1RZ7H 3AU1A 1PG7L 2BRRL 4NP4H 1LO5A 1OIMA 4K8RH 1IAOA 4RFOH 1MQRA 2A83A 1R24B 4OI8A 2DTSA 2D0HA 3FO2B 5BZDB 1JNLH 3IYLW 3TTOA 3WH7A 1F6LL 5DJDB 3FT2B 5E8NA 2XTLA 1E0VA 1ODUA 4PP2B 3D25A 4NO3A 1JFXA 2WWMC 4JHBA 4H26B 5JOPD 3OV6A 3TCLA 5A8OA 3LEXB 3LQZA 3PWUA 3LQAH 4NQEA 1UJ3C 4C55A 2EKJA 2XXCB 4QT5B 4K55A 2WMPA 4YHYB 2DD8L 3QUMA 2QQNL 5C3LD 1HCFX 2DEPA 3NN8A 3ZDYF 4F7EA 1M6OA 1JWUB 5I8CB 1O5DT 4KMLB 3FRUB 3HLAB 3HS0A 1A6TB 3O8XB 3OKKA 4OZ4A 5C07B 1T03L 3EJSA 5HY9A 1XR8B 3MNWA 4EIGB 3HPLB 5CD3B 3S2CA 3FHAA 3W9EA 4X4ME 4YHNB 1XGPB 4HCRA 2A38A 5AWNL 1MLCA 2EC9T 3FB7A 4KKLD 4F80A 3RWGB 3X14B 1EJOH 4JZ5A 1JK8A 1WAAF 4LCWE 3QDAA 5BMFL 2P24B 2RFXB 2IH1A 3WL9B 3KJ6H 4KXZH 4JM4L 4DKDC 1UZ8B 3NFSL 1R5IA 3KYKH 3MRGA 1PKQA 1TZHB 2V3FA 4FQHB 3BQUA 1S5IL 4RFEA 4UQ2A 4JKLA 2DQUL 2QHLA 3S3JA 1OCWL 4W86A 5KOMC 2BCKA 4Y5VB 2EDHA 5EU7E 4K94H 1OM0A 5IMKB 1RZFL 2CBVA 4JLRB 4ZTPL 3VSTA 3TTQA 1A3RH 1FFPA 4FQCH 1G7IB 3K81A 3MSPA 3MRDB 4GMSL 3TBWA 1OWQA 4YHGA 2IADB 1N5AB 3O6LL 4UNVA 3N85H 2DIAA 2VLLB 4KUZL 5IW1B 2AJZB 1MI5D 3QNYB 1L4IA 5H37H 5AEAA 1YEJL 2OL3L 3P9LA 1NUNB 4WI4A 5EFIB 5EC1B 3C5SB 1Q38A 2W60B 5JPNB 4ZS6C 2NLJB 3NZHH 1GH7A 5E5MB 3JVGA 5CP7B 1YN6A 1TZGL 2V5YA 4NSKB 3N13A 4GAJH 4G7VL 5B21A 4ZAKA 1H09A 4O58L 3R06A 2FX8L 4P46D 3LKNB 1P4IL 3I3BA 5I16A 1P4BH 2APXA 1MRCH 1UA3A 5DA4A 4S0TD 2DT2A 4MLSA 4M1DL 2I60L 3ARGD 3PBGA 3PZQA 4NUJA 1Q9LA 4LAQH 2MPAL 4X6EB 3X13A 4M80A 5JLZB 1Q6CA 1H3TA 5BXFA 3PWJB 3RZCA 1YEIL 1IGTB 4Y19D 2VI0A 1DEEA 3MA9L 3VW3L 4C56D 3SUVA 5CMAA 4CVZB 4NXSA 2X89A 4ZFGL 1GZPB 2A6IA 4PJ9A 5DT1H 2P8LB 2D9CA 3QQ3A 4JQIH 1B6UA 4ELMA 5FKPB 1MJUL 5EUOE 4QDMA 3ULUC 4HLZG 5A95A 3AMLA 3E0GA 4APQD 4R2GB 4WO4D 2E9IA 2FZ3B 3TYFA 4NWTL 1T0MB 3NUKA 1XCQA 1PBYA 1UWUA 2XIBA 3EO1A 4PJ5D 3GHBL 1ZBVA 3C60D 3NABL 1AY1H 4N1EA 4ODSL 4KJYB 4MX7B 3ZT7A 2EDTA 3ZOAA 3MLYL 3ZYZA 5M95B 2ADFH 1HHGB 3QUZD 3MV01 4OZGA 4I0KA 1QI2A 3KLSA 1DWFM 4NQSA 1TQUA 2DQFA 4MA1B 2ICCA 1FDLL 2CR6A 3C2SA 1QNZL 4NGHL 1FGNH 3RO8A 4NI3A 1OIFA 3UO1L 3KWXA 2AXJA 3RM9A 1UXWB 3UEZA 1HH6B 1BFVL 4NM4L 4OM0L 4K7FB 3PDOB 3KDMB 4PRAA 4I77L 3ARDC 5I1HH 2R4RH 5A16A 4OKDA 3BKML 4KVNL 1QKZL 4BFGA 2EIEA 2XN1A 5F7HA 4XC1L 1XD1A 2WUBH 2V7NA 4Z7WA 3V95A 1T66D 3DHMA 2J4WH 3NCJL 4Z7QE 4ERSL 5E4EC 3UYOD 4U1NA 4ZSOE 5E99H 3RM8A 3HUJA 4PJFE 1GGBL 4E5XB 5M94B 3RWJB 1WCBB 4PP1C 1BIIA 5FO8A 1Z2KA 1D5RA 3WUFA 4DEPB 2BNRD 1JNJA 1XSKA 2PC8A 4LSVH 3O2LA 5D7IA 2F54A 2EE9A 3GDBA 3AIBA 4GO9A 2N7BA 3QCTL 32C2B 3K8MA 5CGYD 4EN3B 5IBTL 5BVPL 3EBAA 4YBQC 3OR7B 3NSXA 4G7YH 3NH7H 3VG0H 5HPMA 3P11H 4Z76B 3SOBH 4ENED 5DHVA 3AS1A 4NQCA 4XI5D 1P6AB 2F74A 3MXVH 1RUMH 4M6OH 3CPUA 3X12A 2OJZL 1FAIL 3WEXA 2Q76B 1D6VL 3I6LD 3O2VL 4Y4KC 1BD2E 4B41A 5EIQA 3EMQA 1WPCA 3PP3H 1KB3A 5CPQA 2XFFA 1NBYB 1B0GA 7FABL 1DBJH 3VIMA 2R1XA 4PYHA 4L4VD 4PJGB 4HBCL 4NO5A 1OTSC 4QRRA 2BFVH 4H25B 5D2LB 1C16B 3D51A 1CIUA 1U8MA 1NCUA 5EOCH 5EO0B 5LGHL 4J2XA 2NNAB 3D2UD 3GEWB 5SWQB 3L4VA 1INDH 3NA9L 4PSRA 2CDFA 3L7FB 4XP1H 1CLOL 4UDUA 2K9UA 1BEYL 1C08B 3HE7B 4RDQF 4QHNA 3DVGA 5GGRY 1A02N 1DFBH 4X4YA 1W72A 4PJ7F 1EGJA 3QFJB 4WI9A 4NIKB 3JV6A 1CGXA 4TUJA 4BQ5A 3D4ZA 4PMNA 5C0FA 3WUGA 1D9KB 5B38G 3L4YA 4FTVE 4N0YL 2ORBH 1NDMA 5C0RL 4FZEL 1LNUB 3H9SB 2WMIA 1R8LA 3SIMA 2AXGA 5HI5D 1DBBH 4BQ8A 3FKUS 1AMYA 2W07A 4Y7MA 2XN2A 5ADPH 3PTMA 3ZE1E 4DQOL 1QRNA 4OFDA 2OJEB 3ULVE 3BPCA 2P5WA 5F6IC 1XCWA 3M1BA 5CHNA 3VXRE 2KH2B 4NQDB 5DUBA 1QBBA 4IRSA 5FCUL 5IJKA 5HDRA 3TO4D 4HAGA 5HDQH 1QFWH 2QJDA 4NKMA 1OAYH 1QBAA 3D69A 2VRQA 5GSRB 1J87A 2OTUB 3GXMA 3VFTA 1C5BH 1H4PA 1G1YA 2JB6B 3KPLB 3SURA 1ZV5A 3MUY1 3S9DB 2VQUA 4DKEH 2YZ1A 3BIKB 2EDBA 5GS1B 4MWFA 1LQSR 3DX7B 1CE6B 1B3XA 5JDSA 3BKJL 4PGEB 1MHCB 1CIDA 5HDBE 5EU6A 4JFVA 4LIQE 2J7BA 1YY9D 4K3EH 2X4SA 5EWIH 2EDFA 3BAEL 4YAQA 1ADQL 4LDOB 4N0UB 1JXKA 4NZJA 4Y5YC 1ZBKA 4TTDC 1FYTD 3OG6B 1FFRA 4KROD 1MFVA 4WKFA 1JV5A 4J6RL 4D0BB 1U0QA 2R0WH 2C9AA 5J57B 2BNQE 2DH2A 1E6SM 2VLJD 3S6CA 5JNYA 1UJ3A 3BH9A 1F4WL 1I4FA 4QXUH 2EDRA 3ARUA 1EOKA 4NZFA 4EUPH 2Q8AH 1XGRB 1GC1C 3W27A 1FNLA 1M7XA 3VIIA 2O9PA 3VXMB 5T3ZH 5ABHA 2WBJC 1A6WL 1Q6GA 2EYSB 4Z7NF 1MJ8L 3V7AG 4HF5L 1YY8A 3PZUA 3CVIH 1ZS8B 2KZWA 3GSVA 1NFIA 2OSXA 2X4RA 4RNRB 3VFPA 2EXWC 1T1XB 4R7NB 1YEDB 3BVWA 2VXVH 4XP5L 3A6CL 5D8JL 4CCCA 4MCYA 4G42B 2WP3O 2UY4A 4AH2A 2VISB 1DQDH 4HWZA 1U8NB 4K68A 3S3PA 2Y5TA 1OAXL 4YEFA 1YPZF 1IC4H 1VHPA 4HH8A 1B2YA 2Y5EA 4WHTA 4F2MB 5JHDA 2Z31B 2DQCH 1JDCA 1B0RA 2JEQA 1AI1H 4HMEA 4PJBF 4FFVD 1JWMA 1IT0A 1QYGH 5DEGB 3BVTA 4F9DA 1UVQB 3BUTA 4L3EA 4LDLB 4M4PA 5IHZB 1QBMH 2HFEB 3MODH 1NL0L 3EYQD 1KCUL 2AK4B 2ILLA 1XAUA 4NUGL 3KXFD 4PEEA 3D85D 5FM5M 4MA8H 5A2BA 2I27N 3VH8G 4AT6B 1DQTA 1CZ1A 3F12B 4J28A 5CZXC 3MCKB 1XF2B 4X7TB 5L7XL 4TVSa 1ZBCA 1G6RA 2E9MA 5F88A 4NRZA 1FORH 4L9DA 3FQWB 3ZKMD 3IAQA 4HXAH 2G60H 5IMLA 2EAEA 2XM2A 3QIWC 1JF5A 4N0CD 1BBDL 4XPBL 4D6FA 4BFEA 1Z0MA 2DSVA 3G5YB 4H20L 2CESA 3KPSE 1FHLA 3S96B 4KRPD 1W1YA 4NNYA 3KVQA 1UM4H 2D03L 2PF0A 3VGAB 1G7JB 5EU7C 4ZUSB 1I1FB 4FQLH 3QAZB 5K9OA 4WHYG 4GSDL 3ZE0E 4LHQB 4AWEA 3FQXA 4MJID 3TBVB 5A6JA 2WZEA 1E4KC 1IVLA 4AD4A 1WICA 3KPRE 1IMHC 1P69B 2O5YL 2QSCH 5DUPL 2J72A 3O0RH 4P23B 3AS2A 2OYKA 3ALXA 5H94B 1S5HA 1AE6L 4K3DL 1NOWA 1MJJB 5HYJE 4OIIL 3WD4A 3QRGL 3LZFH 5CINL 1X5XA 4LU5L 3MV7D 5A2KH 4OZFH 2ATKB 4W6XB 4XVTL 3QP3A 4OZFB 4UV7H 4OZHA 6FABH 3EOYG 1NAKL 1X5HA 1QVOA 2F2HA 1V3KA 3FO9B 3X17A 4EE9A 1CGSH 5BCAA 1CK0L 1KJ2L 4HS8L 1BG9A 1K5NB 3JXAA 4O02H 4OAWA 2YN3A 1DVFD 3HZKA 4HZLB 4I1NB 2UVFA 4IOIB 4HQQL 2Z9TA 1XGQB 3VIKA 3B6SB 1QZ1A 5IQ9A 1QQDA 4IDLA 4NCC1 2X4PB 5F7YC 4WTZG 1E0WA 1QNSA 3WMBA 1T89C 4OCNC 5IIEA 2DI7A 3V0JA 4JFTA 4Y4HB 4PRHE 5KVMC 2ATPB 4HC1A 1EFXB 1AD9A 3CFDB 2AI0H 3FCTA 3CZSA 3IK2A 5GS3A 3G6JE 4H04A 3OXSA 4XBEH 5DMKB 1R75A 3PHQB 2APVA 4TSAH