2FHBA

Crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltose
Total Genus 340
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
340
sequence length
1052
structure length
1052
Chain Sequence
DVVVRLPDVAVPGEAVQASARQAVIHLVDIAGITSSTPADYATKNLYLWNNETCDALSAPVADWNDVSTTPTGSDKYGPYWVIPLTKESGCINVIVRDGTNKLIDSDLRVSFSDFTDRTVSVIAGNSAVYDSRADAFRAAFGVALADAHWVDKTTLLWPGGENKPIVRLYYSHSSKVAADSNGEFSDKYVKLTPTTVNQQVSMRFPHLASYPAFKLPDDVNVDELLQGETVAIAAESDGILSSATQVQTAGVLDDTYAAAAEALSYGAQLTDSGVTFRVWAPTAQQVELVIYSADKKVIASHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPEGWDGLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAQESNMVQHLKQLSASGVTHIELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLTQLKQNDSKDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMLYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDAVRGGGPFDSGDALRQNQGVGSGAGVLPNELTTLSDDQARHLADLTRLGMAGNLADFVLIDKDGAVKRGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRSSDDGSNYDIIARVKDAVATPGETELKQMTAFYQELTALRKSSPLFTLGDGATVMKRVDFRNTGADQQTGLLVMTIDDGMQAGASLDSRVDGIVVAINAAPESRTLQDFAGTSLQLSAIQQAAGDRSLASGVQVAADGSVTLPAWSVAVLELPQGESQGAGLPVSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of pullulanase: evidence for parallel binding of oligosaccharides in the active site
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords pullulanase
total genus 340
structure length 1052
sequence length 1052
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2005-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fhbA03
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2fhbA01
2.60.40.1130 Mainly Beta Sandwich Immunoglobulin-like Rab geranylgeranyltransferase alpha-subunit, insert domain 2fhbA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fhbA05
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2fhbA04
5KVDL 4CCCA 1BAGA 1SEBA 3JSSA 1O7AA 2P5WD 1L4IA 2XQBH 5FM5O 3F58L 3ECQA 2X4QB 3VX0A 5DMKA 4XCEA 2C3HA 4NGHL 1RZFH 2I24N 1EAJA 4BFEA 4UU9A 2LTQB 4PJIB 2NXYB 3TBTA 4ZG1A 4ZXBB 1VBRA 4B7IA 1VFOA 4I2XA 3M6DA 5L8JB 1DWFM 3A21A 1EFXB 4JZNB 3E6HB 1EO8L 1KNOA 3N17A 4NZUH 5DHYB 5CSGA 3RL2A 1PFCA 5E0FA 4GXVH 1FA2A 3KLAB 1P4IL 2PW1A 3VJ6A 2XPKA 1GGBH 2A9MH 2MQ0A 1D5ZA 3OKNB 5EU7E 4TVDA 5E8PB 1XR8B 3MFFB 3ZE1E 1VEMA 3QFDA 4NNYA 3W0KA 3QDAA 3VGGA 5JLZB 3T3PF 1MCCA 1FOBA 2BOBA 4P5TD 3OJDA 1U91A 4WFED 1ZS2A 3WEXA 1U8OA 5GJSH 2WVTA 5GSVB 4CJ0A 4PJAE 4OZFH 2H41A 3UEZA 5AC5A 3G5VA 3RI5K 4H20H 2PXYB 3U0PA 4Z0XB 5JZ7C 3PWPA 4AQ1B 1BQLL 3BDYH 4RAUB 1TZHB 1DBKH 1CDYA 2W60A 4M02A 4ZYKB 4RE4A 4PJHB 2DQFA 4DWHA 3A67H 2IH3B 1C5BH 3VXME 4GKNB 1U8NB 1FVEB 3PDOA 2FGWH 3TBYB 4OZOA 2V17H 4WLCA 2MNUA 3VXNA 3GNRA 3POHA 3KYAA 4QRTB 5FO8B 4LSRL 1A47A 5A94A 5IW6A 3RWEB 2XIIA 4POUB 5IEHB 3HFMH 1FDLL 2YL5A 3NGBB 1KIQB 2R23B 2A1WH 3WD1A 5IJVB 2YD5A 4NHCL 1QPXA 3H9SB 4KMLB 1G9ML 4XAWH 1H15B 5D93B 1YN6A 2XWBB 5E7FA 1YHTA 1JYWA 3OJMB 1A6ZB 3RGVD 1DN0A 4PRIB 1EDGA 2DPEA 1F13A 2DBLH 4P2OD 3GMPA 2AJXH 1C7SA 4DTGL 2NT0A 4U7MA 4FA8A 3NSXA 4JRXB 4CU8A 1MLBA 2EPLX 3KPRB 4X0KA 1IGTA 3GKWL 3WFHA 5I0ZA 2WZIA 1FV1B 5CIPH 2VZOA 3WDHA 2J73A 2A9NH 2ZE0A 3SO3C 4GINA 1X5XA 1J8HE 4X99B 1OQOA 3T0AA 3I02A 4L8BA 4Z7NE 1TTGA 4IPNB 4OD2B 4QXGH 4KGJA 2R1WB 2D0FA 1BD2E 2UYLB 4Y88A 3MYZA 4A6YB 3CUJA 4Z2GA 4JQVA 4X98A 4J4PA 5FF6B 1M7DB 2VDRH 2EE2A 3CFEB 5CZVH 4KJPD 4FQ1H 3CPLA 3OZ9L 4UQAA 3A4XA 4MSWB 2AV1A 3PL6D 4NZUL 4DVRL 5KN5B 4XH2A 4EN3B 5SWSB 4JHWL 4JO1L 4OB5H 1NM9A 4DKDC 1UJ3A 3RBSA 5LYRA 4M4RA 5F97E 1T1WB 3CU1A 4RGND 4OI8A 5EZLA 4M7LL 4LNVA 1OB0A 3V8CA 4WJ5B 1PDKA 1RUMH 1V5JA 1Q1JH 2N4IA 2PYEA 4MNJA 2KUTA 1J0IA 1CGSH 2RFXB 3MX0A 3T0EC 5SWZA 3TONA 1YMMB 1GGCH 5ADOH 1HNFA 3MLWL 4X8JA 5GIRB 2D2OA 4XPFH 3SCUA 1ONQA 5DQDH 4ZUSA 2VL5B 2D03L 3GBMH 3P4NA 1C5BL 1OF2B 1B0WA 4GRLB 6CGTA 4P57B 5B39A 5CJ5A 4U0QB 1M04A 3V5DA 3JTSA 3KYMA 1KJ2B 3A5VA 3MUJA 4FLRA 1A7OH 4HWZA 4LSRH 1FVCA 3D18B 2G3MA 1EFXD 4UIMA 1F2QA 1Q94B 3PWNA 3D39B 1T7ZA 4IRJC 4GKOA 5HNNA 1JTTA 1KG0A 1JZ7A 5CUSH 4X7CC 1UXSB 2EXWD 4DKEH 3ILQD 1KIRB 3H9SD 1J1PL 2DL9A 2RCSH 5F7WC 1F6AB 1G7PB 4NO0B 1U41A 3OKKB 2V9QA 3M46A 4ZSOB 3AS3A 1BBJB 4EEEA 3B5TA 4XMPH 1MJUH 3STZA 4X6DA 2DGAA 1NCWL 5LWYH 4FQ2H 2R56L 2OWXA 4LBEB 5EU6A 1YNKH 4WU7B 4QWWC 2E7LC 3ZZ1A 2F8OA 3D9AL 5KSBB 3BFOA 1N5YH 3ARFB 4LYQA 2P8LB 5F8QC 3SDCD 4J3WA 4YGVA 3UPRA 4GIAA 4CD7A 1QVBA 1RZKC 2N7AA 4MA3A 1A7BA 4QHUA 4YE4L 3GMRB 5D8ZA 4ZFOA 4YPGB 1JCKA 1JDAA 1E6OH 5F9WB 1ZANH 3PGFH 1ODZA 3WIJA 4Z7WB 4D6EA 2VIRA 4OSUH 3IFNH 3W2DL 5CBAB 2CPCA 5F1NA 4U2ZA 2CR6A 4P46D 1AQ0A 5FYJU 1A0QH 12E8L 2YZ1A 4WY7H 3LDBB 4ETYA 1RFDL 2YLAA 3WD5L 1G7HB 1AE6L 4IHOA 5FYLH 5CZVL 1MCBA 4U1SA 4TOYH 4HIXH 2J7DA 1QNQA 5E8PA 2GITB 2D7MA 1MW2A 5HD8C 2XTKA 4WW2B 2VLKA 4DVRH 5E9DB 2Y24A 1KGXA 1UZ1A 1EMTH 4LGSB 2ZSWA 3CVHH 1GOIA 2XA3A 3H3BC 4A6YH 1N6UA 4OZFB 3P73B 3VD5A 4UTBH 4LGRB 4Y19E 4QYOA 5MEQB 4F7EB 2V3GA 5E95B 4HKZB 5FA3B 1QPPA 1E15A 3HRZA 4XBPA 3OKOA 5HYJE 3D5HA 1WUNT 4I18B 4UT6L 1WZAA 1A6AA 3SJVB 5DLMH 3NZHH 1QSFA 4Y2DB 3FQTB 5C6PB 4YDIH 3WXWL 2ZUWA 1MJJA 3S96A 1BYBA 2IQAA 4QP0A 5DQDL 4XXDB 4H5SA 2CLRB 2A6DB 2BHUA 4BUGA 5I1IL 2EH8L 4KJWD 4MPKA 1CT8A 4U0RB 4W6WB 2J44A 1T0OA 3F5LA 3O8XA 2VQ1A 3EO9L 4GPNA 2DWEA 3BLKA 3W6LA 5ICXA 4X9BA 1H4PA 2OCFD 4UV4L 4Z7OE 1OL0A 3CVIH 4Z7WA 4AIZA 1G9NH 1QFUH 2AGJH 3GZKA 1RVFL 4L4JA 2DICA 5DK2B 5TD4A 1M1SA 4MZ3A 5JHDD 3NTCL 2VMFA 3BGFC 1KEMH 4FK9A 2RCSL 1T0PB 3SDYL 5T1KD 2FECI 1ZEAL 1KV3A 3X3GL 3G9VA 4UI2A 5ABDE 2Y07L 5I1KH 1YDPA 2QQKL 2IPKA 1JPFA 2VVNA 5EPMB 4FMKA 3IXAA 2GHWB 2DRUA 4LCCA 4MGXA 4B7LA 2EDRA 1YQ2A 1U6AL 3D9AH 4UDUB 1N5YL 3QCTH 4XNUL 2J25A 2YL9A 1MVFA 3FOMB 1UXSA 1YMMD 5HHVL 2APVA 3U6RA 3F6IA 3AHZA 2A0LD 2CR3A 3ARRA 3HRZB 3V5KB 1BZQK 5IB2A 2FEEI 3NCMA 4L4PA 2PB1A 2LVCA 3OAZK 5BZZA 4P23D 1I1YB 3F5KA 3HG2A 3AFLA 4U1HB 4PJEE 4LQ1A 3JWOH 2VX4A 2QSTA 3FFCB 3QZWG 5GGQH 1RFDH 1W0WB 1T5XA 4URIA 4TOYL 1UA3A 2DS4A 1OGAA 1FL6A 1ZT1A 4JREC 3ZO0A 4NXKA 2F61A 3TO2B 1XGYL 4OUUB 5D72L 1NFDE 1PY4A 1U95A 2VURA 2PYEB 4FQXC 4P23C 4UTBL 3SKNA 2JLLA 2J72A 3MRBB 1X6LA 3VWJA 2X4QA 5C9KA 4GW5B 1F45A 2VYRE 4NM4H 5D7LE 3QUML 5FXCH 2XSBA 4KU1A 1JTOA 1NAMH 5BVPL 3CC5A 3MV7D 4JN1H 1OWRM 5JXEC 4TSCL 4JDZA 4AEHH 3GBEA 4HA3A 2VDMH 3SE4A 3SE4C 2X1WL 5HI5D 1OAZL 2GI7A 1JYVA 1CZ1A 1I1XA 1T22B 3RUGB 5IHZA 5D9PA 2PWHA 3C8HA 2OTUA 5FYJL 3LX9A 4F57H 1XH3B 2BCKA 4AEEA 1Z9LA 4LPCA 1QW8A 1SHMA 4WIQA 3FB6A 5JOPE 3QOMA 4QHMA 1MRDL 2HT2C 1P7QA 2VE6A 1QRKA 4KKAC 2DTML 2FO1A 5CINH 4G8IB 3QWRA 3MUIA 1JDDA 4G7YL 3VG9B 4QTIH 3MREA 5DJ2A 1XYFA 3B9EA 3MUGB 2ENSA 4OFYA 1SBSL 3C6LB 4FQIH 4LNRA 3DX8B 3M07A 4RISL 2DQTL 1OTSD 3E3QC 4NWUL 3APGA 1Z0MA 4GRWF 4EOWL 1KGCE 1VHPA 3CFDA 1OSPH 3TJHC 4HOXA 3DSNA 4ZPTB 4E4PA 3QDGE 3LN5A 3VM5A 3QR3A 1V8HA 3VFSA 1A8JH 4Z7UA 3U7VA 1QQDB 1DANT 5CWSB 3KS0H 3I85A 3MYJA 2Z92A 3BVTA 5I18H 4I3SL 1HZHL 3CZKA 2VH5H 5A2IH 3WBAA 5F7HA 4LVHC 3CFBB 4CVZA 1K4CA 1UR2A 4Y5VA 2BNRA 3OHXA 3V4UL 1GIGH 4PJEB 1J9CT 4K71B 5L6YH 2X42A 1FFNB 5B8CA 1V3IA 1T03L 4HIIA 1XEDA 2VDPH 1FL5A 1JI1A 3VW3H 2J2ZA 5D2NA 2XUCA 3KR3H 1NDMA 1KCSL 3BGFB 2V2TB 5KW9L 4LCUB 1KCLA 1NWRA 1EBPA 3BMVA 3PQYE 3LQZB 4V1DD 4WI4A 5GHWH 3UJTL 5C0GB 4NSBA 4DCQA 5JPNA 5IW6B 1XSIA 2JCCF 4N8CL 4M80A 3HNSL 4POZC 5HHPB 5HBFA 4PJBA 1EHAA 4PB0H 3DO7B 3ARED 2EDKA 3ZQ9A 1XGYH 1WWAX 3TBWA 2K1MA 1HXMA 2H1PH 3I6KA 3WSQL 3RDTA 3VXMA 4PJFF 1YEHH 3GHEH 4ZNEA 4O51B 4HZ8A 4AD2A 4TNWK 4HWBL 3AHYA 1FZKB 4XNYL 5D5MF 5IVNA 3VXSE 5I15H 4BQ8A 4KWUA 3B2UD 1HILA 1PZ5B 4MVBD 5BXPA 1D5RA 3BQUB 3UJIL 4OTXH 4MTVA 1T2QH 5I1CH 5IVXF 4HOZA 4BQBA 4ENED 1RZKL 4NFBA 5EBGA 4GKSB 3MSDA 3CVHA 3UZVB 4OUEA 4XB3A 1FRGH 5FOOA 2CXGA 3BVWA 1FNGB 1BIIA 3MRMB 4LEOA 4GBXB 3ESUF 2XFXA 5KSBE 1TETH 5FCUL 1EX0A 3VMPA 3WHE0 3O2DA 1QPKA 1NGXA 3NABL 3CSGA 4KUZL 3TNNA 1CDCA 2I9TA 4L3CB 1OARL 1NCBH 1XCTB 1IL1B 2Y5TB 1IM9A 1LEIA 3LQAL 4GQRA 2B1HH 4MYWB 4NWTL 1CE6A 5IEHA 1A3RH 2VX5A 5EUOA 5EO9A 5DC4B 4O2FA 4I2XE 3U1SH 2BVTA 4WHYG 1ZAGA 4V27A 2ARJB 1UD3A 3ULUL 2BY3A 4H26A 2XTJC 4NRRA 2OSYA 1FNFA 5GXBB 4QHNA 4TTUA 1XF3A 2XSAA 1W0YT 4F9PA 1DQLH 2B20A 4KTEL 1XF5B 3AZSA 3MRJA 4K3DL 4GFTB 5D7JB 1BGAA 2R29L 2JTDA 2CUIA 1R7AA 4XMKL 2VX6A 2PETA 4C55A 1IAOA 4ZFZA 4P99A 3M17B 3VGFA 2MPAH 4XVTH 3HNTL 1P9MA 4Y2OA 1A7RL 4I1NB 1TTFA 4LCWA 1KCKA 1LP9A 1FGNH 1UH3A 4DAGL 4Z5RA 3T8XB 2FD6H 4L4OA 1A1MB 3A6BH 5FECB 3O6FA 5IHSA 2D4DA 1ORSB 1A3QA 1UGNA 2AJSL 4K8RH 5C86A 3LIZL 2GCYA 5ID0B 3I02B 1K8IB 5EWIH 4PJ8D 4YXKL 1OAYH 1DDHB 4R7NB 3QUMB 4OGAD 2D3LA 2ZJSL 2IANE 2VDKL 5K9OB 4UFHA 1J87A 1IM3B 2D9QB 4KUCD 2NQCA 3PWVB 1OWQA 2E9MA 3C6LA 1HF6A 5D1QA 3BOVA 3UTTD 4PJGA 5IIEB 5KVEL 4ZUUB 1DVFD 4AEIH 2BXZA 4W6XB 1NAMB 2BMKA 3OKDA 4OQTA 4CDHA 1AXIB 3SCMC 2SEBB 1URLA 1JG9A 1JV5A 3IYLW 3X3FL 1UD6A 4M5YH 4APQB 2ZX8A 4ONOA 2YIHA 3HMCA 5L2KE 2VRJA 4MZ2A 1KENL 2VC2L 1OCWH 1LE9A 1EK3A 5C71A 4P9ML 3T0EA 4L8SB 4PB9L 5E4IA 3ALWA 5CBAA 4I13B 3U30B 3JVGA 2A3EA 1MSPA 4ENEC 1V3HA 2OI9C 2VAAA 3VXRE 4TULL 3TYGH 5CP3A 5F6IB 1RJYA 2D3VA 1UM5H 5AYUH 2Y2WA 1LE5B 2OSLB 3VX1A 1JL8A 4X6CE 4Y4HB 3QHMA 4R27A 3SCMD 2NY4C 2CKBH 3QCVL 2NY6C 5DO8A 4YUEH 3T2PA 4JCMA 4N0YL 3L2LA 1DCLA 4X7SH 3GK8L 1RZ8A 5FYKU 4PSRA 4XZUB 4N0UA 2FDBP 4HW6A 4ETQB 1G84A 2D20A 5KVDH 3NH7L 4LEXL 4WI6A 2V2XB 1FYTE 2FDMA 5MEQA 2XFXB 5CIPA 5EOCJ 4J4PC 1FZKA 1KLFA 2CH8A 4I77L 4LSPL 4MNQB 3PV7A 4U1GC 3GSNH 2XFFA 3MRLB 5T1LA 1QD0A 5JORB 1G6VK 4NZCA 2CHOA 1A6AB 1FVDA 1I3GL 5JA8B 3AIVA 1NBYB 5FCSH 4HWEH 3U36B 2FYYA 1DQML 1FLTX 2P24A 4HUUB 4XMLL 5GGVH 1RIVL 4P4KC 3L2MA 3SDXF 3H7LA 2V5DA 4KQ4H 3RGVB 1TJIH 3HI6H 3EMZA 5C09D 3RVVD 4K94C 1XFPA 1CBGA 4O9HH 5I75C 3MGTA 4IEFB 4YXHH 3NYDA 3WD3A 1T2XA 4QCIB 2VNCA 3S5YA 2I07A 4HAGA 4HPYL 1LL4A 5EO1B 5EOCL 4PYHA 3MUY1 3EYSH 4K3EH 4LLDB 2P5WE 1IMHC 1E6JL 5EUKA 5HDLA 3K7UA 5I8EA 3S88H 4BJLA 3W5NA 3THCA 2AXFB 4HUWB 4KROC 1B3WA 4C7FA 1W8NA 4PRHE 5A40E 1KN4H 5BW7C 1CGYA 4BKLB 8FABA 3HI1A 1DWIM 3T4AB 2F5AL 2GUOA 5DRXA 4PMOA 1JGDA 2VCAA 3QRGH 1WP6A 2F54D 2K7QA 2V17L 5KVGL 1IAIL 2ESVD 5C0DA 5DSCB 4HC1H 2Z0BA 3F65A 3VI4F 3IDIA 1HL8A 4YHLL 4F7PA 3HFML 3DBXA 4P7QA 3ZJ6A 2JK5B 3RNQB 4W8BA 1PX8A 1HHKA 4HSQA 1H3PH 3SE9L 3W6MA 5IKCB 4P46C 4XI5D 2Y5TA 3IDXH 4PLKD 1E4XI 5ENWA 1DQQB 1FIEA 1FH8A 1NGPL 5BS0A 3PHAA 4NNPH 4ZAKA 2DBLL 4DTGH 2DN7A 4UBDC 5C0RL 3BUYB 4EDWL 1MRCL 5LKNA 4ZFFA 1INQA 3EYOB 1HJXA 5DEZA 4P2CG 2QMJA 3RWHB 3RJDA 8A3HA 3TP4A 4D6FA 4NRSA 3OLIA 4XPTL 1UG6A 1AC6A 2HP4A 1GRWA 4LHUB 2DQIH 4URTB 4AENA 1QNPA 3QHZL 4BSVB 1F3JB 4RCAA 4ZFZB 3K2UL 4MJIE 2YRPA 1F3DJ 5SWZB 3EJZC 1AGFB 3FJTA 2BS9A 4LLDA 1QYGL 1DE4B 1IGJA 4YLQT 2UZXB 1OIMA 4FQJL 1H5VA 5DDHA 4ZAKC 1G7QB 2XG5A 2YDRA 1EOKA 3EBAA 2UYLA 3OKEA 4AD4A 5KZCB 4S1DD 2EAEA 3VA6A 3ZDXF 4R90H 5J3HC 3KXFA 5F71A 1M6OA 3WIHH 4MB3A 4XPAL 4YXHL 4G8FA 5SX5H 5B38A 1KACB 5KN5A 3TGXA 4LX4A 3JZ7A 4G8IA 2DBJA 4QNPE 4CMMA 5HGHA 4XP9H 3OAZH 4UCFA 3VIIA 3KWXA 2Z4QB 1W9XA 1K6AA 4C7GA 1AD0B 5EU3A 5IW1A 2P5WA 2ENYA 1UFUA 3MA9H 2ZWLT 5DD5H 4PCSA 4ZSOA 1AR2A 2YA1A 2AMGA 3VDCA 4H7VA 2VKWA 1YUHA 1A02N 3N12A 5T1MA 4NQXB 4HF5H 4RMVA 3AWEA 2R2HB 2F8VA 4OKVB 2CLZB 4Z9KB 1LMKA 4ZOAA 5CZXC 3HC3H 1YMMA 4OFVA 3CSBA 4XVSH 3WJLA 3QWQB 2X4PB 4K7PY 4K55A 2DSVA 1CFTB 1UWXH 3V6BR 3H9ZA 3IU3A 1CD9B 4X5XA 4WU5B 3GSVA 5JO5B 4OGAC 3QDJD 3SDCC 3AXLA 4P57A 1GC1C 5IBLC 3WQVA 3KJ4C 5I8OL 1CS6A 1L9MA 3R06B 3VI3F 4PJCF 4U3AA 1E4KC 2H9GA 1SR0A 1J1PH 2AP2A 4MAYA 3QA3A 1NBQA 4X4YB 4KGLA 3MV9A 3CH1A 4GXVL 4POZD 4MX7B 5TH2A 3I3BA 3O41A 1W3HA 3DRTB 5EBAA 1WT5A 4E5XB 3TVMB 1AP2B 1ORQB 4WF7A 1NP2A 5D7IF 3VXUE 2FHCA 4DK6A 1QI4A 4JKPH 1BJMA 1RZJC 1MELA 1HHKB 3DJ9A 1D7FA 3SDDC 5I74B 2HFTA 2D0GA 2AK4A 3FW6A 2DQIL 5IF0A 5FYJD 3KLDA 4C4KT 5A6LA 3F7RA 5D5MA 3EIFA 5EZIH 1MHHA 4MXWL 4GZEA 3PWPE 2BDNL 2XWJA 2J4WH 3C5ZC 3GRWA 1CQYA 4EBQL 1QO3B 3SJVA 1FHLA 5IVOA 2IMMA 1ROWA 1X5ZA 1W72A 1BMGA 5J57B 4S1RL 5FYLL 2OZ4A 4J28A 4YZFE 3DVGB 3MUAA 3BRFA 3OTTA 4D9LL 3KL5A 4OI9A 1JGUL 1I7ZB 1UG9A 4WKHA 3OIHA 4F7MB 1XR8A 4PJ5D 4XPAH 3LEXB 3DSFL 4A6YL 4YDKH 5TGBA 3GKZA 4R0LC 1NGQH 5E9DA 4ZQKB 4JPWH 4JQXA 2CO6B 3MPCA 1Y6MR 4A2LA 1QKZL 3EYVA 4OQ1A 1NH6A 5JXED 1EFXA 4PGZA 4JREB 2PO6D 4JFDB 2DI7A 1OM3H 2F53E 5A2CA 3EOBB 5D96C 4KTYA 4E8CA 1HJUA 3JTTB 3NIGF 1ZLSH 2H26A 3DOSA 3ILQC 3H9SA 4G3YH 2LAGB 2DJSA 3L3DB 3SE3A 1KTBA 3OGOE 4JHAL 1QLEL 5K9JH 3MLUH 2EH8H 4WUKL 5IM7B 3RWCA 4AMKH 1P6WA 6TAAA 4OKDA 4XVSL 1KLGB 5E94B 5F7YC 1QI5A 2CDGB 2VSCA 3GO1L 3KLHD 2FLRT 3TTOA 1S5HA 2WINB 4QOKA 1A6WH 1YDPB 1SQ2N 2VLJE 5T1KB 5SX5K 4QXGL 4NDMB 5CLTA 2R39A 2XWTB 3ULUE 1G9NL 3D4YA 5I1GH 2FIKA 5J12C 1M7XA 1F6LL 4GRMB 4M7LT 4X7EC 4UT7L 3CXDH 4XP6L 5DFWH 5GGSY 2DQGH 1GQKA 1VCAA 1U8HB 4HZLB 5E2TH 2G3NA 4JM2B 4K23L 2YD4A 3L4UA 1IKFH 1WCBA 3FFDB 3A4AA 2ARJQ 2ZP0T 3X3GH 2QR0B 3G6LA 1D5MA 3QULA 3FO1A 1AD0A 1IAKB 1WIPA 4Z18A 1HHGA 1HI6B 3QDMD 3RP1A 3LKOB 3BRGC 3DX6A 4LPTA 3RL1A 3O6KH 2HTKD 3L9RA 2BMKB 3OKDB 5JQ6L 2FX9H 2AW2A 3CZFA 5A2AA 3MV8E 2A6JB 4PJGB 4NQEE 1N7ML 5IIEA 1I9IH 3L1OL 4FXGA 5HHOA 4HC1A 5EPMA 1JHTB 1WEJL 4M7LH 4GRWH 5DD3L 4PRNA 1I9JH 3FFCE 4JFWA 3P30L 2ARJA 4OV5B 4Y4FC 3PL6C 2WZPD 2Y4SA 3QPQD 4KH2A 1JAKA 3BPOC 3L7EA 4ZS7L 5TH2B 3BZEB 3HA0A 1MY5A 1ITXA 4TSAH 1FO0H 2FJFA 3QUZA 1B0GB 4HXAH 3VXOA 4UOZA 5GGRB 4BFIB 1L7TH 4D9LH 1XT5A 1ZXQA 2P44B 4I8DA 5ITFA 4YHKH 2BSTA 3O4LE 1G6RL 3CH1B 3VCLA 5DD1L 1RHHB 3DUUA 5MI0C 1QBBA 1MVYA 5E9DE 4O4YL 4BZYA 3B9VA 4RFNB 1VFAB 3BAXA 4F7CA 3TVMD 1TJGL 1TZGL 1UH2A 3HG1E 5ACMA 4K7FB 3D2UD 3CMOL 2KKQA 3QHNA 2A73A 4ELKA 1GVYA 1MQKH 1LQSR 2GW5A 4IOSD 3WJJC 2F53A 4AEHL 4OF6A 5ABFA 4PN2A 3EFDL 1LGVA 3W9EB 3L9RB 4GW4A 3QO0B 4I9WE 3I2CH 2QV2A 4YHOL 5BWFA 3BX7C 5A3ID 3RX5A 4X6FB 4JHAH 5K9JL 5FDYA 5HDBF 3T65B 1I8MB 3P77B 3Q3GB 4F9LC 5KSAA 1K2DB 2HTLC 3KNBB 2J7EA 5DVNA 3P0YH 2B8OT 3WUGA 2YBUA 4XZWA 2DTMH 3GSUA 3L6FB 4XB7A 3W2DH 2VRKA 1ECEA 3ZTJG 3ILPB 1IAIM 1JRHI 2VLJA 3CJJA 4JPVH 2NLJB 5F44A 5LA2A 2CKBA 1JF1B 1JNHB 1AE6H 1PGRB 2ERJC 3DX7A 1CDGA 4NM8L 2ADFH 2VLKE 5TF1H 5E99H 1U8QB 2JKXA 4J7RA 2E9LA 2F8QA 1EUTA 5E00A 4CD4A 2NY0C 1IT0A 1JWSA 1UR8A 3OGCB 3D39E 1JUFA 4QCIA 4XAKD 2OTWB 1WGOA 3UCRA 3AHTA 3SURA 3WNPA 1LTXA 3CFDB 4NYLB 4L4TD 5I18L 4I3SH 3VXNB 5A2FA 5I79A 1Y0LA 4N8VA 3WQ4A 3RPMA 4WHTA 3JUZA 3W82A 2WUCL 4PCTA 2V38A 1TNMA 3LH2H 4OBSA 5E03A 3M1BB 5L6YL 3CZ8A 4R96B 5TFSL 5D6DA 5C0ND 3HUJB 5HYSG 2OR7A 3BDBA 2X41A 3VIMA 4R9HA 1KCSH 2BX5A 4HZ6A 1H2JA 1S5IH 5BMFH 2YN5A 4U1MB 1IGFH 1OSZB 1FPTL 5JHDA 1RUPH 5J8OA 4O51A 3WL1A 5L7XL 4YFLF 3E8UH 3LMJL 3S36H 3SCMA 1KXVA 3R4DA 2FR4B 5AYBA 2IBBA 1NWUA 4XP4L 5E2UH 4KKBD 1GC1L 3UROR 4ZOEA 3V0WL 4FTVE 4N8CH 5I1JH 3HC0A 4F80A 5MEPB 1LP9F 5E1QA 1KWGA 5L2KA 4DN3H 4J3XA 1HSBA 2MJWA 4EVNB 3ZHLA 1BF2A 1BWMA 2WWMC 3BQUD 4FFWC 3B8SA 2W0FB 4NO3B 3UR7A 5IKCA 3UTQA 5D9SB 5M17A 3L3GA 1NCDL 1ZEAH 3WN5C 1NMCB 4Y7EA 4L8BB 1KCUL 3DGCR 1YYMH 4X6CA 1FN4A 1MQKL 2OSXA 5T1LD 2P42B 4P23A 4RRPA 3BD3A 4XNUH 4NQDA 3P4MB 5H35A 3W0WB 4W7WA 1T0NB 5HOSA 5JA9A 1KJ3L 2V7HA 3SN6N 3WYRA 1AC0A 1JPTL 4WENB 1BYDA 3BT2L 4P5TC 3IF1B 4UZGA 1SMAA 5HY9B 1INEH 3BQUC 4FFWD 1P9MC 5FUCE 1KUMA 5LJYH 3QNXB 2F2HA 4ZUTA 1MFDH 1HVQA 3UERA 1GYAA 2QSCH 3V4VL 5C0JB 4FNUA 3IRZA 3OAYK 5CPTA 4G9DB 4R4BB 1UWRA 2BNRD 1MWOA 2VXQL 3LRSA 3V5KA 3KPMB 1GZPB 3OKNA 5TDPB 4FNLH 1GORA 3T65A 3AAZA 4CNIA 5EO0A 5JW4M 4BQ4A 3SCWA 5DQ9B 5T3XH 3AB0C 1P6FA 3Q5TA 4EN3D 4ZFGL 3E2HC 2R4SL 4XMKH 3QIBA 3N0AA 3PG2A 1YUHB 1VEOA 1MHCA 3P9WB 1P4IH 1K8IA 2HTKC 1BQHB 1BQHG 4D94A 1CWVA 4ZE4A 1QLRB 1V7NH 2P5EA 5DEFA 1R5WA 1DQTA 1I8LC 5IB2B 1F00I 5D96B 1NL0L 1AKJB 2WUCH 3U46B 5BVPH 3QUZB 4LQFL 4MCYA 4JFPA 4KI1A 1KR1A 3QH3B 3TYFB 1I1AC 4XPBL 1PKQB 3TFKC 3Q6FA 3TF7C 1RUQL 5C0CD 1PY9A 1DQDL 2X4OB 2VDKH 1P7KA 1R3JA 1MPAH 4GAJL 2BNJA 4NRXA 3BUDA 4FQLH 3WS6A 3MJ7B 1C16B 5L7XH 3HE7B 1WO2A 3A67L 3U6RB 3IDUA 4JDZB 1JPST 1F4AA 3MMEB 4J3VA 1OW0C 3GIVB 4FNRA 3IANA 3AYSA 5H37G 4NNXA 2J8GA 2BFGA 2A3BA 1QA9B 5INDA 3JBG7 1QR1B 1WV7T 1TVHA 2VC9A 2X40A 1SBSH 1XC6A 2GJ6A 3MJ9A 2BRRH 1DZBA 3OL2A 2DIBA 2JJWA 3UEQA 1J1OL 5F9DC 5I5RA 4UQEA 4TX6A 1ZS8A 2AAVA 1GZQB 3IDJA 1GZJA 4ZTPH 1K2DA 4YAQB 1BVLA 4PB9H 1HKLH 5LAXA 1JPTH 2QR0A 2LV4A 3WDPP 4IOFD 1A9EB 5KS9E 1I1FA 3RZCD 1BFSA 2J7FA 1UM5L 3VSUA 1WBYA 1AY1H 1BVZA 1HH6A 3N9GH 1U33A 3IDGA 5AUMB 4TUOA 3C09B 2UZIH 25C8H 5I17A 3SE3C 4NN6B 5A8QA 1JMXA 5EOQL 1KF9B 1MFDL 2PC8A 3O4LD 3K1KC 1CFNB 5IGXL 3ULVL 3VXPA 3NA9L 1R3KB 5C0FB 3CIVA 3GZAA 3P2TA 3SDAA 1PX3A 3HPLB 3CNKA 1YEJH 4W6YB 4D3CL 3N85H 2EDWA 3WD2A 4UDUA 4ZFOB 3ABZA 6FABH 2ZUXA 4M1RA 3MUHL 4X4XA 4AG4L 4N8PA 4QRPB 2VR5A 1Z5LA 3V0VB 5BRZE 3C6SA 3GSNL 3P4OA 1UH4A 4KMTL 1V05A 1GH7A 4PYGA 4DO4A 4XPHL 1J12A 5D1ZB 3QEHA 2VWEC 4RNRB 5D7IB 3C5ZB 4M6NH 5J7CC 4OCYL 1SJEA 4TRPL 1CECA 3AIRA 4PMNA 1MWAB 3Q1SH 4TVPE 3TT1L 4W88A 1NC4A 4YN5A 2ZSVA 5A16B 3W0WD 1CNVA 2X1IA 2OYKA 4BA8A 2Y9RT 2GVYA 2CITA 1A6VH 1MNUL 1DUZA 3G5ZA 3UTOA 5EORH 5DQ9A 2IPUG 4LLYA 3C08H 2I27N 1Q9WA 3PIQB 3DX9B 4DWSB 1T1ZB 2NY7L 1I75A 4N5ED 2AKRB 1PG7W 5IQ9A 1DSFL 4HWZB 2YLLA 3JV6A 1DBML 4OM1H 3ZYJA 4JRYB 5C8JA 3TO4D 1I7UA 3KLKA 1W2KT 2CPUA 4I4WA 3ROLB 3HE7D 3NABH 3AGVA 4C7DA 3FO1B 3QULB 2F54B 1U58B 4OIFA 2CKSA 3T1WA 2GUYA 4FQXB 2FX8H 3CX5K 3QEQB 2WP3O 2YFNA 1W9VA 4PMVA 3EZ8A 5CEZH 3O81A 1S7SA 5CMAB 2EIZB 5IFHL 2E8ZA 1KTKE 4YFDB 5KVGH 1QHZA 1ZVHA 3PUCA 2VXVH 4PY7A 4ISVA 1ZWIB 3HC4L 2PNDA 4HC1L 2GJ6E 4OAWB 1VSCA 3JV4A 3L3HB 1NDGB 3H3KA 4LVEA 5DVMA 4KK9C 4ZO8A 4FOMA 1MJUL 2FEEL 1GPOH 4GJTB 1JGEA 5HJ3A 2YWZA 3V6OA 2KPNA 3WUBA 3RJYA 2CXKA 1YNKL 1A1OA 5EU5B 4BSWB 5E4EB 3L3DA 1FGNL 4UIKL 4AL8L 1K4DA 4TTDD 3TNNB 3RWEA 1LK2B 1GONA 4NZTH 5BZXA 1L6XA 4KAQH 3A6CL 4ZD3L 3D3VE 1UM6L 1HYSD 4K8RL 1YPZB 1JHKL 4JQVC 4JFZH 2V2WA 3EJYC 4LHUD 1SYSA 5HHXL 3WIIH 4LGXA 3IFNL 1TPXC 1Z3GH 1AGFA 1MFCL 1ISWA 3BXNA 4GOSA 1P5VA 3U9PL 1INQB 2NY2C 2FGZA 4U5KA 4ZNCD 4WW2F 4KQ3H 3O4OB 2WKGA 2G60H 1U8PA 4PJCA 4RRPG 1HJQA 2HLAB 4GLRH 1R5VA 3BDXA 3K2UH 3KPRA 3D85B 4XTRD 3VXTB 2UVFA 4TTDC 3H55A 4H88H 5E8OA 4Y5VB 3T0ED 1Z0NA 2IPTL 4W4OC 3EDKA 3I6LE 1B2WH 3H54A 1UM4H 1XGQA 2AJYL 4DFIA 3TT1H 1UQSB 1WFUA 2LU4A 5JHLL 4QLLA 4CMMB 1BAFL 4ATLA 3NCEB 1F42A 1MNUH 4NOBA 1HJWA 1OCWL 1J0HA 1A9BB 2WBWB 3STLA 4PG9B 1IC7L 1MI5A 1ZVSB 4YK4C 4U1NA 5DHVB 5H94B 4A6YA 4NZRL 4Y5XC 1R86A 4X0KB 1OSEA 4UT6H 2NY7H 5DXWA 4JFTA 1NUNB 4NQXA 4NZDA 4FNQA 2FHFA 3U0WH 1CVSC 2Y8VA 2WCAA 3LAFA 1B3ZA 1J0YA 3W39A 5I1LB 4LIQL 3WXWH 3SBWA 1SJEB 4IRSD 5D6CA 3F7PC 4AEFA 4LMQI 5LCVL 2OZ4L 2Q3AA 3TBYA 4XCYA 1T83A 1IE5A 4P4KB 1YYLL 3ZTJH 5IFJA 3VIKA 4JJHA 3VMNA 4DVBB 3MRCB 3F12A 2IC2A 4M6ML 5E5RB 2EYRA 4J1UB 4NQUA 2HVKB 3QG7H 1FQ9C 3QXUA 5ECJE 4GMTH 5HHOD 4PTVA 4PUDA 1QI2A 4X9HA 3SUTA 2AJ3A 1KTLA 4NI3A 4NIKB 4P7OA 1IGIH 3PZUA 4OZIB 2XWBA 3AIQA 4F8QA 4LSTL 3D0LB 2NY5L 4WI8A 1FVEA 4DW2L 4IJ3C 1HVXA 1JFXA 3HMXL 2BNQE 2MQCA 1I1AD 4PYSA 3U79A 1Y6NR 3QDGA 1ZT1B 1HH6B 5JIKA 4HA1A 3GNML 3GIZH 4YQXH 1NLBH 3BRDA 2YD3A 1LO5B 3QCTL 1FC1A 1MWAH 4ONHB 4X80H 2Y06L 4UDTB 2LVEA 3MRLA 4LNRB 1I7UB 3FFCA 4XP1H 1S7XA 3A6CH 1T04B 4ZD3H 2G2RA 3EDFA 4QF1B 5HDRA 4X99A 1MH5B 4WI5A 3D3AA 5IFAH 4EK7A 5LVEA 2PTUA 1RQ5A 4GRLC 3MJ6A 5A95A 2IH1A 5HJ3B 2V2XA 1EAPB 4BH7B 3QEQA 2C26A 2CRYA 2X9YA 3WMSA 2AQ2A 1N8ZB 5FDWB 3SCMB 3FB5B 3RWIA 4BQ3A 5EB8A 4O5LH 2F19L 4YXLL 1CGUA 1P4BH 2G60L 4ELMB 4HU0A 1OGSA 4DEPB 1CXEA 2X10A 3AROA 3BKCL 3C5ZA 5JBDA 3MRBA 3VWJB 4EBQH 1YPZA 2WZEA 2WMKA 4HUXA 4Y4KA 1JUFB 2F5AH 3ZE0E 3BVUA 2NTFA 1BTCA 5I8EB 1T80A 3WFLA 1MFBH 4LLYB 3ET9F 1SJXA 2A74A 5E94A 5CEZD 3G6MA 4N8VB 3CDFA 1QFPA 3HMWH 3KYOB 2J77A 3GIVA 1YECL 2ID5A 2OR8A 4LLUB 4UINH 4F79A 2JJSA 1PQZB 4NQSB 4NKIH 2VISA 4UFJA 2CYGA 1MF2H 4YGVB 3UPRB 4U7SA 4TNVF 3FMGH 3OX8B 2GFBA 2VABB 4AMWA 3CK0H 1KJVB 3QEUB 4KY1L 1D6VL 4ODWA 2F7PA 3HZVB 1V0KA 4ZO6A 1AO7D 4XX1E 3CV5A 3DROA 3EOAB 4KTDH 3VGAB 4ZUUA 3GJEB 1GCYA 5HPOA 3IJYB 3FCTA 4OFIA 3RA7L 4IDJH 4ZODA 3UETA 4HX1B 4PJ7E 1P4LA 3QIBB 1IAKA 1ACYL 3KLAA 1SJHA 2XN2A 1K8DA 4W4NA 3RDTC 4C57C 3ECBB 1Q94A 3KLHC 4JPIB 3MV9D 4GRMA 2A73B 4QTIL 3BKJL 1S7XB 2C1OA 3JV5A 2V3EA 3GO1H 5HYFA 3ZKND 4TVUA 3REVA 2WMIB 3PE9A 1M4KA 1RZFL 2WMGA 5AZEH 4WV1C 4NN7C 4F2MA 3HMXH 3LSOB 2WAHA 4G5ZL 1PZ2A 1LQ0A 3W38A 1YEKL 3CHDA 3BVNA 3C8DA 1NFKA 5GS0C 1CFVL 3HNVH 4QCFA 3CXDL 4XP6H 3T3MF 4CVWA 4EKJA 4UQDA 1G9NC 2GJXB 4NF7A 4HA4A 4AT6B 2GSGB 3LKQB 3O9WB 3FB8B 3SGJC 5CPSA 3FQUB 2Y36H 1C16A 2DQUH 3HE7C 3HPJA 4PTTB 1LO3L 3C8KB 1CF8H 4MAUH 5E6ZA 3O6KL 5FM8A 5JQ6H 2WHLA 4PUBH 2OYMA 4HJJH 4BA0A 1XAUA 2GAZB 3UZEA 3MA7A 4PJ8B 3BZEA 3NFNB 1TTUA 2CHNA 3G6JE 3ME0A 3U9UA 4PGCB 3ROOA 5I19L 1GUVA 3DHJA 1U3JA 2EEAA 3MA9L 5DD5L 5F96L 4PREB 3HE6D 1AD9A 4PJXE 2KQNA 4QHNB 1B2YA 3BKCH 1PYWB 3GXIA 3VTRA 4GMSL 1XF2A 3ARGA 1U8KA 3BDYL 2D0HA 5ID0A 3MXWL 3VE0A 4TSAL 4PB0L 1E6PA 4PPTA 4OZFA 3CZLA 4O2CA 1UYWH 2FGWL 1MFAL 5DHVA 2ADIB 1QLFA 4KUCF 1PPIA 1L7TL 2O5ZL 3CDGA 4LLVB 3BAJA 5FDWA 2B0SH 1H5BB 2J7HA 2C3XA 4M29A 1GGTA 1JHTA 4WFFE 2JIXD 5FUCC 4EXPX 2V5TA 3DWTA 1GQIA 1W9UA 1G6RH 1WJ3A 1CTOA 1H1NA 4PR5B 4M1GL 4TVPL 3ZO9A 3N11A 3TPKA 4G9FE 5ABGA 3CK0L 5DF0A 3NGBC 3N1FC 4OCXH 1G9MH 4Z2HA 4QOKD 2D7PA 3GBDA 3TIDB 4L4VD 3LKSA 2AJUH 2OP4H 3FAWA 2FIRT 3VXRA 1F58H 1MCPH 3HTLX 3RWJA 5F9JB 1Q0YL 3IETB 3VWJC 5I1HH 4RX4D 2YUVA 4IHOB 3BD4A 3RHWK 1KT2B 4LF3A 5JOFA 3RKDC 4W89A 4UQCA 4YHOH 1TIUA 2GFBB 1ORSA 3GKWH 2CGRL 4Y8DC 2Q7YB 3ZSSA 1MCLA 4OLZL 4Y4KB 3KPQA 4I48A 3ZTNH 2CIKB 3BIKA 1FYTA 1ZT4A 1V3JA 4OCSL 1IFHH 1C93A 1QOXA 3PWUB 1NCAH 3ULUH 3QIWC 5EC2A 3WFZA 4PD4K 4YHNA 4UT9L 2RFXA 4P7LA 5FHBL 2ORBH 1TE1A 1DQLL 3UTTE 1MCOH 1BG9A 2W9DL 4JPVL 2AXGA 4TSBH 2J8UB 3VFVB 4OKVA 3HN3A 3R8BB 4XBGB 4JAMB 1UR0A 4HLJA 5LG1A 1Y18A 3ALGA 4LVHB 3MUZ1 2DQUL 1X3DA 1QFOA 3EJJX 4HH9B 2O61B 3QOKA 5JO5A 4R0LB 3FZUC 3SKMB 1K6QH 1Q8MA 4WGWB 5EH1A 3GUTB 2LE9A 2OX5A 5DC9B 4Q9QL 1VADA 3TTYA 4G8GA 1RJCA 4CNIB 3EKCA 5EWIL 2EDXA 4M03A 5ILTH 3WF2A 2EDQA 3LPGA 4WW1B 5DSCA 1AGEB 4JRXD 4P2OC 1RUML 2BV9A 2A6KB 5T33L 4AK1A 3V5HA 1US2A 1W3KA 4WV1A 1ZLSL 1KJ2L 1KN2L 3L4WA 4U2YA 4IIQA 1VF8A 2G75A 4RMUA 3RPKA 5IB5A 1FCGA 3TVMA 5C07B 4KZDL 3GBML 4AMKL 1YNTB 2BNRB 2MKLC 3DUHA 2GJZA 1CEOA 1U3HC 2J8FA 5E9AA 4LHJB 1XGPA 4MAZA 4HP5A 4ML4A 4PTXA 4PGCA 3ROOB 2PW2A 4WFGE 4GG6F 3GI9H 4GRWE 3BSHA 1A6WL 1NBZB 5D2NB 1OT2A 5EZLB 5EFFA 5IHUH 4L9LB 4Z7UB 3NUKA 2VIRB 2B31A 4BKLA 2DDXA 4C59B 4JN2A 2W0KA 3QR2A 1FC2D 4HKXB 3MI6A 1N6QL 1RZIA 3LKNA 3ZKXC 3EFFB 1K4DB 4JG1H 2Z35A 2AJUL 3AIWA 1FFQA 4Q9BA 4XMPL 4JFYA 4Z0BL 1VKXB 3N1MC 4HUUA 3SE8H 5TDOB 4F37F 2V2WB 3BUPA 1I3RB 4GW5A 5IROC 1MJ7L 1HH9B 3VD7A 4AMXA 5HI3C 3ZMRA 1UJTA 1I9IL 3L1OH 3HE6B 3RGVA 4W8LA 4IRSB 2BFVH 4P5KB 5JPMA 1A6PA 5DUBB 4WW1A 3STBA 1C90A 1HSBB 3MNWB 3PGFL 4S1DC 1R5VB 1PAMA 1QX1A 1LDSA 1JGLL 3MFFA 2CRIA 1UWUA 1IC4L 4AH2A 3QCUH 4UZUA 5CXPA 1OLZA 3JV4B 3V4VH 5CG0A 4I5BB 3LN5B 4YHYC 1NQBA 2J7GA 1AR1D 4PRPD 3MNZB 3ARDD 3QNZB 2HFFB 5KANG 3RWCB 5D5ME 3SO5A 2BVDA 2DD8L 4P4RB 3SUWA 2CIKA 3BIKB 2NXYD 1KTDA 3MUGA 4N1HB 1LK2A 4QOKB 5IVXE 2J6EA 3I50L 2IH3A 3D6GA 2RBLA 4RDQG 2FO4B 5GS2H 5ALBL 3PGDB 1NWTA 1MHPH 5EU4A 2WHKA 5ABEA 2VE6B 1AJ7L 1OD0A 1E6SM 2V2TA 1EPFA 1V7NL 4QRTA 3QXDB 1XF2B 2AEQL 4N42A 5C0AD 1E56A 1MFVA 3KPQB 1BZ7A 3I9GL 5CSYA 3S6TA 3QG6A 2YK1H 1S8DB 5D7KE 2R2BB 5EZOH 3S88L 3T4YB 4HMCA 1YN7A 2UVEA 1B90A 1AQHA 1CLYH 1T66D 2NW3B 3ARWA 4P49A 1IILE 1TQTA 1IT9L 1CGXA 4DUWA 2EZ0D 2FE0A 3BUYA 2ZSVB 1IJ9A 5A16A 1MLCB 5GGUA 5E8DH 3RJXA 5SWZD 3ULUC 3EO9H 4JHOA 2TAAA 1QFHA 2R1YB 4IOIB 2YMXL 5BVJB 1XR9A 3SKOB 3MLTB 4OV5A 1KJMB 3QO0A 1I3UA 4MA1B 2BP3A 1BZ9A 4LCCC 4JRYA 1AQDA 4P3DA 4JM4H 4QY8B 2WSPA 4ZXBA 1UWXK 4BFGA 1VADB 5TQ0L 3E3QE 1LEKA 3V7MA 3S5LB 2FEDD 4QOKE 5M3WA 1CFSA 5GQBA 3QO1B 3X13B 2FECL 1BECA 3RPIB 4H41A 5ABFB 3MNVA 3IDXL 5IM7A 3WN6A 1H3VA 8CGTA 4Q7NA 1NGPH 3T2NH 2NR6D 2CETA 2AK1H 1ZJBA 4Y16A 3HPJB 3D2UB 4BFIA 2BY1A 2VOTA 1KB5A 2VLME 5A3HA 3QIBD 2ED9A 2VISB 2R0LH 3AMLA 4XPTH 5TFSH 3QCUL 2GAZA 1H3TA 3GM0A 3BESR 2R9HC 4HPOH 4ZQKA 5E56A 1B4JL 1N3NA 4KKAD 1QNZL 4LPUA 1RJYB 2J8UF 3ULVC 4YBQD 1W1VA 3ZIZA 4BYHA 1CXHA 4HK3N 2DLIA 4FMFA 4OQTL 2CDEB 3S4SB 3LMJH 3S36L 2XN9D 1YMHB 3FT3B 1BOGB 3RVWD 5D2NC 2DQFB 5C7XL 5DURB 1BX2A 1GW1A 2W0LA 2WVVA 4GBXA 2ZG1A 1C5DA 3O3AA 4N1EA 2O9OA 4HZ7A 2EICA 4MNGE 4U1IA 4NQDD 3O6ML 1K8DB 3B43A 2FX7L 4MD4B 1XD1A 4I5BA 1MHPL 4G42B 2H3NA 2MKWA 3QUMA 1ZL1A 1BJ8A 3AMKA 3RIKA 3NA4A 3ZJ8A 4U1HA 3O6AA 5TQ2L 3UO1L 4UIMB 3CLFH 2R0ZL 4RL3A 4BZ2H 2E27H 3IU4L 3FTGB 4HBQA 5KTEL 1IQWL 4IMLA 1WK0A 4XNZC 4PSPA 2JEQA 1WCBB 1A64A 2GTZA 2JJSC 1FAKT 1OTTD 1UOKA 3MQIA 3WFDL 3RNKB 4NC1C 3IFOA 1R3LB 4PGBA 2PWDA 4WWID 2QHRH 5BRPA 1INEL 4R7NA 1OAQH 4FLSA 2X7LA 2UWEB 4P5TA 2YMXH 4BUHA 1UZ6F 1LE5A 2CDFA 3WV0A 3HC3L 3OPZH 2DI9A 3ULSA 2H9GB 1J86A 1U92B 1JBJA 5ADPL 4OD1H 4W84A 2H2PC 3IS0X 4JHBA 1EGJL 3VH8G 2WP3T 1N3NB 1OD8A 1C08B 2XT1B 5I6XC 3HS0A 4CU7A 4D6CA 1D5BA 3SDDD 3NFPB 5GGUB 2QPSA 3BISA 2X9WA 3LQZA 3IKKA 2J88H 4Z8FL 1IEBB 1V3MA 2F74A 1QVOB 2VXSL 3FO0L 1V6UA 5J3HD 2D31B 2K3TA 4BH8A 3QBTB 5C0JA 3WUZA 2ESCA 2FEDC 3GI8H 3P4MA 5MEPA 3O2DL 3QQ4B 4E8DA 3QUXA 5IBTL 3T1FB 2UWFA 5EZJA 3OLDA 2NMSA 2XKNB 4HFUL 4LIQE 5C3TA 5CGMA 4KXZI 2Q1EA 4AL8H 5B39B 3LEVH 4KAQL 4P2QA 3CDCA 2DKMA 2HKHL 1GHRA 1Q0XL 2E7LA 3NVQA 4HPOL 5T5NF 2X05A 1G6RA 2EADA 5HHXH 4Q0XL 3WIIL 2GSIA 3NN8A 3CMGA 3A23A 3ZJ7A 4JO4H 4A2MA 5KW9H 1NKOA 4HWBA 2ZWYA 2F9BT 3PV6B 4JZOA 1KPRB 5GSRA 1J0KA 4BZ1L 1HOCA 5DHVH 3JWDC 5D9SA 5JW4R 1NLDL 4PJXA 5J13C 3ULVD 2VL5A 2O5XH 2DM2A 1QFWH 2J8HA 2P49B 4IRJA 5EBWB 2XTJD 3U4BL 4D0BA 3D0VA 3BEVB 2YC1B 5DTFB 1LDPL 5DJDB 3KHOA 3O6MH 1MCSA 3AY4A 1OGAD 3KG5A 5FL1A 3TNMA 3UJJH 5AWNL 3SQOL 1UM4L 4JKKA 2HN7A 2HJFA 5KBNC 2ZXDA 3SGJA 1GSMA 1FL5B 4PRDA 3RZCA 3HS0B 4TVCA 3RDTB 5C2BH 4CJ1A 1SYSB 2BC4A 4NO5B 1OAKL 4BZ2L 1I7TB 5HI4D 5FYKD 1F6FB 4PJDA 1HQRA 1EQCA 2JB6A 4WCYH 1R33A 3MCG1 5IEKA 1ZA6A 3CSYA 2AEIT 3STLB 4LIQH 5HVWA 1JHLL 2VLRA 1AKJD 1CU4H 3FO2A 3MLUL 4PMXA 3WQ6A 1V3LA 4MD0B 1YY9C 4IM4A 5E5MA 4H25B 3L3GB 3DXAB 3MR9A 4NGHH 3OGRA 5F7EH 4Q2ZA 5FOJA 3L3KA 4GG6A 3AS0A 4F9JA 1X5HA 4HV8A 5JW5A 5BV7B 2OJZL 1JJUA 5EU3B 5IW1B 3UBXG 4GH7B 4W7UA 1AIFA 3N85L 4UT7H 1T5WA 4LCYA 1RSFA 5EBLB 2J88L 4AG4H 3WNLA 4LHUA 4AENB 4DZBB 4Z8FH 4F7TB 1GJWA 2XYCA 5DJ6B 2XY2A 3GSNB 4E42A 4JGUA 4YDJA 4YAQA 3HB3C 3ARGD 1NMCC 3W27A 4PMUA 5JHDB 3NCJH 4JZOB 1NBVH 1GGBL 2A9ML 3GNMH 1H5BC 4MJ2A 5MP6H 5JW4N 2EEDA 5IB1A 1NLBL 1G7JB 1NGZA 5JOEA 1QRNB 1S9YB 2CK0H 2X4RA 3INUH 4LPWA 2BY2A 3SCTA 3QRFM 1T6WA 2XPGB 1S7RB 4M5ZL 2Z91A 1VPOH 1I9JL 4P5TB 1Q0XH 2RGMA 3RM4A 1LWHA 1HQRB 2XN9E 1MRFL 1GXEA 4F8XA 3PL6A 3S35L 1HP4A 4X6BA 3HAEH 4WKAA 5FM4A 2R9HD 2QTEA 4JDVB 5D1XA 4AIOA 1W72L 3BP7A 5E6ID 3BC9A 3RVVC 1WB0A 3WH7A 4B9ZA 4N0RA 4X8XA 1S9WB 2WMPA 3GSRB 2VLMD 1C12A 3GRWL 4I0PA 4S0SD 4KI5C 1H49A 3D25B 4XVJH 1DWJM 1E43A 4V2CB 3ZYIA 1XCQB 5I1DB 3AVEA 5IOPA 4I0KA 4ATWA 3BPCB 4WNQA 3D69A 4JQIH 4U49A 5A3IC 5ANME 3MFGB 1IVLA 3QDJB 3QFDB 4PS4L 3RDTD 3AS1A 5D8JH 1H3WM 3NACH 4Y1AA 1YEEL 1EHXA 5GNZA 4AIUA 2PYED 5ICZB 1LG1A 3MREB 5DJ2B 4P59L 4D0BB 3VFTB 4HXBH 2ADIA 1NBYA 5D7IE 4M56A 1F8TL 3C5SB 3VXPB 2OM5A 4LLWB 4MWFA 1HXKA 4PJHE 1EEYA 2PBGA 1VERA 5IG7B 3PV6A 5H8DA 4NRYB 5BZWA 4D0CA 3CFCL 1R8LA 4AYGA 4BQ5A 3DX1A 4K8RD 3CUPB 5IDIA 3UG4A 3TT3L 5ITBH 1W0VB 1ES0A 1XF3B 3UDWA 3PWLA 1ORQA 4M24A 1Z3GL 4JY6A 1E6XM 4NPYB 1T83C 1PQZA 2YR3A 1DQJA 1G1CA 2VDRL 3MODH 3TWCH 1S7WA 4X4YA 3PABB 4QT5A 1TFHA 2DQDL 3HZVA 3LEXA 2GJPA 4K3JL 3O9WD 1JYXA 3WNOA 3C8KA 4CD5A 3EJYD 2F7OA 1MFNA 4TYUA 1HT6A 3PL6B 4LVNB 2XNAA 4JO1H 3ARDB 4OB5L 3MRGA 4XNMA 4MDJB 5HYJB 4QRQA 3MRNB 4LKXB 4ALAH 1D9KD 2PR4H 5I17B 3VFNA 4NSKB 1BF8A 4MDOA 5JHLH 2HT4D 3KAAA 3WUEA 2P5EE 2VRAA 2OL3A 2W0FA 1B6DA 3QQ3B 5L2JB 3V0JA 4P46A 2J7BA 2P7TB 4IOIA 4L9DA 5BVJA 1T5XB 3WH8A 3CD4A 4W93A 3VM7A 2DM7A 3ZKSD 2VJXA 4I3RL 4KKBC 4QY8A 3LH2L 1MY7A 1QSFE 4AH2B 2C1OB 5FGBA 4PTTA 4KI5E 2W63A 3N04A 4HV8B 5JW5B 4XPFL 4JKLA 1Q9OB 1MEXL 4U6XA 4WEBH 3WL9A 3ZT5A 3OZPA 5IG7A 1ZBKA 3EMCA 3HE6C 1F4YH 1OT1A 2WWCA 2GY5A 1RPKA 2C9AA 3MRQB 1HJVA 3QO1A 1OAXL 2NY3D 4R7DA 4M1DH 3BZFB 3CGTA 3ZKMD 5D9NA 3CZGA 1J01A 3FQRB 1J5OH 4MNQD 2ZXBA 1IBGH 5D1QD 5F1NB 2O5ZH 5E8NB 3BH8A 2DQHH 3MACH 1QSFD 3F62A 1HQ4B 4PS4H 1E55A 2GDUA 4HWUA 3O4OC 1PS3A 1YEEH 1MHEA 1E5NA 2CO7B 5HHPA 3V0HA 4KJWC 3G5XB 4WW2A 1KGWA 1NKRA 2NYYC 3GSRA 3O8XD 1PKQA 5D5MB 5T3ZD 3E6FB 3GIZL 1Q72H 2BSSB 3SE9H 4YQXL 5C09B 5BZDB 1F8TH 3ARDA 3MCKA 5C08E 1KPVB 2YPLE 3N15A 3MV01 3WY4A 4P4KA 2C0HA 5CWSA 3SKUD 3CFCH 4YE4H 4JRWA 3MRPA 1BLNB 1IGCL 2V3DA 4PGDB 2HKFL 3OHXB 2J62A 3A24A 5GS1B 2HYMA 3DV6B 2C1PA 5L88H 5HVGB 3WCYA 4G7VH 4QXWA 1YNLH 4YFLI 1WIUA 4OZGB 4WDIB 2CMRL 5D6CB 2E6JA 4FP8L 1RK0A 4KJYA 1NCAL 4PTWA 1W9DM 2EE6A 4N9OB 4U05A 4JM2C 2W9EL 4LOUD 3HUJE 1N2RB 4MA7H 1EMTL 4AYSA 3GB7B 3WKMH 1NFDA 5ICYA 2R1XB 4Q22A 5F7KC 2Z91B 3SDDB 4YHYB 3WENA 7A3HA 3C60A 4WUUA 4JFFA 43CAA 1MQRA 5DURD 3OKMA 2XHYA 4RFEB 2CBUA 2UY5A 1NL0H 1KOAA 1NMBL 2BVQA 4ORGB 5HGDA 3MRJB 4PMQA 3SCVA 1WLHA 3FMGL 1D3CA 4F33A 3WD4A 1F3DH 3VFPA 3PWUA 4OGZA 4AYFA 5IMMA 4XPBH 2OL3H 5HI5C 3PZ9A 1KCRL 1XYZA 2NY2B 3LPOA 3MBXL 2MTPA 5CD3B 1XIWA 4X9YA 1JWUA 2IEPA 2OWCA 1IGJB 4OZGF 4M7ZB 4JFEE 2FO4A 3LHPL 1XF5A 1OY3B 3CSYB 4G6KH 1KN2H 2HH0L 5C9JA 1EZVY 3LKRA 5CP7B 3H42L 1X4XA 1IBGL 1K9FA 4HK3J 4ZE5A 4TOQA 1QFUL 2AGJL 3FO2B 1HCFX 2DMCA 4PMZA 4MB1A 5IQ7L 1YEIH 5EMYA 3TZVA 1T1XA 1LD9B 4V1DA 2WPGA 1FNAA 4OF8A 5AZEL 3VWJD 3WDQA 1E4XH 5ACZB 3WUFA 2FJHB 3BAWA 1WICA 2P8LA 3IKCB 4P8XA 4XUYA 2NXZC 5EUOE 5B21A 2JCCE 2HRPH 3HNVL 4Z78A 1DLHB 2VXUL 4CD8A 1NPUA 2RJMA 4ZAKB 1RI8A 3QNYB 2NLJA 1M7IA 4G80A 3EJTA 4PJFE 2IAMD 1LL6A 1HKLL 5EULV 2EDOA 3G6AB 4F8TA 4HLZH 3FQWA 5DRWA 1NFIB 2Y1VA 3MLYL 4NN5B 1OD7A 4BS0A 2A77H 2ITCB 1MJ7H 2HKFH 2EO7A 2X89D 1H0DA 3BEVA 25C8L 2BY0A 3RGHA 2A3CA 4ZTOH 3MJ9H 3X11B 2DJUA 5I16B 4U1LA 3AJ7A 4WHTB 3X17A 3HRPA 4HG4K 4FP8H 1ZLWK 3UYPA 5CD3A 4PJDB 5F9OH 3LRLA 3K8MA 5J9PA 3MXWH 1E1EA 1JWSB 4QXTA 4RZCA 3QQNA 4JB9L 2HG5A 3T0EB 2HJFB 1QFWI 4Z7QF 4YNYB 3T77A 3KDMA 5E70A 3MV11 4U3XA 3MCKB 3KL0A 3TM6A 2K7PA 3VXRD 5DC0A 4JFFE 2OJEA 3LOWA 4PJGE 4NKDB 1PBGA 1MCIA 2EPOA 3CFEA 4OF0A 4Y2DA 3LRMA 1V3KA 1NMBH 2QADD 5LGKA 4N90E 4H1LB 5ALBH 1NGQL 2R1WA 1FO0B 2LU3A 3ROLA 5FKPB 1J1XL 5AZ2H 2J6EL 2ZPKL 3V0FA 2AEPH 3IVKA 1INDL 4JFXB 1TUXA 1CXLA 4GW1A 4MMXC 5GGSA 2OR9L 3SGDI 3RDKA 4HMDA 5EU6E 1S9XB 2AXJA 4X98B 4GXUN 5FF6A 1HKJA 4KRPD 2X5PA 3SKOA 4S10A 3QHOA 3ULVE 5BV7C 1IT9H 4DGVL 4ONGH 1ZWIA 2H32B 2VLRE 4PJ8A 5BXSA 3EGSA 4OFDA 5FGCE 1FBIL 2QBWA 4QRSB 3QIUD 2X4SA 3LN9A 5E6IB 5GS3A 4C56A 5GGRY 4JZJB 5L9DH 1UHVA 2D4FA 3O6LH 3KPOB 1KJVA 3MRIB 5IFHH 3MJGX 3IFLL 4RISH 3C6LD 4N0UE 4P8VA 4Y5YC 5HHNB 5IJKA 4JM4L 4Z7VE 3F6LA 1GPOL 3MRPB 5TQ0H 3AMCA 3C9NA 4Y4FA 5F1OB 5GRZA 3UYRL 5KSVA 3S4SA 2HT2D 2VH5L 4N0UB 2O9PA 4UIKH 3RCNA 3VVGA 3MBED 3V52H 1QEWB 4TUKH 3SGDH 4PP1D 1UM6H 4TUJB 4HUNB 1T03H 4LDOB 1N82A 3RL1B 1QBLL 4NRZA 5DD3H 4UOQA 3BYTA 1KIRA 1EEQA 4CUCA 4UTAL 4M9OA 4L3ED 3VIFA 4GAGH 2R0LL 2C4FU 3FHAA 4KROB 3NCFB 4X6CF 3V0IA 1NEZA 3ALPA 1F11A 5ABHA 4LCWD 5TE4L 4LKCB 2YRLA 3HNSH 1BBJA 5K59E 1B4JH 5D6DC 3ZDZF 3WY2A 2DH2A 5M7QA 1A9EA 4N8VG 4H88L 1ISVA 5I1AA 2H32H 4N5EC 2EABA 1ODUA 5FA4A 3J8F7 3C5SA 3B9KC 4ZOCA 4YHEA 4FTVD 4CD6A 1B2WL 3GSXA 4HWBH 3ELAT 2F5BL 3CFKB 4Q6IA 3RU8L 5I15L 4WSJA 3GXPA 1LWJA 4FLOA 3UP1A 3ZOAA 1WVZA 2GT9B 3U83A 4KC3B 4NZRH 1G0YR 4OCRH 1KB5L 2EO1A 3JTTA 4EI5D 3GYCA 1INDH 2YPLB 1JAEA 1HKIA 1NGYA 3PABA 4QT5B 5GIRA 3ZHKA 4ATDA 1NMAL 1I8IA 3WN5B 1DVFA 3D51A 3AHVA 4L9LA 3PZOA 2W67A 5FA3A 5F88B 5CILH 1AO7E 2X44D 4FF5A 1IAMA 5D7IA 2BVYA 4HKXA 1KFWA 5E09A 1ZBVA 4RBPK 4RFNC 2X1XR 4UILH 4XNZB 4M6MH 4APQC 4U1GB 2B1HL 1IEHA 2WWKO 1FE8L 4NO5A 4MXVF 2VRQA 1GOFA 1Z5LB 5DFTA 3V0VA 3CTTA 5E0QA 1IQDB 3BP4B 4GAFB 4ZFOL 3PDGA 1N8ZA 1Q6GA 3MRRB 3VOCA 3VIHA 2DL2A 2NY5H 4UMGA 1SVZA 4K3DH 3IJ8A 3VFTA 3OGVA 4UFLA 1M71A 2XACC 3L4ZA 4K2UL 4PY8I 2ADFL 1O7VA 1KFAH 1WZLA 1RUKL 4OD3H 2BERA 3S96B 5ETUA 3IFPB 1EEYB 1MWAL 2E7BA 3GMMB 2AJVH 3V52L 3O3DA 4X5XB 4EZMA 4MA3B 5GS2D 3C5JB 1E4IA 5T5FH 3ZT6A 4UAOC 1DBJL 4NHUB 2DJ4A 4DUXA 2JJVA 4C4KO 4ZFMA 2ERJB 1R24A 2FATL 3BKMH 4GI8A 2XN9A 1BFNA 1KGCD 4Q6IC 1T5WB 4LCYB 3LRKA 5D7LA 1F4WL 3U4EB 1XRVA 5SWQB 1ADQH 2AEQH 3EFFA 1JE6A 4G8FB 3DIFA 3SGEH 1L7IL 1VDGA 2D3NA 4ODWB 4GG8B 4YHMH 3UC0H 3HG1D 5F8RC 2NX5D 1E0OB 2B5IB 3QAZB 4JGJA 4KROD 1CIUA 2EE3A 3IDMA 5J56B 3GGWB 4JRYD 5BMFL 2BNUB 3KPLA 2XTJB 4BH8B 4N0CD 2WIIA 3DI3B 3NIDE 1NCTA 5C09A 1SY6L 4NJ9H 1X4YA 4MAYB 1YJDH 2X1OA 2H2SC 1ZGLB 3SCSA 1GVIA 1U8IB 3JWDL 4M7JL 4EANA 3OKYA 4RFOL 3B4NA 4J8RA 5KAQF 4L5FH 4PJXB 5HYIA 3JV0A 1JNDA 1KENH 2XY1A 3FOLB 1LWRA 4G6JL 2XVGA 3GSVB 3VGHA 4NKIL 3FB7B 1KB5H 4P9MH 4MA1C 3UTSA 3PZMA 4AIEA 4EVNA 2Z31A 2ZXAA 1M01A 2I9TB 5FUZH 4KRTA 4M8QB 5C1MB 5B4MD 4UV7L 2FYYB 1AGCA 4O2EB 4KTDL 1MQPA 2XM1A 3Q3GA 3GSWB 1HSAB 3T2NL 1L0PA 3QISA 3RIFK 4PTMA 2F54A 5C0BE 1KJ3H 2HVJB 2JB5H 4Y5VC 1JRHH 1QNOA 3GK8H 2YA2A 2BJML 4OD2A 1W72B 2F15A 4R4FL 1U8PB 3G5YA 4PJCB 5DJDA 1Q9LA 1MI5B 1ZVSA 1RURL 2LAAA 1FNEA 3ARUA 3L5XL 3BP5A 5JW4Q 5T5NG 3G6DL 2X2YA 4KVCL 2DT3A 5DMGC 3BAYA 1A7PL 3WO3B 5MENA 4P3WA 2MMXA 5BRZB 2F58H 3ARGB 4IS6A 2OTWA 1CG9B 3CMJA 4Z95H 3HZYA 1WDQA 3F7YA 3LXBA 4OLVH 1ZGLA 4X5WB 2YPLD 4ZFGH 5IUSA 4FNSA 3VD9A 4OCMC 1IGTB 3VXOB 1KT2A 4K71C 5DR5H 3T77B 3O2WL 3O2VL 4WEMB 3IXTA 4ZUVB 1GOOA 2C8NA 4WUUE 1BP3B 2V5YA 1I85A 3PHSA 3KEHA 4UQ2A 32C2B 2VXTL 3EYSL 4K3EL 4M93C 4RAVA 2R0ZH 2G5RA 1AQKL 2PBOA 3OXRA 3WY3A 5BV7L 2EYRB 1S7SB 5CMAA 3TA9A 1E6ZA 2ZKHL 4KV5E 4GSDL 2R0KH 4MNQE 2R69H 1B3YA 1QQDA 1BQSA 2QLVB 1C92A 1UKTA 1BJ1H 4NFDA 4E41B 3S5ZA 4S2SA 3SDDA 5DS8B 4P4KD 4Z7UF 1YJDL 2E3ZA 1W72H 2YWYA 2W0PA 2NY5C 3FQWB 5DRWB 2VZTA 1G7MB 3AXXA 1A9BA 1MCKA 3GRWH 5I23A 1HHJB 3TV3H 1M7IB 4YC2C 3KNBA 2NZ9D 3WH9A 5HYJD 4HLZG 2XN9B 3C87A 3BHBB 1R3HA 3GMNA 2W66A 1UADC 2EH7H 2BRRL 1H3PL 3UTPD 1QR1A 4P2QD 5GGTH 1UQZA 4QWWD 3GHBL 4W5UA 1EHLH 4NNPL 1C5CL 4S1SL 2J74A 4JDVA 4OM0H 3NZ8B 2DH3A 4QCEA 2XNAB 4XNMB 1D5ZB 1JRHL 2VZUA 3FN9A 4LLQB 4TN9A 2H3NB 2FJFB 5I77A 4JFFD 4NT6B 1BD2A 1D5IH 3N9GL 4OLZH 3B6SA 5LBSL 5DJXA 4EQ3A 3ZTNL 3VD4A 4Q9RH 3MMWA 3PZIA 2JIEA 1KC5H 3QHZH 3MV8A 1BX2B 3GH4A 1ZANL 3FN3A 1EV2E 1S7QB 4MAYD 1D2KA 4I18A 3NIGE 4FXKA 1D5MB 4XWGH 3V4PH 4UT9H 3QIUB 1QSZA 1HHIA 1YEGL 5TJWK 4YX2L 4WO4A 4PRPB 1GZQA 3HZKB 3DXAE 4CN6A 3C09C 4JFSA 4QDMA 3WO4B 1BQHA 4XNXL 4FG6C 4XHQA 2E9BA 1U2HA 3G5VB 4HD9A 1VGKA 2WKLA 3NPSB 1HEZA 2PTTB 1VFUA 1DBBL 5AYQA 4HS3B 4BQ6A 2WV3A 4O02H 2PR4L 1VJSA 5E6IA 1N5AB 1RZGB 2EQDA 3UPAA 2VXTH 3IT8D 4QRRD 2DB8A 2UZYB 1A6VL 3MRNA 4H5SB 5C0AB 1AQKH 4I0PD 2QADB 4KK8C 1VACB 3C08L 3TO4B 3MJ7A 3WIFA 4GSDH 2R0KL 4M3JA 4HQQH 1DUZB 2YUWA 5TDOA 3UTZA 3QHFH 2WVVB 4OOZA 2GEEA 2IAMA 1CU4L 1Q6EA 2XQBL 4O58L 3ZKMC 3CX5J 1E72M 4NT6A 3VFWB 3S34H 2ZOXA 5KSVB 4PRAA 2BSRB 3LVEA 3AIBA 2UY7A 3DV4A 3EJPA 5T3XE 4Z5RB 3IDYC 4HCRA 5F7EL 4MQ7A 5E1AB 1I9EA 3VFUA 5GS0L 2XGIA 2QSVA 1J5OL 3LKQA 3GJFB 5CEZL 5D1QC 4XPGH 4P2YA 2OYLA 3H2WA 2AI0H 5DJXB 4L8CA 1U8MA 3ARVA 2SEBA 1EAPA 2X4UA 3KPPB 1Q9KA 5K9OA 5E0CA 3CPLB 4YBHA 2PO6A 1EHLL 4XT1C 4WW2C 4XX1G 2Y23A 4X9FA 5ERWA 4EI5B 4LLUA 1AI1H 3DNKA 3MLVL 3MKKA 3WHXB 5CZKA 3WELA 2JF1A 3QWOB 1LEIB 2QSQA 1DR9A 1TR1A 4E41A 5D1XD 4KPHL 5FA4B 1NEZG 1VPOL 1T7YA 4DOHE 2X4TA 4H20L 1KC5L 4D72A 4OLXL 1QBMH 3KPOA 5IR1B 1DLHA 3ARGC 2CK2A 1BQLH 2ICCA 3GXDA 2BDNH 3O11B 1IC4H 3BAKA 1RZGA 1OTUC 1CPUA 1MW1A 3AHXA 1LHZA 3TCLA 1ISYA 1ZSDA 3BSZL 4JG0L 5HDBE 1FZMB 5B4MC 4FNTA 1OF2A 4NYLA 5DZOA 1IC1A 1JFQL 1L0XA 5C07E 4PV8B 3O9WC 4Z7VB 1WAWA 2UWEE 3MO4A 2YOCA 4CN4A 1JD7A 4JKWA 4AW7A 3QDMA 2PN5A 1DBBH 2A6IA 3TEUA 5I16A 4XVJL 4NQDB 2AVGA 3MANA 1ULVA 4G9DA 4R4BA 4Z2KA 5EN2B 5ANMA 3QIUA 2RIKA 4C58B 5HDOA 1AJ7H 4C56D 1H8NA 4WTWA 3GMLA 2ZOKB 2AJXL 1P84J 2NY2D 1CDUA 1IC7H 1J0ZA 1FAIH 4DQOL 2PUQT 4HIJA 4YDJB 3FRPA 3L3OB 3VFOA 3N1AA 2YUXA 2YD7A 5C70A 5D2LE 5MERA 2NPLX 3ES6A 1KG0B 4Y0GA 4HHAA 4PBGA 3WBDA 5JNYA 1RK1B 4R8WH 5JDSB 1KPUA 5I75B 4X6DE 2QQNH 3QUZD 3LKSB 2NX5E 3OQ3B 3BLPX 4JFHE 5JDJA 5B38G 5ENWB 5IMMB 1B3JA 3AWGA 1BGXL 3W29A 1T04A 1LD9A 1OWWA 4V1DB 2NY6B 5DT1L 3CFBA 4CVZB 5DJ6A 3HMXA 4LLWA 4PR5A 3O8XC 4WFFD 3U7YH 5IFJB 4JAMA 5F6IC 2A6KA 5CINL 1GHFH 4FZEL 4XPGL 4ODSL 5IQ7H 1YEIL 2VDOH 1IZKA 4WO4C 2APWA 3VXUA 2AJZB 5C8BB 5TE6H 1MLBB 1FZJA 2NZ9C 1X5GA 5F3BA 4GKZB 3H9YA 3DHUA 2DM3A 1IRAY 2FX9L 3VFUB 4F7PB 3D25A 5KVFH 4OZFG 4HUVA 4X80L 3BPNC 5HXMA 4XBGA 2EXOA 3ORJA 1Q1JL 5BCAA 2R8SL 4YIQB 4V2BA 2VDQL 5D4QA 3TTQA 1E40A 4N9GB 5FOBA 4MADA 4L3AA 2M2DA 5KSAD 4TVSa 35C8H 5IVXB 1A5FL 1GGCL 1E4MM 4NBXB 5FYKE 5AEAA 5HYSA 3RVXD 5BS0B 1UR4A 5EZJB 3G08B 4ZS7H 3W81A 3TIEA 5HPMB 3VW3L 2PXYD 1X1NA 5JUVA 1CCZA 1IZJA 5IW3A 4CADA 4GW4B 3IJSA 4JY4B 1RK1A 1RZ7H 3VIPA 2F19H 1FNLA 4XH2B 4NNYB 3RNQA 2R0WL 1EXUA 1B3VA 3NBNA 3AWFA 5F9OL 1F4YL 4OQTH 2XTLA 4HIJB 3WFEH 3CC1A 4TUOB 3T0XA 4M1DL 3FO9A 1F4HA 4YHKL 2C3VA 2FB4H 4NKQB 2VO5A 1HHGB 1D6EB 1R3KA 5C0FA 3WSQH 5DUPL 1T7WA 1YA5A 1Z9SA 2EIEA 3WEZA 5IHRA 2CQVA 1CBVH 5JLZA 3DIFB 2Y7QB 4UFMA 1T21A 1R3LA 4PGBB 3CMOH 2KH2B 1WNOA 1P69B 4JFOB 1GGUA 4PJDE 4OF5A 4B53A 4NQDE 1WFTA 3U7AA 3B2VL 1RZKH 3QGVA 3DVNA 3KLSA 3MV9E 1MWAA 2QQNL 4PMDA 2VN7A 4PLNC 1EJOL 2B2XH 4D8PB 3P11H 1TETL 1B6UA 1BGXH 2XWTA 2DWDA 5ESQB 1L6ZA 2X2HA 4FNPA 2EJ1A 1IEAA 2H8PB 3HB3D 5BXFB 3OKLB 1UB6A 4GRWB 1YEFH 1T1ZA 1NCBL 2FWOA 2WXDM 1Y7VA 4C83A 3VFOB 4HFWB 5E08L 2A6IB 3R0NA 4NKOA 1WQVT 5CEZE 3C60D 1DVFB 3BKJH 5IV2B 5DO2C 3VFNB 3LD8C 2CMRH 2ITDA 4NQEA 5FGCB 3U1SL 2JCCB 5TF1L 1JN6B 4YHZL 2BC4B 2W9EH 2W65A 5JTWA 3ARFA 1NANI 3DMMA 1AHWB 2VXSH 4WI3A 2OSWA 1UACL 4PJAA 4DZ8B 4C56B 5F93C 4M7KL 4P5MB 5AUMA 3GFUA 3MV7E 3O2DH 3BIBX 5JUEL 3VFMA 2XA8L 3MROB 3SCPA 1CXKA 1SEBB 4JCLA 3HNTH 4LXFA 2XWDA 2VDQH 3RUGF 4DN4H 2GK2A 1AO7B 4OGYL 4LCIL 2NSXA 3WY1A 3O8XB 2FH6A 3FQUA 3H3PL 5I73C 2OTPA 4JR9L 4GBXC 1R46A 1QWUA 2NW2A 4UNIA 5J12B 1QTYT 4LPVA 1KCRH 1KGUA 1VA9A 3DXAD 1WPCA 4QO1A 1L9NA 3KXFE 2R0WH 3VGDA 4AD3A 3L7FB 1EO5A 2L4OA 4R97B 3ZSTA 4Q9CA 1RHHA 3DUUB 4P9HL 1QRNE 5SX4H 3DRTA 3BLBA 2BNQD 5I1JL 2CLVA 2XXCB 5ISZE 3U4BH 2PWEA 2UY2A 2FWOB 5ECUA 1LDPH 1KEML 4F7CB 1MFAH 1F11B 1DWGM 2ZOLB 1FG2A 4L3EE 4QLRA 4PV9A 3UJJL 4PRAB 5I6SA 4NN7B 1U3HA 2R1YA 32C2A 4M8UA 1II4E 1XSKA 3LN4B 2JCCA 4NO0D 1ZMYA 1BEYH 3BZDA 1OAKH 3GJFA 3ZE2E 5DJYB 5J4MA 4B41A 1LILA 2HRPL 3EO0B 4NPYA 2JF7A 4OCXL 4PY8J 5C0BA 5DD0L 4HOWA 1KQZA 4EI6A 3E1F1 5TPWL 3CBWA 2ATKA 3Q0HA 4GT7A 5CGTA 4OZIE 4JANA 2RR3A 3BI9X 4YHIB 2X4NB 3MLYH 5E2JA 2HJLB 5CBEA 3RAJH 1FP8A 4OZHF 2IBGA 2V5MA 1G0XA 3JWOL 1YEFL 4RGMC 2HTLD 3EYFA 5GGQL 4JL2A 4XCNA 5F9AC 3N06B 4X7SL 1E9LA 1MVUA 5CEXA 3QI9C 2ZCKL 5L0QC 4D9RE 5B3JE 4XGZA 2AV7B 2P4AB 3NPSC 1MAML 4QLJA 4X7TB 4WI7A 3C6LC 2HVJA 5F7DB 1MCOL 4P3CL 2W9DH 3UAJD 3PWJB 5CD5C 3RRQA 1FNHA 3QG6B 4MCZB 2WB5A 5AD0B 1K9EA 2XA8H 4K2UH 5C0IB 1TZIA 2ZX7A 4RE2A 1I85C 3BO8B 4RWYL 4OD3L 1V02E 5F1KC 1NAML 3O4LA 4Z76B 5JOPD 2JEPA 1JGVL 1FIGH 4KKCC 1UR1A 3INUL 3O45A 1UXWA 3GMQA 2WVUA 4QXTB 4RZCB 1DEDA 3QXAB 3JXAA 4K3GA 3U2SB 1HXMB 2H8PA 3D3VD 1HWWA 4FTVA 3HG1B 1S7QA 5IB3A 5FYJH 1O5DT 3QNXA 4YC2B 3L3IB 4X6DB 1HWHB 1UWEH 5T33H 2EACA 1C12B 1LO2L 4AY1A 4GAJH 1DQJB 3FQNA 1EVUA 4M43L 3K80A 3D0LA 5SWQA 5SV3A 3PP4H 2OQJA 2HG5B 4HWNA 2WWDA 3GNOA 5B8CB 4K7PX 5F70A 3HI5H 2Z9TA 1T1WA 5GRVL 1B30A 1BIIB 4G6MH 1YPZF 3JUYA 1YEDB 1UA7A 5HHMD 2ZUVA 3RWIB 2Q6WA 3O6LL 1OSPL 3UXFA 2HFEB 4JFEB 1VESA 4RFOH 5D7LB 3U4EA 5I1EH 3W0WA 4K68A 1AGEA 1JK8B 1R5WB 4PFEA 5GRUH 3GSOA 1ZLWH 3S9DB 3NACL 4D6DA 2NXZB 5CEXB 4YHPA 3SBWC 1P2CB 1DLFL 3PZGA 2EDHA 3RKPA 3S6CA 5MENB 5CHNA 2WYSA 5A8NA 1T0MB 4J4PD 4PGEB 3V4UH 1AH1A 1CFQB 3FOLA 3T3PE 5K9KB 1BPVA 3MLRL 4AD1A 1JMZA 2JJUA 3KWWB 4UV7H 3LY6A 4R97C 4ZUTB 5ITFB 1KTLB 1QG3A 1E28B 2YA0A 4Q6YA 3OGCA 3KR3L 2ICWJ 2XVNA 1MI5D 1NCNA 4O2EA 3ULVH 1SY6A 4LSVH 1E1FA 2P8MB 4NZJA 4W4OA 4YJZL 2ZCKH 4RFEA 3KJ6L 4QRUB 2ZX6A 4UTAH 1D9KC 5GPRA 1CI5A 4JN2B 1CL7I 5J6HA 1PZ3A 2MSPA 5A6SA 3TVMC 1CG9A 4PJCE 1T89C 3GMLB 3L5XH 2WNGA 5TE4H 5BOPA 3P9LA 1PZUB 4KVCH 5JHDE 7FABL 1WAAF 4KDTC 3GHEL 4M8QA 2WMFA 2VLRB 4LMQE 5ANMB 5T3ZE 3IGAB 2CRMA 2EYSA 1IM9B 4HAFA 5A6AA 1G7IA 2IADA 1IGYB 5A6BD 1CYGA 2W60B 4POYA 2G5BA 2IANB 3FQRA 4BK5A 5H37H 2JALA 3H0TA 1C08A 4IBLT 4Z7WF 3Q1SL 4ODXB 3DX7B 1W32A 1S7TB 1X5LA 1DL7L 2IG2H 4P2QB 2VI0A 1KR0A 4HPGA 1ZHNB 2FZ3B 1U8OB 5DR5L 3OMZA 4QRRE 1P53A 3V5HB 1I1YA 4WI9A 4F7TA 1YC7A 3BCDA 1SJVA 3LB6D 3VDHA 5JBEA 3O0RL 1US3A 2YSSB 1H15A 1P6AB 1KPVA 3H9HA 2NW0A 2I60L 2ADJB 3OG4B 4RQQA 4NWTH 1HX0A 3OJDB 2AAAA 2BOCA 2ZWZA 4HF5L 4TUJA 5HYEA 2P5WB 5E8DL 4GXUM 1J8HD 5GISH 3OKEB 4UR9A 2EEXA 4M9PA 3QQ4A 3QEQD 2GSIB 1JPFB 1UEMA 1T3FA 1AR1C 1ZLVH 3DLQR 5DWUL 2XKSA 3BXNB 1CGWA 1GOKA 4PJHA 5I24A 2BHZA 3DRQB 4Y2DC 4NX0A 2PYFB 5HGAA 1QEWA 3MC0A 2ZUQC 3PF2A 3MA7B 3H8NA 4PJ5B 4Z6AT 4FTVB 2HISA 3WLBB 1KFAL 2P46B 3U5UA 3ZE0F 5BYWA 2XRAH 1RUKH 3C2SA 4MD5B 3MLRH 3LRHA 4OUUA 4MAYC 4KDTA 2PKDA 4E41E 2ICEB 3W9DA 4A4AA 5T5FL 2GIYA 3HLAB 4Y4HC 2H2PD 2F8XC 1OGAE 3WEMA 1QRND 1LO4H 1S9VA 2N7BA 4B0MM 4HS3A 3BP6A 3L3HA 3FY1A 4G42A 4RE3A 1U58A 1C8PA 1ADQL 3MRHB 1A7NH 5IVZB 4F33B 5F7DA 1CFQA 1HP5A 3KS0J 3CIQA 1EVTC 2ZUSA 2OBGA 4KQ3L 1MXDA 1TCRA 5FYKL 1AGBB 4IIQC 3L95A 4MXWH 3ALFA 1QNZH 3Q5OA 1BM3H 1OB1A 1A6UL 1FFOB 3GSOB 4OJFH 4BCEA 1YEGH 1LNUA 4MA7L 2GTZB 5A2JH 1O7SA 2IPTH 2Z1SA 1NARA 3VFRA 1PLGH 4PRHA 1E3ZA 1I1WA 1AXTL 4R3SA 4KJPC 3O41B 5KOVC 4JLRA 3WUWA 1GGIL 3WL0A 1BAFH 3VWKD 3MOQA 1NFDF 2AKRA 2W9LA 4WWKD 4XVUC 8FABB 1EBAA 1WCGA 1J0JA 2FX7H 1GHSA 4UU9B 3TZVC 4U7KA 1UD2A 3GBNH 1OAUL 4W70A 1HEZB 3VNYA 4D9QE 3UO1H 2GITA 2XG9A 3S37X 1N64H 1U8HA 1S3KL 2A0LC 4HIEB 4DGYH 5TGBB 5LCVH 3BP7B 3H7BA 1NUFA 2CBJA 3MOBL 4C83B 1TLKA 1S7RA 3QJFA 4NQCB 1R75A 2JB5L 1P7HL 4LEXH 2VT0A 1XIWC 3QHFL 1AMYA 4G3YL 3QIWA 3TOPA 1G01A 5I30L 4H1LG 3P0GB 5JW3H 5DD6B 2A6JA 2G4FA 1S7WB 3G6JF 1WZ1H 4NC2B 1RURH 5D7SH 1FNGA 3OPZL 6A3HA 1QBAA 2YD6A 4U1LB 2YPLA 3RY6C 4OIIH 1CLVA 1GPFA 4PJIF 3H9HB 1A6TA 2KQMA 4D6HA 1E70M 1NGXB 4DW2H 1EGJH 4YBLC 3ZHDA 3L95B 1BD2D 4GQ9H 3BGMA 3S37H 3MROA 4AZGA 5KSUA 2X4OA 3DYOA 2ITCA 4LFHD 5I1GL 2DLEA 1R3IH 2B4CL 2VXUH 5GZND 3OF6A 4JO2L 2XRAL 3MV8D 4IPLA 4Z2JA 1HYRC