2FHBA

Crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltose
Total Genus 340
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
340
sequence length
1052
structure length
1052
Chain Sequence
DVVVRLPDVAVPGEAVQASARQAVIHLVDIAGITSSTPADYATKNLYLWNNETCDALSAPVADWNDVSTTPTGSDKYGPYWVIPLTKESGCINVIVRDGTNKLIDSDLRVSFSDFTDRTVSVIAGNSAVYDSRADAFRAAFGVALADAHWVDKTTLLWPGGENKPIVRLYYSHSSKVAADSNGEFSDKYVKLTPTTVNQQVSMRFPHLASYPAFKLPDDVNVDELLQGETVAIAAESDGILSSATQVQTAGVLDDTYAAAAEALSYGAQLTDSGVTFRVWAPTAQQVELVIYSADKKVIASHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPEGWDGLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAQESNMVQHLKQLSASGVTHIELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLTQLKQNDSKDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMLYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDAVRGGGPFDSGDALRQNQGVGSGAGVLPNELTTLSDDQARHLADLTRLGMAGNLADFVLIDKDGAVKRGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRSSDDGSNYDIIARVKDAVATPGETELKQMTAFYQELTALRKSSPLFTLGDGATVMKRVDFRNTGADQQTGLLVMTIDDGMQAGASLDSRVDGIVVAINAAPESRTLQDFAGTSLQLSAIQQAAGDRSLASGVQVAADGSVTLPAWSVAVLELPQGESQGAGLPVSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords pullulanase
publication title Crystal structure of pullulanase: evidence for parallel binding of oligosaccharides in the active site
pubmed doi rcsb
total genus 340
structure length 1052
sequence length 1052
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2005-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fhbA03
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2fhbA01
2.60.40.1130 Mainly Beta Sandwich Immunoglobulin-like Rab geranylgeranyltransferase alpha-subunit, insert domain 2fhbA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fhbA05
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2fhbA04
4JQIH 5BV7B 5DJXB 4IDJH 3CZFB 2HAZA 3UTZB 2R23B 2WANA 4PMYA 1X3DA 1NBYB 1S5HB 3NFSL 3QUYB 4L8CA 1NCNA 4NCDA 4Y5XB 4WUUD 1EBAA 2ZXDA 3MLUL 1QNZH 3B8YA 4D6HA 1R85A 2NX5D 3QISA 3S3PA 2VZ3A 3ALFA 3BMVA 2XG4A 3LAFA 2WUBH 3R1GH 1XGPB 3D3VD 4LPWA 2WUCL 1A4KB 4P4RB 1N0XL 4WFHE 3RL2B 2GFBB 3VGDA 1JPFB 1IAII 5CILH 4C56D 3ARVA 4H8UA 1DBMH 1KTBA 1YECH 4NC0B 1TVNA 1KBKA 3EBVA 3LRSB 2ID5A 3REWA 3NCYS 3X11A 2C1PA 4KKNA 3GGWA 5JXAL 1CGUA 1VGEL 5DUML 3QQ3B 5HYFA 2Q86A 5KBNC 3SGDH 1NPUA 5HD8C 3GXFA 4PBGA 2VSCA 3IKCA 5E8DL 1HKLH 3FT3A 4ALAH 1DVFB 1FH5H 3CPLA 4MJ2A 1R87A 2D31A 2NY7L 3V5DB 5JIPA 1ZGLA 1MHPH 3BUIA 3EHBC 2YDSA 4KJQD 1OGTB 1BFVL 1C8QA 3U7BA 1P7KB 3EYUH 3WHE1 3SUTA 1VB9A 3U46B 1EEZB 3GIVA 4UAOB 1VBRA 5E99H 2H32H 2IXVA 3D39A 4XWGL 3UJIL 1OPGL 4WV1A 3PL6B 3DI3B 3QG6A 4TSCH 5F1OB 2VQTA 3UCQA 1WZ1L 4HIHB 1BD2B 1N59A 1NGZB 4JDTH 5DMYA 1U30A 4AT6A 4RAHA 1ITBB 1X4XA 3KPQA 3JV4A 1JWUB 3JWDC 4M1GL 5E70A 4LCCA 1KFAL 3IGAA 3C6SA 4X4MA 5C92A 2AK1L 3VIOA 2BX5A 4IPNB 3P9MA 3VFOA 3I50H 4P3CL 2E6PA 2NXYD 4X9BA 15C8H 1W3JA 1GZPB 5ICYB 4JN2B 1YYLH 4I3SL 1KJVA 4JFFB 3CDGB 2D4DA 3D48R 5FYLD 2C7UA 3NCFB 3RIFF 3X3GL 5BXTA 5K33A 3QDGA 4TN9A 3UG4A 4NM4L 5TE6L 5E8OB 5FFLA 1J18A 1C5CL 4QWWC 2B5IB 2ITDB 5I9QC 1SJXA 5ABFA 4DZ8B 5L88H 4UT6H 4NWUH 3M1BA 4C59B 4NHUB 4XZBA 4FQXD 3V0IA 4ZE5A 5JHLH 2UWEE 5AD0B 3V6OC 1HXYB 5EOTA 4P57B 2R4RH 3RVVD 5H2BA 1NGWA 2CXGA 1HQRA 1U36A 5C9KA 3RWHB 5I8OH 3T77B 2RAMA 3OR6A 2XWEA 2AEPL 3RPKA 5D8JL 4LPYA 2XWJB 4D0DA 2PN5A 2R2HB 2YD1A 4KY1L 5DXWA 1CK0L 4LVHC 4Y4KC 5FO9A 5DQDH 1J1PH 5FIEA 1FHGA 1OARL 3NCYP 1G7JA 1XC6A 3SY0B 5T1LA 1KCRL 3VFWB 1VPOL 5M03A 4OFPA 1SYTA 1EFXD 3N18A 2ZSWB 5LAXB 2V2TA 5J6HB 3DXAD 3FFDB 1XH0A 3VXSE 3ROOB 5FKAB 4KI5C 4PJ5B 1DWGM 1LK2B 3WIFB 2OX5A 5CEZE 5T1KA 1D5BA 4LK4A 2YA2A 4OLUL 3T3ME 4P99A 4FXGA 5IHRA 3O6LL 1T7XA 3QZWA 5F7DB 5CGTA 3K8KA 5GHWH 4PYSA 2YUWA 2C26A 3QRGH 3OHXA 5DD3L 3T4YA 3UP1A 1K8IB 3QSKB 2VXVH 3L9RB 4V2BA 3CDFA 4LLUA 3O6FB 4XVUC 3MNVA 1YEEH 3RA7H 3GO1H 1PGRB 2CITA 1TVHA 1HHJA 4XP6L 4KAQL 1KB5H 1H3XA 1J0ZA 1UJ3B 3QFJB 2QQNL 4X7FC 1WSST 5JBDA 5D9NA 1P4LB 2Q8AH 2YFOA 1MHCA 3BEVB 4ODWB 3UESA 4HULB 2DWEA 3FONB 4O9HL 3QCUH 2EDFA 2O5ZH 1NP0A 3GNOA 4RGNB 3WFHA 4PYGA 4BQ5A 4WUKH 1RK0A 2G60L 4JO2H 2DT2A 3IDXH 3THDA 1WAAF 2OCFD 5EU6E 1YDPA 1XF3A 5DJYA 4RFEB 4DGYH 2J7EA 3C5JA 5I75B 1YJDH 2XACC 5EDXA 2JALA 3N15A 3H9SA 2HRLA 2YXFA 3C60A 1AJ7H 3HMWH 3KPTA 4P23B 4P2OD 3SCQA 3VDAA 1GPOH 1QD0A 5T5FH 3FFCB 2HJFB 4PJCE 32C2A 3DGGA 4JKPH 3RAJH 3CLFH 2AV1A 4OAWA 1FH7A 4YDJA 3SDAA 2D0FA 5JW3L 5E1HB 3MLRL 1VKXA 2EXWD 2ZPKH 5BRQA 2EH7H 1NFIA 4W85A 1EPFA 4F8QA 3BKJL 5D8ZA 5EA0H 1F4WH 1FNEA 1UJTA 1XCXA 1NCWH 1RZFL 4K9EH 2XN0A 4MB4A 3BKYL 3IAPA 3V79C 3DVIA 3MO1B 2WVTA 4R4FL 1L0PA 3GXNA 1HP5A 4POYA 2DQCH 2CRYA 2QHAA 4WGVB 5IB1B 3B2VH 3PGDB 4MA8L 4O5LL 3DURA 4MJ6B 1HOCA 3HZYA 2EDTA 4B9YA 2BJMH 4Q6IC 1V02E 1YY9C 1G5AA 3IFOB 1FYTB 3ZTJH 3W26A 3GSRB 1XIWB 2YSSB 3UTTE 3MXWH 5E94B 1PKQB 2FX7L 3NBNA 1DBAH 3E2HC 1KELH 2OTWA 5TGBA 3PWPE 1FFOA 5KSBA 1WWWX 4NKDB 3F6LA 3RVTD 2WNWA 4ZG1A 3V4UH 2XZQH 3TPUB 5DMIL 4X9GA 4NQCE 4EBQH 2R2BB 1E40A 3ZTNL 3BSGA 2W9EH 3E0GA 3IXTA 1RHHA 3MGTA 4V1DD 1A6ZB 1XGTB 5LGJA 1MW2A 3FKUS 4PJGE 1FNAA 4MGXA 3MRQA 3MOAL 4B0MM 3P4MA 1QSEA 5CEZD 5CMAB 1KJ3H 3VUPA 3RFZC 4Z2KA 1EOMA 3GMMA 1MRDL 1MFAL 4C83A 2I9TA 4NN5C 2OL3H 1U3HD 1CEOA 3QQ4B 1MJ8H 1P7QB 1RK1B 2BSRA 2J4WH 1IAKB 4LLMB 4LNRA 3SEPA 1BYCA 3MRJB 2Z4QB 2A77L 1PX8A 3SKNB 5B39A 3GSVB 1MFNA 2E7LA 5IV2A 4M29A 4MQXC 1FVEA 2D9CA 1P84K 4JFVA 1ZT7A 4J3OC 5KOVC 4R96B 4OCLC 3VI3F 1SJHA 1FAIL 5GISH 4Z7UA 3V5HA 4NRYA 3CZKA 1GOKA 2AXFA 3FQXB 3ESVF 4XRCA 3SGEI 4C55A 3GMLB 2C3VA 3ALGA 1ZHKA 3MREA 4NQUA 4L4TE 3DUSA 1EFQA 3TH2T 5J12B 3JWDL 5EU6D 2JB5L 4AYFA 4J1UA 4OTXL 5E8PA 1MFDL 4PJ7E 2NR6D 2DDQH 3NA9L 5INCB 4RAVB 3UBXI 2DL9A 3TCXA 1KIRB 1DBKH 1TMCB 4QLKA 4ONGH 5L0QB 3QULB 3MGOA 3U1SL 4LHUA 5D72L 3UTSB 2X4QB 4OGXL 4HS8L 4NNPL 4R9HA 4OD3L 2X89D 2Y8KA 3GKWL 4U1SA 1RZKH 4QT5B 4QTIL 1F4AA 5GXBB 4H1LA 1TQTA 5B39G 3QUML 4NN6B 1JZ2A 1EHLL 3UTQA 2GJJA 4JQVC 5I1HH 3VXOA 3WO4C 2XIDA 3ZDXE 4L8CB 4UT9L 5DD0H 3RI5K 5E4IA 4JFEA 2AAAA 4POUB 4LDLB 4A3YA 2JTDA 5BMFH 4F15C 3RVUD 4XB8A 4NO3B 2KL6A 1IL1A 4JFPA 3OKKA 3NIGF 3N17A 3MA9L 3S4SA 3SDDC 1JWMA 4PD4J 3L4XA 3TO4A 4PUDA 3QUKA 4YPJA 4DAGL 1QUNA 4XPAH 4ZXBA 4B5EA 3CUFA 5L2KD 4PGBA 3UTTD 2J71A 4Z7WA 3REWB 1E4WL 4XMLL 1RULH 4LHUG 2C1PB 1JPGA 2IFGA 3C6LD 3GGWB 4N8VA 4HCRH 4RGOL 4WRLA 1ACYL 1I8MA 2B4CL 5F6HI 2ESVD 2Q86B 4PP1C 1V6YA 5CLTA 2WVSA 5CJXA 4KVCL 4H1LG 4KGLA 3SE8H 4WUUA 3CBWA 3IKCB 3BPNB 1W9XA 3FT3B 2ZE0A 2D7PA 5D9OA 3CPLB 1C08A 4EXKA 2HJKA 3QP3A 2D31B 4PMRA 1A6AA 1T80A 2NX5A 4MXQD 4K7PH 5JOEA 1BQLH 1ZGLB 1G6RL 2R0KL 3CH9A 3D3VA 3NIFF 1DL7L 5SX4I 3I3BA 4LL9A 3HNSL 2BSTA 1P5UA 2A9ML 3GIVB 4J4PD 5DUBA 3MRRB 4TOYL 5GZNC 2ED8A 3S4SG 5C6TH 3EJYC 3MGAA 3FAWA 3D39B 3K1DA 3WIJA 3VRIA 3MRPA 3CO4A 2YPLE 2IUZA 4WV1B 5FYJU 2ICWI 4GRLC 3OWEA 3QG6B 2J7HA 1BBDH 1JE6A 3C8HA 4JVUA 4XNYL 5DF0A 4Y0GA 3HRZA 1N59B 3QG7H 3BDYL 5GJTL 4LGXA 1LO4L 4AT6B 5CEYA 1D2KA 3KPQB 3HG1E 1IC4H 3JV4B 1DWJM 2XN9D 4LCCB 2M26A 1J1OL 1TZHA 3IGAB 3C6SB 3T0AA 4ZPTA 4QHLA 2VRKA 4W6WB 3P9MB 3VFOB 3VCLA 1HVQA 1LDPL 5HPMA 4L4TD 1W1TA 2CESA 1YEJL 4IRJD 5HYJD 5D9MA 2E9IA 4APQC 5DVLA 1JFXA 3AMGA 2IAMD 2Z8RA 2CKBH 1X5XA 4G8GD 4PJIE 3EO9L 3FN3A 4YDLC 4WY7L 3VIFA 1C8YA 2C7UB 1NBVL 5BXSA 2JCCA 3QDGB 4XP9L 1B2YA 4GAYA 3OAZK 2LE9A 5BZDA 2FX8H 3FJTA 1KXVC 4N0UA 5HVHB 2H1PH 4GKOA 2NW0A 2VL5A 3W27A 5ABFB 5DMGC 3BKML 1KN2H 3RCNA 4FLRA 2B1AL 1UXWA 3M1BB 2W1NA 4U2YA 2ZIDA 5E8NA 4H8WL 4WCYH 1J9CT 1V6XA 3QXWA 2VMFA 1AHWB 5EOTB 1JZ4A 5H2BB 1LE5A 4XX6A 1NGWB 1HQRB 2EE9A 1FLRH 1MW0A 2ICEA 3OR6B 3D4ZA 2R0ZL 1VCAA 1EVTC 5FO9B 5F70A 3WENA 5I23A 2CDEA 2VAAA 4U33A 4Q97A 1IKNA 4S1QL 1G7JB 1MCPH 1SHMA 5CUSL 5T1LB 4MCZA 3LQAC 3CUJA 5HGBA 5ABDE 5HDOA 4X5WA 5I15H 5ECUA 4NQVA 2V2TB 1PY4A 4M82A 3FOMA 4BA8A 1YEKH 3JUZA 1ACZA 4CBPA 2FHFA 1T7VA 3F62A 2FBJL 1H8OA 5T1KB 1D5BB 2KUTA 1PIFA 4FXGB 3QZWB 5KOMC 4FQXA 1OCWL 3FRUA 4J3WA 4FF5A 2B0SH 4KQ4H 5KVDH 1WIPA 3OHXB 4FQCH 3T4YB 5I6XC 2MJWA 4HKXA 2NY1D 4XXDA 3IFNL 3EFDL 4IOSD 4BQ9A 4LLUB 4ZAKC 4P5KA 3MNVB 3SQOL 3A6CH 1TR1A 2MMXA 4YBHA 1TVHB 1WDPA 5EOCJ 1HHJB 3LB6C 1RI8A 2YC1A 2DBLL 2J5LB 4X6EA 4UFJA 3RRQA 1MEXL 4NGHL 2HTKC 5HSFA 4JR9H 3ULVC 2DWEB 3DXAA 3RP1A 3MCLL 3PZVA 4TNWF 2X1QA 3WFHB 5FUZH 2H3NA 1XGYH 1RK0B 3MJ7A 5DJ0B 4XVSL 1YDPB 1XF3B 5DJYB 1FNLA 3C5JB 1Z9OA 1CZ8H 3H9SB 2DQUL 1YQVH 3C60B 4OCXH 3H54A 4HK3J 2HKHH 1KEML 1N5AA 2YZ8A 1Z6JT 3DGGB 4WEUD 1X7QA 2AV1B 4OAWB 3CLEH 4YDJB 4TTUA 4NZTH 3SDAB 3MUZ1 1JMZA 3RWJA 1VKXB 4NO0D 1NFIB 4OLVH 4LPVA 1E4NA 4F7TA 4ZS7L 2KQMA 4LSPL 1I7RA 2WC3A 1JPST 5IESL 4Y88A 3LHPL 2CLRA 2PXYD 2X2YA 4HHAA 4DOHB 1MJUL 5DQJA 1KCUL 4GRWB 2NY4C 4F7PA 3OPZH 5DUPH 2N7AA 1LJYA 2DSKA 4QRPE 1ERNA 4MZ3A 4BH8B 4Z2LA 4AMWA 3M17A 3LPPA 3DURB 1HOCB 2JE8A 3GSUA 2QADB 3HZYB 3QUZA 2Y24A 1L6XA 1JV5A 4HJJH 2ZNWA 3LZFL 4ZEPA 1PLGL 1UGNA 4XP4H 4HXBH 4M1CC 2OTWB 5TGBB 5CXPA 1AE6L 1FFOB 4M6ML 5DC9B 5KSBB 3IYLW 3SKUD 4L8SC 5I8KH 3GI9L 4AMKL 3BZEA 1AR2A 4NUJA 2ZUNA 1MFBH 3OB0K 1B4RA 4N0YH 3MCKA 5IB5A 1TQVA 4BH7B 1N6QH 1TLKA 1LLOA 1LEGA 3IXTB 3WDJA 2YL9A 1RHHB 5I1IL 3MGTB 4W6XB 1R5WA 5LGJB 3MRQB 2FO4A 1LO0H 2AJXL 1NP2A 3P4MB 4UV7H 1QSEB 1X5GA 5T3ZD 3QJHA 3VX0A 2DKSA 2CK0L 4M81A 2IG2L 3QCVL 3GMMB 4R8WL 2UWEA 4C83B 2I9TB 4E4PA 3QR2A 2BSRB 4LNRB 3QO0A 1A2YA 1J1XL 1G7HA 4UDUA 4FNTA 3KJ6H 4DGIH 3QDJE 5B39B 4BQ8A 5MHSE 5I19H 5HTSA 4Q0XH 2C4FU 3STBA 2X1XR 5IV2B 3MBED 3B9KD 2C9AA 3SDCC 1DQMH 1FVEB 3GMOA 2Q7YA 5E2WL 3VD3A 2ATPA 1ZT7B 2BRRL 4D6EA 3H8NA 1SJHB 4YDIH 4BK4A 4KKAC 4Z7UB 3V5HB 3SCWA 2X9YA 5FL0A 4NRYB 4UT7H 5GNXA 2JJTC 3VXSA 2C3HA 1Q8MA 2AXFB 4XRCB 5JIHA 2X42A 2MPAL 3GRWH 2C3VB 1ZHKB 3MREB 1CTNA 1UM4H 2J8OA 2F74A 1KYOJ 3DUSB 1NCDH 3GHEH 1Q4NX 1J0HA 1UQZA 4J1UB 5ALBH 5E8PB 2XFXA 3M07A 4AG4H 3BPLB 3RX7A 4BZ2H 5L2JA 1AFVL 4E8DA 1IKFL 4MD0A 1N5YL 3MGOB 1EMTH 5IFJA 3W29A 2E9WA 4LHUB 1MCBA 4DO4A 5I1KH 7TAAA 1X9QA 2XA3A 3A6BL 3OB0H 2GIYA 5HDLA 3NMEA 2ZCKL 3PXJA 4KRLB 3ARUA 1UR0A 4U1SB 3EDJA 4ETQA 5JPNA 3V0EA 4H1LB 4H26A 2EPOA 1TVPA 3UTQB 4UILL 1UD8A 3VXOB 3X3FH 4XUYA 1MCKA 4XAKD 4U0RC 1KULA 5I1DA 2OYMA 4CVWA 4F57L 1P6AB 2BVQA 2DTSA 4KK5D 4JFEB 2DLFH 2VDNL 1VFOA 1MI5E 4QY8A 1QFPA 3D5OF 2DDXA 2BSED 4ATWA 4GW1A 4Q9CA 1IL1B 3OGCA 4JFPB 3OKKB 5EU6A 5EBMA 1G6RA 4ZUWA 1N7MH 4CNIA 3CZSA 3O9NA 1X5HA 3S4SB 4QRPD 1R24A 2UY3A 1T20A 1JWMB 2NY3B 1BG4A 4IOFD 4GAFB 2A1WH 4L4VE 3TO4B 3QUKB 4ZXBB 5A6AA 1UWUA 5C2BH 2X89A 1NBZA 3NDYA 1P5VA 3LQAL 4PGBB 2QQQA 4Z7WB 4BUHA 3TVMC 3I2CL 3GK8L 4M6NH 1JPGB 4N8VB 4ELKA 5KVMC 3VGFA 5E2TH 1IQWH 1I8MB 2Y6SC 3ZT6A 3OF6D 3RNKB 2HLFD 4WUUB 5CEXA 1S5IH 1CDJA 4HQQH 4N1CA 1UWTA 5C0AE 5HNNA 3UPAA 1C08B 2HJKB 1EO7A 1KJ2L 4TPRL 1FDLL 1A6AB 2NX5B 3VW3H 2XV6B 1LNUA 2E8YA 1GVYA 3KZSA 1Q6DA 3D3VB 3BLKA 4P4KD 4OV5A 4LVNB 1AQ0A 2ZUVA 1BEYL 2BSTB 2EXYD 4GBXD 5DUBB 2NSXA 5EUKA 5J57B 1V02A 2XHYA 3WQ5A 4RMRA 3ET9F 3VRIB 1KJMA 3MRPB 3UTTA 4GINA 3IDJA 3QDJD 1I1RA 2J75A 1W8OA 4OT1H 5CZXD 3C6LA 2P42B 4TVPD 3SKMA 1KLGA 1S7XA 3PWPA 3ULVL 5GGQH 3GM0A 1UC6A 1TNMA 3RY4A 5CSBA 1IGJA 4HAGA 4FG6C 3MLXH 1GSMA 4NQCA 1C91A 4KKLD 3MX0A 5CEYB 3ZR6A 1W9DM 4DTGL 5EUOB 2AOSA 2EIZA 2V3DA 3WEMA 1TZHB 2J73A 1CLZH 2Z92A 4ZPTB 4HJGA 4QHLB 2P7TA 3RWIA 5EWIH 2ZX6A 4ZFOA 3HFMH 3QI9C 3D85D 3SE9H 3VCLB 3T0WA 1DEEA 5HPMB 4GKSA 3WDPP 1BQCA 1WNOA 1ZLVH 3V0VA 3W81A 4J4PA 3CZEA 5DEZA 1EK3A 2N56A 2XY2A 2JCCB 2EADA 3WY2A 3HE6D 4JPIA 3MV11 4GAYB 3OGSA 5BZDB 2ZUMA 3QH3A 2J79A 1L7IH 4N0UB 3QPQD 2K3TA 2VL5B 4MPKA 4NQDD 1D5IL 1R33A 5FB8A 2OZ4H 3IAGC 2XZCH 5MENE 1HYRC 1UXWB 4Z7VE 3NABH 4ISVA 4YHZH 4NN7C 5E8NB 3CPUA 4EUPA 5KSVA 2XN9A 1KTKE 2J8UE 1LE5B 4M7KH 1XGZA 1E6RA 2ICEB 4MNKA 4UTBL 3ZKMD 5DR5L 2QKIA 5E9DD 4UTAH 4NKQB 3WXVL 4L4TA 3QO1A 4IRJA 5CD3A 1HI6A 2NXYB 3D25A 1UM6L 2IAMA 3AM8A 2VAAB 4JHOA 5FUCC 4G8GA 1CU4L 4PJ7A 2VVNA 1JTPA 5JMRA 2CKNA 2XGBA 3L5IA 4MCZB 4HOZA 3CVHH 3O9WC 4HLZG 5HGBB 2JEQA 4GS7C 2J47A 4W7VA 2E27H 4X5WB 2AP2A 4NQVB 3G5VA 4OF7A 4D6GA 3FOMB 4XNXH 4A6YL 4Z7NE 2WCGA 4MMZC 4X5LA 1US2A 1YPZA 2F7OA 1E6SM 5DK0A 1IC5L 5KSAC 3AROA 3SGKC 1G6VK 4OLZL 4FQXB 3FRUB 2J43A 4ZO9A 4KK9C 4PJDA 4RWYH 3MV8E 4DWSA 1JUFA 4HKXB 4XXDB 1JGVH 4ZOCA 1KXHA 4WJ5A 5A8QA 5JIKA 1G9HA 4Q7NA 4XBGA 3KYNA 1QBLL 5C0AD 1I1AD 4P5KB 3DYPA 1W72H 4W8LA 1HZHL 4PFEA 4PMVA 4FQIL 1GOFA 3KNBA 2YC1B 1CDIA 4X6EB 4Y7MA 4O51A 3VMNA 5IMMA 2W91A 2OR7A 5DD5H 3EYSH 3LQZA 3DXAB 3ARBD 3ZYIA 4AWEA 2EDLA 4TUFA 4OBRA 1FA2A 2H3NB 5FIPA 5DO2D 1QFWM 1NEZA 3MJ7B 1QNSA 2Y72A 4NSKA 2AI0L 1EAPA 1MQQA 3MODH 1CR9H 1C5BH 2WMJA 2JJUA 1N5AB 2WW8A 1HE7A 5HXMA 1F00I 1X7QB 5I2IA 1AKJB 4G80A 3QEUA 2VUYA 1R0AH 3RWJB 3L3DA 3ARYA 4WKHA 2DMKA 3K2UL 4ODBD 4HOXA 1CDBA 2GDUA 2X9WA 4F7TB 2FJHA 1RZGA 1CFVL 5M95B 1R3LA 1I7RB 2XTLA 3U5UA 1EGZA 2CLRB 5L9DL 1UA6H 1KGCE 4HHAB 2YPLA 2F8QA 5ETUA 3O8XD 3GKZA 4F7PB 2F1BA 1KB9K 5H37H 2UY5A 1MF2L 2R4SL 1A7NL 2XQBH 4FQLH 3FRPA 5D93B 1F02I 3QPXL 1NEZG 3M17B 3CGTA 3AISA 3GSUB 4MNGE 3QUZB 4PLKC 1X5AA 3OX8A 4D8PA 5JOPE 1KBGH 5GRYA 2HN7A 1YC7A 4UQ2A 4P7QA 4M93B 5E5MA 4BFGA 1PX4A 3BRDA 1MVYA 5DZLA 3EZJB 4NCC2 3OAUH 4Y7EA 4PJIA 3FQNA 4W4NA 4YHIA 3BZEB 1HCFX 1QFWH 4NUJB 3WD5L 1T5WA 3WD4A 5HHXL 3SURA 3MCKB 1T0MA 2D1ZA 3NCJH 4D3CL 5IB5B 2PXYA 3BVTA 3OJDA 3TIDA 1LEGB 4IRZH 4F7MA 3EOTL 3CXHJ 3U30C 1R5WB 1BFSA 3AUVA 2E4TA 2FO4B 1KNOA 4XPHH 5CJ8A 5EIIA 1IAIM 4KZEL 3QJHB 4CN4A 3NH7H 1B4JL 2UWEB 3CX2A 1QBBA 3MV8D 1H0IA 3FRPG 4JHAH 5A2FA 4G42A 1EXPA 3QO0B 1A2YB 4UDUB 1G7HB 3F7VA 1D5ZA 2IQ9H 2UZXB 4LSUH 4XBEL 1UD6A 1RZJC 1XR9A 3EAKA 5GGTA 2IANE 1LP9E 4U1HA 2A83A 5I0DA 4MQ7A 4YAQA 3GMOB 2Q7YB 4UIKH 1ITXA 1OP9A 2ATPB 1ULVA 4KHTL 2MFNA 5E08H 6FABL 3KYKH 3BE1H 1CXHA 3BCDA 1QHZA 4DKFH 3VXSB 4Z0XA 4TUKL 2DTMH 2DQEH 1A4JA 3QDHA 4UQBA 4OZFH 3V6FA 3PP4L 4HU0A 2F74B 1V0MA 2VOTA 4WK9A 4YHKL 1UZ6E 1N6UA 5A2AA 2XFXB 1HEZA 5GRUL 3RZWA 2O5YH 2WV3A 2BP3A 4D9RE 2WBJA 2D0GA 5L2JB 1HJUA 3KE0A 3ZQ9A 2FIKA 1RURH 5IFJB 3RJXA 2XN1A 1SBSH 1OD9A 3MBEA 4HIIA 3B9KA 5C6WH 4F9JA 5DZOA 4ETQB 5JPNB 3OLDA 4H26B 3U4BL 5C0RL 4YLQT 5GS1A 5C8BB 3WQ4A 4YIQA 5I1DB 4OQTL 3BSZH 3BUQA 2BVQB 1EHNA 1AO7E 1IAIH 4YPGA 3GHBH 4QY8B 5FM4A 2NY0D 3V0GA 4XVJH 1KGCD 4NZRL 3LMYA 4LNVA 4GW1B 5EU6B 3OGCB 2W59A 3CFJA 4BFEA 5EBMB 1F42A 1G6RB 1PBYA 2EAEA 4ZUWB 4I2XE 4M1DL 3UYRL 4CNIB 4G3YL 3IDGA 4MNHA 4OD2A 1C92A 4HZ7A 5TE7H 1R24B 1T20B 3IDYB 5A2IH 5HI5C 5FA4A 3FXYA 4I0PC 3QIUC 4X0KA 4TVPH 2CPCA 1QBMH 2D0HA 3ULUE 1NBZB 3MOBH 1C8XA 4JANA 3X14A 4AD2A 1D7FA 2OR9H 4DGVH 1WIOA 3WJLC 1NGPL 3SOBL 4ELKB 4Z8FH 2V7NA 1GJWA 4O2FB 4KU1A 2XIBA 3MLVL 5TFSH 3U9PH 5CEXB 3I3EA 5A1AA 4WI5A 5IBTL 1UYQA 3S36X 1NCBL 1T89A 4AIUA 5E2JA 1UYWL 3IRZA 1LNUB 4JFQA 4OM0L 5KSBF 4QRPA 1NDMA 3KPMA 3MLSL 5B3JE 4HMCA 4OV5B 3VILA 5EUKB 4NF7A 5EPMA 4YHNA 4KTEH 4ODTL 1R5VA 1UWSA 2WMHA 4MSWA 1KJMB 3E3QE 3UTTB 1T5XA 3IDJB 1XV8A 2B20A 3C6LB 1KWKA 3SKMB 1KLGB 3PWPB 3W6MA 4H0IA 1QI0A 4NNYA 3VGAB 3KXFD 2Y07L 3MV7D 5D7SH 1CD1A 1IGJB 3ZDYE 4NQCB 1O6IA 3EO1A 3B9EA 1CDCA 5M94B 2FB4L 5HYSG 3QNZA 1HN1A 2VZSA 2EIZB 2VB5A 4F37K 1CLOL 1TZGL 2Z92B 4HJGB 2P7TB 3RWIB 4ZFOB 3N9KA 4Z95H 1DEEB 4K8RL 1CS6A 4GKSB 4J27A 1ZV5A 4OKDA 4P4KA 3WFCH 5CS7A 2ZX5A 3V0VB 1ISVA 4JB9H 5ILTH 2K7PA 5EB8A 3U7YH 4Z7UF 4D9RD 1A6WL 1DE4A 4WI2A 4JPIB 4A6YA 3IT8D 3QDJA 5CJOH 5CPTA 4XHJD 4DVRL 3QH3B 1J5OL 1VF8A 4K3JH 1QVBA 2GITA 4UIMA 1DQLH 3AS1A 5FB8B 2AQ3A 4NC1E 4J6RH 4BSWA 1H9VA 4HMDA 1NUFA 1Z3GL 4TRPH 1CXFA 2FL5A 4G6ML 4ISVB 3ZKQD 5HVWA 4WI3A 4EUPB 5D2LE 5KSVB 1U6AL 2D3VA 4HUWA 1HYSC 2XN9B 1YNKL 4M5YL 2DAVA 4YC2B 1S9XA 4EKXA 5ID1A 4XI5C 1UWGL 4QYOA 3QHNA 1W1VA 5LGKA 4L4TB 2A38A 3OJMB 2ED9A 4IRJB 1HI6B 3D25B 5CD3B 4XC3L 4NFBA 3AGVA 1M4KA 4G8GB 4PJ7B 4QXGL 5SWZD 1BG9A 4NYLA 1HINL 5BQ7A 4DVBA 1NFDE 3T2NL 3UJTH 5D4YA 3MA7A 4HWBH 3M8OL 3HE6A 1UA3A 1SZNA 5KTEL 3G5VB 4MDOA 1LILA 3N85L 4NQDA 3PWUA 3B8SA 1YPZB 4B16A 4ZTOH 3TYGL 2VDML 4PREA 2EDOA 4JFHE 3S37X 3RIKA 4RRPA 3X17A 1G7IA 1T1WA 4YE4L 4PJDB 4DWSB 3U2SA 1FO0H 1JUFB 1QQDA 4NFCA 5DLML 1QHPA 4P9ML 4WJ5B 1MI5A 3WL1A 4XBGB 5AAWA 5E9DA 2W63A 3UG5A 2R8SH 4U1NA 4XPGL 1E6QM 3D52A 2ZCHL 1YZZA 3DO3A 4HBCL 1H3VA 1D5XA 4UZSA 3KNBB 2I60H 4W89A 3SCNA 1ZVHA 1IGCH 4O51B 2OM5A 4M7LH 5IMMB 3ARPA 4MAYC 3LQZB 4L4VA 2VABA 1F90L 2YD5A 3IAQA 2DM7A 5FCSH 2AGJL 5FYJH 1A3LL 4L3CA 3RWEB 3SJVE 1KXQE 2FHBA 3VFVA 1WDQA 4M80A 1NEZB 1JYXA 4DWHA 3CDCA 4NSKB 3DETD 3CHEA 1EAPB 5LCVH 1TA3A 1GC1C 5HD8D 4O58L 4MD4A 4PMNA 4N5EC 5C0AA 3H9YA 3KR3H 1I1AA 3QUXC 3PV6A 5AYUH 5KVGH 4OFKA 3ALXA 5HI4C 5I2IB 4M5ZL 1C1EH 1PEZA 2AK4D 4G80B 5TF1L 3QEUB 5DT1H 4U3XA 1I1XA 3EHBD 3RILA 3DRTA 2MQ3A 1ADQA 3RZCD 1YEHH 2G41A 2FJHB 1RZGB 2ZX7A 1R3LB 3HKFA 4B15A 1U2YA 3DV6A 1RFDL 5LQBL 1ZHNA 1ZT4A 3KLAA 3F58L 2YPLB 2NQCA 2YUXA 5ETUB 1N4XL 3CSBA 3ULUL 2E9MA 3IKKA 5SWSE 4MXVF 3LPGA 5ITFA 2G4FA 4O02L 5I1EL 5BRPA 1WQVT 4UUJA 3KG5A 1IGFL 3AY4C 3O11A 3BLBA 1CDGA 4HA4A 1YNLL 3K3QA 3OX8B 3FAXA 2WAHA 4D8PB 1JXKA 1IV8A 2WUCH 3GXIA 4PTXA 1N0XH 2IFFL 4FQ2L 2ZXAA 2HN7B 5F8RC 4UQ2B 4ZFGL 2OI9B 3HC4L 4P9HC 1I9JL 5E5MB 4AIOA 2WMIA 2YD4A 3CC5A 3PHAA 4PJIB 3FQNB 4YHIB 1E0VA 1T5WB 2V5YA 5CP3H 4HGMA 5DUMH 1T0MB 5D2NC 1JF5A 1T3FA 1Q72L 5GGRA 2PXYB 4KJWC 3OJDB 3TIDB 5J89A 4JO3L 4F7MB 1OBAA 1QVOA 3O8XA 5E8DH 1VBUA 3LOWA 2ADGA 5M17A 4ZXOA 3TCLA 3HC3H 1IAOA 3BWUC 1MCSA 1UQYA 1AI1L 4CN6A 2GSJA 1KNOB 3BRFA 2NY7H 5EIIB 3W5MA 4Z7VA 4JFHD 4WWKD 2VAJA 1H41A 3MRKA 4KGJA 4RX4D 1BFVH 1CCZA 4G42B 2J8UA 2W65A 1M7XA 3ZHDA 3F7VB 1D5ZB 2DSZA 4ZNEE 8FABA 2ITCA 5ESVA 2V3FA 4HFUL 3SGEH 1YMHA 4XNZB 1H2JA 2FDMA 1HWGB 5L8KB 3ECQA 4M1RA 1XR9B 3AHYA 4PJ8A 4R97C 5HHNB 4XWGH 3UJIH 3RI5F 1CFNA 4U1HB 2A83B 4MQ7B 7CGTA 2V2XA 4YAQB 1GPFA 3BSHA 1BYAA 4OQTA 1YC8A 3T0XA 1WZ1H 4MJID 3QQNA 1JG9A 2RGSA 4Z0XB 3TA9A 3WN5A 1A4JB 5D1XD 1IRAY 3V6FB 2DI9A 43C9A 4EI6A 5I1GL 4AZCA 1KFAH 4CUCA 2D3NA 3CXDH 4HGKC 1OM3L 3GXTA 1HEZB 2X4OA 4RFOL 4N0FA 4P3CH 3MV8A 4S0SD 2WBJB 1KG0A 4LSQL 2FIKB 1A7QH 1MFEL 4JL2A 3QJFA 3GM8A 2NZIA 1GGCL 1AY1L 3MBEB 3B9KB 5JA8B 4NM4H 3ZJ7A 3RBSA 5CIPA 1C5CH 3MUGA 5ALCL 1YY8A 4YGAB 3W24A 4GKZA 4NHCL 5GS1B 2BOCA 5HY9A 1MFCL 4QP0A 2UY4A 4YIQB 4YFLI 1MIML 2Z31A 2GJZA 5BRZE 4YPGB 1L0XA 2O9TA 5BXRA 3C8DA 1QOXA 1WFUA 1X5LA 1VEMA 3VXMD 3CFJB 2PTVA 2AEPH 5D8JH 3ZDZF 1H0DA 1GGUA 1RUPH 3IDGB 4KY1H 4MNHB 4OD2B 1CK0H 1FRGH 2EDXA 3HHRB 4N1EA 1ISXA 1OARH 3BD5A 4P59L 1PZUB 2YA0A 5FA4B 3H53A 4UFIA 3H55A 5IHUH 1KCRH 5T3XD 4AD0A 1VPOH 4X0KB 3CSYA 4DFHA 4K3HA 3DDFA 4KUZL 1ZJBA 4BKLA 2DQFA 4JANB 3X14B 4KRPC 3QHZL 4AJ0A 1N64L 5FGCE 4HT1L 3NCMA 1XZ0A 2EC8A 2V7NB 3CVIL 5SX4H 4MB3A 4LCUA 3EZ8A 1WBZA 4A2MA 4ML4A 3O6LH 3NGBC 3LEVL 4Q74A 5CGYC 5DMKA 5AZEH 5DD3H 3RDTA 2EZ0D 1SM3L 4NIKB 2I07A 4KJPC 2VLJD 2GJ6E 1TFHA 5E0QA 4JFQB 1EJOL 4PTUA 4KKBC 3HE7D 4QRPB 1NDMB 3KPMB 3SO3B 3OXRA 2BY0A 3VFTA 4PRAA 4Q58C 4XP6H 1DQDH 4FS0A 4KAQH 2RCSL 3FHQA 4PV9A 3ES6A 2KPNA 5EPMB 1YY9D 1R5VB 1V7ML 4MSWB 4O9HH 3CZLA 4JREC 1T5XB 2AQ1A 1CZ1A 1W9PA 1TCRA 4JHWH 2DQHL 4DO6A 2R9HC 3HAEB 4NNYB 2G60H 4ONFH 4L1HA 3L3JA 1E4MM 1CD1B 1Q1JL 1KR1A 3FB8A 3EO1B 2OSXA 3LS5L 4PTWA 3QNZB 2ENYA 4MHHI 2XI9A 4PUBH 1CF8L 4D9QE 1UHVA 5I79A 5DEFA 3UBXG 1O0VA 2OJZH 5IWLC 4B53A 1XD1A 1UQSA 1OAQL 3BP7B 4P4KB 5JW3H 4LU5L 3EYQC 1GJUA 3MLRH 4JHZA 4IRSC 4XZUA 4G8EA 1N82A 1ZBWA 4YXHL 1DE4B 5IQ7H 4JLRA 4A6YB 5DRXA 1G0XA 3QDJB 1KUMA 5C0DA 4R5EA 4JZJA 1JFQL 2GITB 4CJ0A 1RZFH 2IANA 1LP9A 3BKYH 4BSWB 1CGSL 4MYWB 4BZ1L 4MQXD 4R4FH 2FL5B 3EYFB 4Z18A 5J9PA 1TITA 4HUWB 1HHHA 4MA8H 4OF6A 4O5LH 1S9XB 5EU3A 1VAHA 2EICA 3EDEA 4HC1A 1CT8A 4JY5L 5BRZD 4HSQA 5ID1B 1KB3A 2YFNA 1WAAE 4QYOB 5JBFA 2J7LA 3VRLF 3GBDA 4JJ5B 1EGJA 5K9KA 2FX7H 4NYLB 4YXKL 5BQ7B 4DVBB 1HKIA 4P9HL 3DIFA 1P9MA 2FWOA 4OZGA 4MJ4A 1VEPA 3HE6B 1QTYT 1EXUA 3L3GA 4E0RA 1OAUL 3FO2A 4PCTA 5I66A 5D96B 2HISA 2FR4B 2P8PA 1KGXA 3PWUB 2OLHA 5HI3C 4L29A 2D23A 3HMXA 2XZZA 3IJ7A 1K9DA 1IGYB 4PREB 2CCRA 5EZLA 3O3BA 3WF2A 4LRIA 1OCQA 3PBGA 3MOAH 1G7IB 1T1WB 1MFUA 4QGYA 4LDOB 1GCYA 5GS0C 1QQDB 3U2SB 4XGZA 3UROR 1MRDH 1MFAH 4UBDD 1AO7A 5LJYH 4PJXA 1MI5B 4NQEE 4L5FL 2NXZC 3L3OB 1PYWA 2A77H 3EOYG 4U1NB 4UV4H 3EJTA 1F4YL 1H3WM 2GJ6D 3KLKA 2HP4A 1D5XB 3C5SA 2J77A 1CICD 2AJYL 5EZJA 4PG2A 1G9ML 4YBQD 4MWFA 4L4VB 1ZLSL 2VABB 3LKQA 4XCEA 4ZS6C 1FAIH 3VFVB 4L3CB 5J0BA 4UINL 3NA4A 4AZIA 4GI8A 5J13B 1OWWA 5I16A 1CGTA 3JWDH 2JB5H 4U1GC 4OTXH 1TA3B 4BSJA 1KQYA 1MFDH 3FMGH 3AHVA 1IM9A 3NA9H 4LSSL 4MD4B 3HNTL 2XTJE 5C0AB 1I1AB 5E7BA 3PV6B 2XZAL 1Z5LA 4D9QD 1GQJA 3U1SH 5D72H 2CRZA 1T2XA 3WBDA 4OGXH 4HS8H 3WNPA 4AIEA 4OD3H 4XP5L 3GKWH 3RU8L 3DRTB 1CL7L 3OAYK 4QTIH 1LDSA 3QUMH 4NCC1 4AL8L 1A3RL 1CXIA 1UT9A 1EHLH 3KWXA 3SUUA 3DV6B 4WFGD 5GZND 5AZ2L 1FGNL 5EIVA 1OGGA 2G8ZA 1ZHNB 4QTHA 1ZT4B 3KLAB 4UT9H 1CXKA 4E42A 3AIBA 3MI6A 2IPUG 2UY6A 2HRPH 2GSIA 5E00A 5ITFB 4QRQA 3CUGA 2P5EE 1MQRA 5ID0A 4POZC 4HF5L 1JNLL 4JGMA 5F9AC 2Z91A 1B3WA 1K4CA 4UUJB 3VI3E 2IMMA 3I84A 3O11B 3MA9H 3WFEH 1FE8L 3F6IA 1Y7VA 2ZWLT 4RMSA 3SCTA 1OAYL 3QA3A 4JE4B 4NZJA 4ZMAT 2AK4A 3QWRD 4DAGH 3AYRA 2R1YA 3V8OA 4AIXA 5ICZA 2BY3A 4BK5A 2WMIB 4ZO7A 1T2QL 3CC5B 4APQD 2BCKA 3RZCA 1FIEA 1E4WH 4XMLH 4EI5A 2B8OT 1TZIA 4RGOH 1ACYH 2EPLX 3HJEA 3NCOA 1T3FB 5GGRB 4KVCH 3RWDA 4F9LC 1G0CA 1QVOB 1UEYA 1GZJA 3O8XB 4MZ2A 1C12A 2ADGB 1FGVH 4ERSL 3TCLB 1C93A 2EBNA 5DMGD 3GI8L 4PJ7F 4M7LT 2IPKA 4Z7VB 4F9PA 3MRKB 2R0KH 1M05A 3FHAA 3DHUA 1DL7H 1TETL 3KJ4C 4IMKA 4KVNL 2J8UB 1A6TA 2W65B 3HNSH 3V4VH 2A9MH 4PMDA 2CYGA 1NANI 5IBLC 2VLLA 4MADA 2NY5C 4TOYH 8FABB 2ITCB 5ESVB 1JGUL 1YMHB 3QHFL 3NIGE 1EAJA 1YPZF 2ZCLL 3S88L 3MLZL 4PJ8B 2DIJA 3MLYL 5IQ9A 1CFNB 3WO3B 2Y2WA 1K9TA 1A7OL 1NFDA 1Q6GA 1RZ7L 4PJDF 3QR3A 3ZDXF 2VDQL 4XNYH 3TC9A 4WW2A 5GJTH 3BDYH 3EYOA 1LO4H 2YD7A 2DM3A 4RMTA 1ORQA 3WN5B 4Y5VA 4U5IA 4FABL 1DQJA 4EI6B 43C9B 1J1OH 5HPOA 4AZCB 3VXUE 4HK0A 4GPNA 2FHCA 3N0AA 3UMTA 4WWKA 4Y16C 1GGYA 1OTUC 1LDPH 2X4OB 1MH5B 3QIBC 4N0FB 1YEJH 3MV8B 1A02N 4MVBC 1KG0B 2ZSVA 4UU9A 3MSGA 3QCTL 3QJFB 5JORA 4JY6A 4WY7H 2JEPA 5EORL 3CFKA 2XTJD 1INQA 3GJFK 4XP9H 2J8HA 5KSUA 3DO7A 5CIPB 3MUGB 3NIFE 3SCRA 1YY8B 2VLRE 4HZ8A 3CHCA 1WIUA 3BKMH 1OGBA 2BOCB 4EDWL 2RR3A 5HY9B 2ORBH 2B1AH 1V3KA 4PJFE 5DT7A 2Z31B 3BT2L 2GJZB 5E4EB 5D1XA 3DX6A 1HJSA 3SJVA 5ENWA 1KXQA 5CPSA 3DX9A 3BHBA 4FOMA 2YPVL 4EN3C 5EBAA 2R0ZH 2ZUQB 3LH2L 1H0DB 3HNVL 2H2SC 3ZZ1A 4XB7A 1K2DA 2FATL 1B2WL 2PF0A 2WHKA 3KPRE 1NMCB 4GOSA 3F12A 3ARDC 4UFKA 4FFVC 4S1QH 3QEHA 5CUSH 2QPUA 3B2UC 3CSYB 1OSEA 4GQPH 1CDUA 3O6ML 1TTGA 5HGAA 4BKLB 2DQFB 3NVQA 5DD6A 2LTQC 4Y2DC 4OI9A 1P1ZA 2BMKA 2G75A 5JQ6L 4NZFA 1XZ0B 1FNSL 2FBJH 4LCUB 1WBZB 3NPSB 3N1FC 4KROC 4WEBL 4X6BA 5BV7C 5DMKB 1OCWH 1CBVL 5DWUH 4LQFH 5EC2A 4KDTA 4WIQA 4CDHA 3RDTB 1U8PA 2NY0B 4HH8A 1EHXA 2I07B 3QUYC 2HA1A 1S9VA 1UEMA 1YEIL 4OM1L 3IFNH 3EFDH 3VXMA 5ACLA 2NY4D 4Y5XC 5GS0L 5SWSA 5HGDA 1B3YA 4NC2B 3T4AA 4YDKH 2IBBA 3D2UD 4L3EE 4PTUB 3SQOH 3VH8A 3D51A 3MMDA 4WENB 1BYBA 3OXRB 3VFTB 1KCVH 2Y25A 4PJIF 3DYOA 4PRAB 1RH9A 1QI5A 3KPSE 1D5MA 1U2HA 2VERN 4Y89A 5TPWL 3UC0H 4YFEA 2DBLH 1MEXH 3ES6B 5E2UL 4W81A 4JVWA 5JNYA 2EKJA 3JUYA 3WUWA 3GNPA 1FP9A 1TCRB 1MAML 1VFUA 2IJ0C 1MRFL 4OLYL 4M1CD 4U1KA 1EERB 4WSKA 4YXLL 5IKCA 3L3JB 5I1LA 4EIZC 4W70A 5E0FA 3FB8B 2X1IA 1QRND 2WP3O 3VIIA 2DQUH 1CFSA 1QR4A 1S8DA 5D70L 4H04A 3UR8A 2R0WL 5F1KC 1A3HA 3ARFD 5DEFB 5K9JL 1A5FL 2R1WA 4CADA 3LY6A 3HE7A 4DK3A 5IUSA 2DLEA 1DVFC 5K9QG 4PB9L 1UQSB 3CTTA 3WN6A 1W0VA 1G94A 2BC4A 1BBJA 4XZUB 4G8EB 4JM2D 3VH8G 4JLRB 4FP8L 2EYRA 4ZS7H 4LSPH 3IDIB 5DRXB 4UAOC 5C0DB 3MU7A 1JIBA 1UADC 2EDQA 4JZJB 5IESH 1HNYA 3LHPH 1FP5A 2IANB 2J62A 1LP9B 1MJUH 1KCUH 2W61A 3BAEL 1LL6A 2V5MA 3DVFA 3WUWG 3CV5A 3WS6C 1LL7A 3PL6C 3S5YA 1GL4B 2HLAA 4KPHL 5J9PB 2ZICA 1HHHB 1CL7I 4KKAD 2RB8A 5EU3B 1WITA 1CT8B 2FJGA 4ENEC 4YK4B 3L3KA 1NAMA 1E1FA 3QFDA 1PLGH 1PY9A 1ZHBA 2GJRA 3OR7A 2C5DC 1MWAA 1LWHA 3KPOA 5K9KB 1Q6CA 4UOJA 1S78D 3RX8A 2ARJQ 1AE6H 2FWOB 3DIFB 3GJFA 4M6MH 4B50A 4P3DA 4Z78A 2CLZA 1KC5L 3GI9H 2NT0A 4AMKH 1EXUB 3L3GB 4CKQA 4E0RB 1OVZA 3FO2B 4NSBA 3AMLA 2P8LA 5I66B 2V5CA 1Q9WA 3TA3D 1V3IA 1FLTX 1V0NA 4CU8A 1HWWA 2P8PB 1WDRA 5I1IH 4TOQA 3VXRE 4L29B 1AQKL 1JGDA 1DFBL 1BD2E 5EZLB 3VIGA 1DN2A 2B5IC 2AJXH 1WEJL 5FO7A 2MSPA 4OBSA 5A6JA 3REVA 1FNFA 2CK0H 2QQLL 2IG2H 3PP3H 4XGZB 3QCVH 5CBEA 5BRZA 4R8WH 1AO7B 3P0GB 2XWBA 3K2MC 4LPTA 4GZJA 4PJXB 4UFLA 2XKUA 1NC4A 3NCCB 2XM1A 2DIAA 1S3KL 1JP5A 1PYWB 1J1XH 3JVGC 4IUGA 4EJ1C 2UUDK 3WXWL 1DJSA 4NRXA 1AC6A 1BJ8A 4JFFE 4L3ED 1CGYA 2NY5L 5HDRA 3C5SB 4I4WA 4D6CA 1CNVA 4U1LA 3A23A 5EZJB 4MX7A 3KPSD 3VNZA 4OJFL 4MWFB 3RGVD 5E2WH 2Q7NA 1T83A 5TQ2L 2BRRH 3LKQB 4XCEB 3O45A 4HPOL 3MFGB 5T1MA 4ZE4A 3BX7C 2VCCA 3TVMD 2MPAH 5I16B 3CSGA 4JQVA 3C08L 3ZKNC 1NWUA 5DVMA 1FBIH 3VRJA 1MJ7L 2V17L 1RVFL 1IM9B 2P8MA 1EEQA 2Q87A 3P0YL 4FQQB 1AFVH 4X5XA 4P2QD 1KTDA 1IARB 5E6IA 1I8LA 3BDBA 1Z5LB 3QT2A 1IKFH 1N5YH 1HKFA 4NQTA 4OGYL 2GJ6A 5ICXA 3AIRA 1X5ZA 2B1HL 2PTTA 2VWEC 3A6BH 2ZCKH 5L6YL 1CICA 3O6FC 1IVLA 2DJUA 2WBGA 4MA7L 1RJCA 4Z6AT 5IJKC 3GBEA 4HX1A 3WQ6A 4UILH 1U0QA 4HDIA 2OSWA 1HP4A 3V52L 3LSOA 2H2PD 1UJ3C 5TJWK 4KDWA 4QTHB 4P48A 2M1KA 4S1DC 4E42B 2VDNH 3HRPA 4GRMA 1U8JA 1G7MA 2GSIB 3LN9A 5E00B 3K8MA 4QRQB 1WT5C 4RGNC 5ID0B 4X9HA 5MEPA 4XCNA 7A3HA 3LKNA 3LQMA 2Z91B 1K4CB 5C7XL 1SY6A 4FG6D 4GSDL 4QRUA 1K5NA 5F97E 5I75C 4P23C 3QA3B 2AK4B 3ZYJA 1E15A 1UCTA 2R1YB 1OW0A 2A9NL 4JRXE 5ICZB 2CETA 3VIKA 1MQKL 3BVXA 3EKCA 3LQAH 5F6HJ 4GG6F 2BCKB 3A67L 3RZCB 4JQXC 4J28A 3I2CH 4EI5B 3GK8H 1TZIB 3O6KH 1VRXA 1QWNA 4MLIA 2DEPA 1AP2A 3RWDB 1D6EA 4K23L 1QP1A 1D9KA 1QYGL 1C12B 3O4OB 3MMWA 4FZ8L 5AYIA 3DECA 1G9NC 5JUEH 1KJ2H 4TPRH 1FDLH 4I77L 2IPKB 4PJAE 4L3AA 4J3TA 3FFCE 1M05B 3RKDC 4HD9A 1A6TB 5GRZA 1EQPA 5DJZA 2VLLB 4LKXA 2ICWJ 1NH6A 4I8DA 1W2PA 4QCIA 5T33L 3K4DA 1V3JA 1CQKA 3V9FA 5IQ9B 2DQJH 1XIWC 3GNML 1PIGA 3U79A 3PZIA 1A0QL 1NFDB 3ULVH 2PO6A 3MROA 1ZXQA 5BXFA 1P6FA 3P2TA 2CBJA 5FO8A 4XAWL 5FGBA 3H42L 4C4KO 4WW2B 1KT2A 2CQVA 4QRRE 3EYOB 3EW3B 1ORQB 1ESWA 1US3A 3QEGL 4Y5VB 1DQJB 1LWRA 1FN4A 1HT6A 1AXTL 4ORGA 2WSPA 4QEGA 4HK0B 4WWKB 1TPXB 3KLSA 3TT3L 1BJMA 4B7LA 2D7NA 1ODAA 2D03L 1L0YA 3OXSA 2HVMA 2ZSVB 4UU9B 5JORB 4JY6B 1PVHA 3CFKB 2G2RA 1INQB 1ZWIA 1Y6MR 4NDMA 1GHSA 2FYYA 3ZL4L 3DNKA 5KSUB 3WH9A 3DO7B 1RJLA 4LASL 4ZXLA 3WNLA 1D5IH 1EUTA 2NW2A 5DTFA 3VO0A 3HAEH 4DUVA 4OCRL 1S9KC 2WB5A 3JWOC 3VIJA 4TVCA 1M53A 2Y23A 3O2DL 1SMDA 5D1XB 3DX6B 3SJVB 5ENWB 3W11C 4ONHA 5JW5A 3DX9B 3BHBB 1HKKA 2IGFL 12E8H 2OMBA 4BF7A 3WL9A 4UTBH 2ZXQA 5DR5H 3WXVH 4IDLA 4JIEA 3I6LE 4FNQA 1K2DB 4AXNA 3D0LA 5GS2D 1UM6H 3F12B 4FQ1L 5J12C 1CU4H 2AJSL 2HFEA 5IVXE 4LARL 1T7YA 3RNQA 3QEHB 4KRMB 1A1MA 3MZTA 1BPLB 1OP3H 2F8OA 1JAEA 3LKRA 2CUHA 5HGAB 4WKAA 1QI3A 4G6AC 2D7TL 2QQKL 5DD6B 5L0QC 2BMKB 2G75B 2APXA 5EZOL 4F37F 3THCA 5IP4A 1IC5H 4QLLA 4X6BB 4OLZH 4JFUA 3QEQE 2HTLC 1BFTA 5EC2B 3SCMA 4AMCA 1U8PB 5I8CA 3VXMB 1S9VB 3VD7A 3SDYL 4BYHA 4MCYA 5A8OA 5SWSB 5HGDB 3PZQA 3T4AB 4MA3A 1DBJL 4BFBD 3VH8B 1HZHH 4DN3L 3NCBB 4FNLL 1F3JA 5LVEA 1KIUA 1PDKA 1GAFL 5BO1L 4FQIH 1D5MB 5E24E 2HFFA 4PLKD 1AXSA 1W9UA 2FH6A 4U5KA 4LIQE 5FA3A 5JUVA 4YHLL 4X0NA 2V9RA 3WUWB 2EE2A 2OTUA 4X4XA 2HG5A 4U1KB 1V08A 4G6KL 1Q9LA 2YEZB 4Z7VF 1BWMA 2F7RA 5IKCB 2JJVA 5I1LB 4FTVD 3FO1A 1UR4A 4XPTL 3OZ9L 2N4IA 1TQCB 2AI0H 3OGVA 2J8UF 2EDJA 5TE4L 1CFSB 4QRRD 5D7JD 3VA2C 4U7SA 3BXNA 3V7MA 1QLRA 1FP8A 3EJZD 1Z9LA 2P45B 2R1WB 3BPNC 4CADB 3HE7B 1MHEA 3TBTA 3VFNA 4GT7A 4P46D 2KDGA 2BXZA 1NKOA 1W0VB 4P8VA 1J12A 2P1YA 2BC4B 4DEPB 1MY7A 1BBJB 3K2UH 4H8VA 2YL5A 5A3HA 5BCAA 3L5WA 1CFVH 2EYRB 2VXTL 2HVKA 3QIWD 3THML 1KTLA 1K6AA 1JN6A 5L9DH 2VZ1A 3WHXA 3TZVA 1FC1A 4XCFL 4JKMA 4WV1C 3P9LA 1MF2H 2HLAB 1A7NH 3QPXH 1JTOA 1WPCA 1OTSC 5CZVL 3ARFA 2FJGB 4QLJA 3L3KB 1NAMB 3N13A 4A3HA 4Q2ZA 3QFDB 2DQDL 1JL8A 3TF7C 3IFPA 3GIZL 4LCCC 4XZWA 1ZHBB 1OSPL 4YDVA 3OR7B 5GRXG 2BFGA 3IJYA 3KPOB 1VEOA 4JM2A 3I6LD 3GJFB 5DS8A 4OD1L 4P3DB 4Z78B 2CLZB 2FX9H 2HKFL 1X1NA 5IGXL 3ETBF 2CO7B 2P8LB 4WHYH 3TJHC 1Q9WB 4D3CH 3WFDL 2AKRA 4H7VA 1I3VA 1OOAA 1JGDB 2VLRA 3MSPA 5GRVL 1KBBA 3MLWL 3WNMA 5HVHC 1MVUA 3BIAX 1K6QL 1P4IH 3MNWA 5FO7B 5T1DL 3REVB 4KZEH 5E0CA 4PJFA 1G9NL 5FHBH 5CBEB 1N6VA 1B4JH 5BRZB 2XWBB 4UOZA 2XWTA 3BN9C 1NC4B 4PYHA 4NOFA 2WLZA 3L5JA 3WUBA 2M8XA 2L0DA 2E7HA 4AEIL 2J88L 5ABGA 4XBEH 4NRXB 1DSFH 5JLZA 3KPRA 4I4WB 4P7RA 1E5NA 4U1LB 1Q0XH 3KGRA 4AZBA 2CERA 3SCPA 2NY6B 4MX7B 2WC4A 3NTCL 1CG9A 1PKOA 3L5XL 1L9MA 3QIUD 2CHOA 3TA3A 3O45B 5EU5A 1VESA 6FABH 1GGBL 5T1MB 4JPKH 4TUKH 3PP4H 4Y1AD 3VRJB 4YHKH 3ZIZA 2AAVA 2P8MB 3LPFA 5GRUH 1ORSA 2VZTA 3A3HA 4YHOL 4X5XB 3PXHA 4HIXL 1KTDB 5E6IB 5ADOH 5HYEA 4PJEE 3DC0A 5KVFL 4LGPB 5ICXB 2GJ6B 2PTTB 3KLHC 3G6MA 3RKPA 4L3EA 2J2ZA 2ESCA 1CICB 1W9VA 4Z9KB 3KPSA 2AABL 3RGVA 1K3ZA 4WFEE 5C0RH 1ZGLP 4HX1B 1R47A 5F3HA 5FV2A 3OG4B 4HDIB 2J5LC 5A8MA 3LSOB 3TN0D 1GXEA 5ERWA 2DI8A 3INUL 4XNUL 3F65A 3ZR5A 3EDFA 4GRMB 1U8JB 3JWOL 1G7MB 1OQXA 4NZRH 5MEPB 4XCNB 4S1RL 3LKNB 1FHDA 2H9GB 4UOQA 4M1DH 4UDTA 1KGWA 3UYRH 4G3YH 4QXWA 3W6LA 4QRUB 1K5NB 4LSDA 2J6EH 1MSPA 3NFPA 3DPBA 3C60C 4FNSA 5D7IF 3BVVA 2YBUA 3IFLL 4IBLT 3VDBA 3VFUA 3DMMD 5C3LD 1J0KA 2HT4C 4UB0L 5BS0D 4FZEL 1E6ZA 5HJ3A 3BPOB 3PNWA 3SDAC 3SOBH 2F53D 4YHYB 2JK5A 4OFYD 4HG4J 4KXZI 2VZOA 1AP2B 3MLVH 2QSQA 4R0LA 1MCWM 1D6EB 1D9KB 5IBTH 5EO1A 5F72S 2QSTA 1NCBH 4JRYD 2DPEA 5HHMD 1UZ6F 3H9SE 3WIHA 4M62L 2X4NA 5DVNA 1E4JA 4OM0H 2FEDC 4OCMC 4OZGF 3LMJH 5DJCA 5EFIA 4CVZB 1KCKA 5IB2A 2BZDA 2WMFA 2XXCB 4M48L 1HYSD 3MLSH 2NTSP 3QXAA 1OY3B 5DJZB 4KK8D 3MRNA 1WTLA 4OLXL 4XI5D 4LKXB 4I3RL 1AVAA 5IFAH 2QADC 4ATLA 4PD4K 4ODTH 2KZWA 4QCIB 3A24A 4JKKA 4M56A 5GPRA 4M7JH 3BKCH 1QA9A 1MCIA 1HWHB 2PO6B 3MROB 1ETZA 4M61B 3W0WD 5BXFB 5FO8B 1UKOA 1V3HA 2Y07H 1KT2B 3MJ8B 2A74A 3O2DA 4PJXF 1A47A 5IFTA 1MNUL 1JHLL 3WQ8A 2FB4H 2GJPA 2I5YL 4XV0A 4X4ZA 1X5FA 1FN4B 1I85A 4R4ND 1GHFL 3K4ZA 3VXRA 3BW9A 4ORGB 1CLOH 1TZGH 2YMXL 1YN7A 3WKML 4KMTL 3F5JA 2V7HA 3OXSB 6TAAA 1FG9C 2WKLA 1YYML 5SWQA 3MXVL 1UZ1A 1EV2E 1ZL1A 3H3PL 4R7NA 3JBG7 3TT1L 4WW1A 3O41A 2XVLA 2F2HA 1EA9C 4FHBD 2G2RB 1A6WH 1ZWIB 2QSCL 4NDMB 4DK6A 2FYYB 4F80A 5I0ZA 5KSBE 4Q22A 2L7UA 5CCKH 5A95A 4DVRH 4GQ9L 1J5OH 3MR9A 1RJLB 3B5HA 1YNTA 1LEKA 2E7LC 2WPGA 3VTRA 1I3RA 3OKDA 2NW2B 2MTPA 5DTFB 4JFSA 4WFED 5LKNA 3D9AL 4G6MH 3GH4A 4LKCA 4GQRA 4AZ7A 1U6AH 1YNKH 4M5YH 4NBXB 3T0DA 4ONHB 5JW5B 1QSEE 4BQ2A 1UWGH 2BRQA 4EIGB 3WL9B 4Y4FA 1UKPA 2AEWA 1OF2A 5B3JF 3D0LB 1ZJAA 4XC3H 3KPPA 4QXGH 2HFEB 3ZOAA 1HINH 3K80A 3RNQB 5L7XH 2F54D 1A1MB 5BUGA 3A4XA 3NZ8A 2XTJB 1IAMA 3M8OH 3U7VA 2LAGB 3BPLC 3R4DA 3LKRB 4G5ZH 1FORH 1PEWA 2UY7A 4OZHA 3KPNA 5KTEH 3W37A 1HH9A 5HI4D 4GXVL 3N85H 2WINA 3AS2A 3TYGH 3VGBA 3ZDYF 4X9YA 1U8IA 4LDEB 3MUAA 1I9RL 4F58L 4YE4H 1RIHH 3JTSA 4KK6C 4U1MA 3SCMB 3AZTA 5DLMH 5I8CB 1YECL 1LWJA 4P9MH 1CE1L 4XX1E 1FQ9C 4OGAD 4MCYB 5E2VL 1BQSA 3V0WL 9CGTA 5I73B 3CZGA 4MA3B 4AEHH 2X4PA 4XPGH 1F3JB 4JO1L 1W0YT 2E3VA 1CD8A 2ZCHH 4ETYA 1H3UA 2AXJA 2ZJSL 2HFFB 3QHOA 5CWSA 1VADA 1AXSB 3HZMB 3U5YA 1XF5A 1HKLL 1RZJH 2DQTL 4YH6A 5FA3B 2PR4L 5BVPL 2NY3C 1MUJB 5A6BD 4WI9A 5JMOC 2OTUB 1PG7H 3TO4C 4NQXA 4OSUL 2P44B 2HG5B 4TVDA 3ECBA 2AGJH 4ZXBC 1A3LH 4JZOA 4RE2A 4K71B 1Q9LB 4LPUA 1BGXL 2AV7A 3O3EA 3M46A 4G7VL 3EYUL 3MJ9A 5JIIA 3VVGA 3FO1B 4U49A 5E8EB 1ZS2A 1RUAL 2YRZA 5KEZA 4RGMB 3BXNB 5HPCA 4HPGA 5CJXC 2P5WD 4NRSA 1QLRB 1T6WA 2N1KA 2YS4A 5JDSA 1UH4A 3PF2A 4TSCL 3MLPA 1MHEB 2CLVA 3TBTB 4JFYA 3VFNB 2O5XL 4XBPB 1GOMA 4PJAA 5FYKL 1NFDF 2EDKA 4JDTL 1XF4A 4WW2F 3U82B 4JFXA 4NWTL 2Z8SA 3L5WB 3VINA 1XGUA 1E3XA 4LVNC 2HVKB 1KTLB 5LQBH 1QNPA 1JN6B 1HXKA 3V6ZA 3WHXB 3C09B 3MRFA 1KCSH 3F7YA 3I50L 1N4XH 3TZVB 2VRQA 1UFUA 1JPTL 4FTVA 4Z2HA 1HNFA 3P9LB 1YYLL 2YHGA 4HXAL 5I1EH 2F19L 1JHKL 5D7JA 4QRRA 1JF1A 1IGFH 5EIQA 1HIML 3ARFB 1YNLH 4FXLA 3BJ91 4H20L 2VXQL 1DWIM 4Q2ZB 4W87A 2VKXA 5EZIL 2GK1A 2VI0A 3KJ4B 2IFFH 4FQ2H 2JELL 3IFPB 4ZFGH 5MP6L 3HC4H 4P46A 5FEBA 1I9JH 2XKNA 1WWCA 2X44D 4YDVB 2BV9A 5B4MD 1UG9A 3IJYB 3WF4A 4GKNA 3WLBA 4JM2B 3S8WA 4C56E 5DS8B 2ZKHL 3WE6A 5DA0B 1X5KA 4KJQC 1XCTA 4R26L 4TX6A 5FM8A 2ZG2A 4RMVA 1NQBA 3QIWA 4DUXA 4PPTA 5KANG 3K4AA 2A6DA 3B3IA 1Q72H 2W92A 5IW6A 4FLQA 1E4XL 2AKRB 4JO3H 2VURA 5AG8A 1IFHH 2VLRB 2QV4A 2HYMA 3OMZA 5BW7A 3T0BA 2Q6WA 1NUDA 3BH4A 1MVUB 1ZLUH 4CU7A 3MNWB 2CXKA 4PJFB 2EYSA 2MNUA 5HYQA 2XWTB 1D6VL 3O3DA 4RE4A 5EU7C 4MXVE 1PSKH 2ZUYA 1I3GL 5HHVL 2DF3A 4HFUH 3SE3A 3BZ4A 2BOBA 5JLZB 4JFDE 3KPRB 4OZOA 2MHAA 4K3EL 2NXYC 5FGSA 5IVXA 5ANME 1CG9B 1YQ2A 2PCPA 3KDMA 1IKNC 2IH1A 3TA3B 4PJBF 5L8LB 3B9DA 5EU5B 3PTKA 1YEGL 5J56B 1X4ZA 2XGIA 4V27A 1TQBC 3TV8A 4KRPD 1U58A 1E3ZA 3WH6A 5I1GH 4FFZL 5IB4A 2W0KA 1CLYL 3ARRA 3LEYH 1OM3H 2WZHA 4HKBA 1B9ZA 3BUYA 2JLLA 3M6DA 1XSJA 3MRGA 4RFOH 4FQXC 3EJPA 1ORSB 1T1ZA 5IDIA 4G6JL 4LSQH 3WH7A 1MFEH 4BQ3A 4KJPD 3IJ8A 5C07D 3IDXL 1RV6X 4EEEA 4L3EB 1AY1H 5FYLE 4KKBD 4JVPA 3VG9B 3TTSA 4LSVL 3KPSB 1ZLWH 3B5TA 3RGVB 3TO2A 4E5XA 1UKQA 3CMGA 2UVFA 5F3HB 4NHCH 2W67A 4PG9A 1QHOA 4P2CG 3BZFA 1MFCH 4Z7OE 3MYZA 4HKZA 5ERWB 1MIMH 5C86A 1FCCA 1LEIA 4OLWL 4L4OA 2OJEA 3WMCA 1EEUA 1CIUA 3ABZA 5CQ1A 2LFGA 3T04D 1U91A 4UDTB 4AM0A 1KCLA 3M7SA 1KYOK 1WBYA 4P59H 2WVUA 3NFPB 1BZ7A 3BGFB 3FO9A 4KUCD 3S6CA 3UDWA 4K9EL 3LKSA 2Z0BA 5BOZG 5IR1A 1T66C 3VFUB 3PJSA 4K94C 2DQCL 4BCEA 3C8KA 1E28A 3QHZH 1N64H 4ODSL 3B2VL 4HT1H 1WTGT 3DXAE 3PNWB 5HJ3B 1UR8A 3VWKB 1ES0A 2HWZL 2JK5B 3CVIH 3SN6N 3TN0A 3TJEL 1UWXH 1NANH 4J23A 4R0LB 1VFBA 1D3CA 5KW9L 5EO1B 1XMWA 1SM3H 4FLOA 2VISA 4HUXA 5F7YC 2X4NB 3KS0H 1EJOH 5DJCB 2XZQL 5EFIB 5IB2B 4GAJL 5D93C 2DS4A 3GSXA 4L9LA 1UG6A 3QXAB 1UB5A 4EZMA 4U4BA 2W9EL 3MRNB 2RCSH 1JZ5A 3NSXA 3QUZC 2GT9A 2DYPD 1H8SA 1UXSA 4M43L 3ZDZE 3DMMA 1V7MH 4L4JA 5HDQL 3WY4A 5SX5H 4LXFA 2AW2A 2DQHH 4M93C 4JFDD 1DN0B 3LS4L 4OFYA 1QA9B 2EXWC 1ETZB 5TDPA 2A74B 4LEOA 4C57C 3LS5H 3G5XA 1CF8H 3VXRB 3BW9B 2DT0A 3AYSA 5HI3D 1XHGA 4B9ZA 1YN7B 3H6JA 1GC1H 4XPFL 3HI5H 4QLRA 3SCVA 4BFIA 3VD5A 2V7HB 4PJ9A 3TBYA 5SWQB 2CRIA 4R7NB 3GSNL 3L2MA 4WW1B 5FCZA 3O41B 1AGDA 3L7FA 1G0DA 4IJ3B 4CCCA 4N68A 2BY1A 5FM5O 1MCRA 2C1OA 3EGSA 3MV9E 3PDDA 4FQHA 3MR9B 1CGVA 3W0WA 1LEKB 1YNTB 2DDQL 1I3RB 3LPWA 3OKDB 4LSTL 1CGSH 4BZ1H 3RVXD 3IS1X 1ZSDA 1DBKL 1NAKL 4LKCB 5E5RB 5BOPA 1HKMA 1MCFA 3OLIA 4JY5H 3VMOA 4ZUUA 4Y19E 1QSFE 3EYVA 4PIRF 5GGVY 1RUML 4Y4FB 5C0CE 1IMHC 3WD0A 4RNRA 1OF2B 1S7WA 4QHKI 3WSQL 1XF2A 3KPPB 4EANA 1A6UH 2FGLA 3WLWD 1GOHA 1JPSH 4YXKH 4P9HH 2CMRL 5I17A 3DV4A 3NZ8B 3CFCL 3RO8A 3JV0A 5ABEA 4PJEA 1V3MA 3QDMD 4RQQA 5B3NA 3KPNB 4XB3A 4L8BA 2CUIA 5JHDE 3TH4T 1HH9B 2FBOJ 2R56H 1CGXA 3C5ZD 2WINB 3JXAA 2NY2B 5IHLB 3WUEA 4QF1A 4NZDA 2WCAA 3L4YA 4W88A 2H32A 4V1DE 1U8IB 3V0AC 1I7ZA 4CN1A 2B4CC 3JTSB 3HZKA 4U1MB 4XPAL 5GIRA 2ARWA 1E55A 3V0JA 3QXUA 4I9WE 1EQCA 4L5FH 5MERA 1ZHLA 1HDMA 5GSRB 4ATDA 4K2UL 5LGHL 1E4XI 1SFSA 2X4PB 3RWCA 3FZUC 1F4YH 4TNVK 4H8HA 5C0ND 3STZA 2F54A 2NR6C 1XEDA 5CWSB 3SE8L 1VADB 1KQZA 1XF5B 5CG0A 4UZUA 3IDYC 1ZLSH 3VRLE 4JRXB 4NQXB 4OJYA 1AXIB 3ARED 3ILQC 3R06A 3ECBB 4JZOB 4X6FA 4UINH 5FYLL 3UZVB 2AV7B 3O3EB 3QHMA 4HU8A 1J0JA 1HX0A 5D9PA 1H4PA 1FJ1A 4AY1A 2YPKA 5I8EA 3HG3A 3BQUA 3APGA 5FKYA 4ORZC 4LSSH 5E1AB 3BRGC 3IVKA 1A21A 4NBYB 4JFTA 2XZAH 2C4XA 5JDSB 2CUMA 1CGWA 4I18A 3S36L 2CLVB 2YD8A 4JFYB 4PJAB 1CVSC 4JPVL 1HSBA 4OFIA 1XF4B 4XP5H 2ATKA 3RU8H 5JW4N 4JFXB 3R8QA 1Q6EA 4TSBH 1AH1A 1XGUB 4AL8H 1A3RH 5A6BA 4JCLA 1JK8A 5AZ2H 1FGNH 5EOQL 2LU3A 2APTA 2F1AA 3ZKXB 4OKVA 3V6ZB 2QLYA 3UXFA 2D22A 3MRFB 3F7YB 5F1NA 5KS9E 3MV9D 5ESAA 3P4LA 2GVYA 3MRDB 5GGSY 2DSWA 4FTVB 2BDNL 3C6LC 2V3GA 4HF5H 1JNLH 3FQRA 4QRRB 5D7JB 1MWOA 1JF1B 3VGAC 4GKLA 4H8WC 1E4KA 4YX2L 1QI4A 1DWFM 2OWCA 1XT5A 3ILPA 3FQTB 2FX8L 2GK1B 1OAYH 4X6DF 1QFUL 3U7WL 4P46B 4Y19D 1QSFD 5C0CD 5GNZA 4Y16D 4MXQC 4GKNB 3WLBB 3NYDA 4W6YB 3QIBD 5HHQA 3WE6B 2D7OA 1XCTB 4UNIA 1M7IA 4K94L 5DJ2A 5L2KE 1TVBA 3QIWB 4J4PC 1FLRL 7FABL 1LMKA 2I27N 2A6DB 3B3IB 3CAFA 5IW6B 2R69L 1MCNA 3KPLA 2ESVE 5JHDD 3MRCA 1KB5A 3DVNA 2Q6WB 4OGZA 3GI8H 1ZK9A 3P0VL 1URLA 4K3GA 4QDMA 4XXCA 4NP4H 4U6VH 1G1CA 2A3EA 1Z9SA 2EYSB 5I15L 3BAYA 3OTTA 1OTTD 3GUTA 3O3DB 1LGVA 4KVNH 3CFBA 1JWSA 4W4OA 3S2CA 4YC2C 4KRUA 4I9WD 1JGUH 3QHFH 2P4AB 2BOBB 3BZ4B 2ZCLH 3S88H 3MLZH 1IGMH 2GK0A 1F4XL 2MHAB 2J8GA 1K8DA 4IRJC 3L4VA 2JIWA 3TNMA 3AM8C 5IVXB 5AC5A 1A7OH 4FFVD 4URTB 1RZ7H 3PQYD 2PCPB 3KDMB 4N0CD 4ZDHA 4F7CA 5I71B 2VDQH 2IH1B 1QLEL 1AQHA 4EQ3A 5TH2B 5J6GA 2GCYA 3K81A 4FABH 2UZIL 3OL2A 4B7IA 3RY5A 5IB4B 2XN9E 3CXHK 2VR5A 4HKBB 3BUYB 4RDQG 3QEQB 5FYKU 3MRGB 3S37L 3SGJA 1T1ZB 4A2LA 4DWSC 5HYJE 2X8RA 4RA3A 3CMJA 4J3SA 2ZUWA 5EORH 1MAKA 5GQBA 5CD5D 4G8GE 5C71A 2DSVA 1NFKA 4YN5A 1T7ZA 4MAUL 4XP1L 3TYFA 1EHAA 5FECA 4E5XB 4Y5YA 1YQVL 3WD1A 2ZUUA 5DJAA 4PG9B 3L3HA 3L95A 3MRBA 2MQCA 4OCXL 3BZFB 4EDWH 2HKHL 1HK6A 1DLFL 4QNPE 3CMOL 1YPZE 4HKZB 2J3SA 3UX9B 1NL0L 2Y7QA 1LEIB 1SEBA 1J86A 3T09A 1IEBA 2OJEB 1R3JA 3MRMA 4P5TD 4PJDE 1T2JA 2YPVH 1XH1A 4HJ0D 4S3KA 1U91B 3LH2H 1FG2A 5J7CC 3HNVH 1ZVYA 2FATH 4AM0B 1B2WH 2CHNA 3JUGA 3BP4A 2CD0A 5JPMA 3GSWA 1BZ7B 3FO9B 3DSFL 5C07A 3LKSB 5CEZL 1CN4A 4YQXL 5IR1B 4XT1C 1KACB 5JZ7D 3OPZL 3O6MH 1DVFD 3PJSB 5D6DA 3C8KB 1E28B 4XX1G 5GGVL 2WMGA 2OL3A 5JQ6H 2F5AL 1ES0B 1WVZA 3LN5A 1FNSH 4WGWB 5C3TA 3TN0B 4WEBH 4X80L 3WFZA 1CBVH 1VFBB 2JJSA 4WIWA 4XP4L 1ZA3A 4L8DA 3ZTJG 4HUXB 4LAJH 1YEIH 3IJHA 4OM1H 5GS0H 4B3LA 4XH2A 3S35H 4JM2F 3G6AA 1H5VA 3AFBA 3C2AH 3MZGB 1MOEA 1MFBL 1PQZA 3D0VA 4BELD 4KZDL 3GSXB 3GSNA 4L9LB 3VXQA 1ED3A 1UB5B 3CUPA 5TPWH 3HLAA 2A3AA 1VA9A 1QEWA 1F5WA 4N5UA 3AIUA 4AZ5A 2GT9B 1LO3H 5E2UH 1UXSB 3DMMB 5FCUL 2I26N 2BVPA 2OI9C 1MAMH 1MRFH 4OLYH 5HBFA 5EN2A 4C56A 2QTEA 4S0TD 3TGXA 4YFDB 3W9EA 4PJFF 4YXLH 3UYOD 5TDPB 2XSAA 4LEOB 4AIZA 1FPTH 4MA1B 4DGIL 4HZAA 1KR0A 5D70H 1Y6NR 3O6AA 4XTRD 3G5XB 2PXYC 3VD4A 2IWGA 5CGMA 4FMKA 5K9JH 2AVGA 2O9RA 4M24A 1HHKA 3EFFA 4BFIB 1GQIA 1I9IH 4PJ9B 1YN6A 3TBYB 4PB9H 4RBPK 4ZD3L 5KVEL 2VDKL 1FZJA 1AGDB 2DYPA 1NJ9A 3FN0L 3L7FB 5DI8A 35C8H 1X6LA 2VDRH 2C1OB 3EGSB 2KQNA 5DRZA 2XICA 1JNNL 5EG6C 4FQHB 3GHEL 1KJVB 1NCDL 3IU4L 1E0WA 4Z2JA 1M1SA 4JFDA 5JXED 4XNZC 3W0WB 3FT4A 2IH3A 2Z8VC 3BAEH 4AG4L 3ZE1E 5ANMA 1BJ1H 1ZSDB 4KPHH 1HJVA 1MCLA 1F2XK 1OD7A 2VYRE 2X41A 4Z2IA 1H49A 1IT0A 2YUVA 5AAMA 2UZYB 2YA1A 4ZUUB 3BI9X 4R7DA 3NFNA 2Q8BL 3EYVB 4HCRA 4F2MA 2YD2A 4RNRB 2GJXA 1S7WB 3DI2B 3ZJ6A 1NGQL 2VT0A 2VLMD 3N06B 1XF2B 2VX6A 5CJQL 3QBTB 3P73A 5I17B 4HA1A 3DV4B 4D0DB 4HFWA 4PR5A 5DGRA 3WUFA 1KC5H 4ODHL 1ONQA 4PJEB 4ZFOL 2WBJC 1R75A 4RQQB 5F7MC 4L8BB 4Q9QH 4G6FD 3EMCA 1E6JL 3MBEC 3B9KC 4QF1B 5ITBL 4S1SL 5JOFA 4LFHD 5A3ID 2H32B 4R2GD 1I7ZB 2HT3C 1PG7X 3HZKB 5GIRB 5GS1C 1C3FA 2QQLH 3LXAA 4KWUA 5D1ZD 4RBPH 5T3ZE 4S1DD 5DFTA 3AZRA 1OD8A 5MERB 1ZHLB 1HDMB 1S3KH 3HUJF 3RWCB 5E2TL 3WXWH 4DO5A 4MAVA 3SUWA 1U42A 3STZB 3ARGD 2NY5H 4JHBA 4YHPA 5J8OA 1UKSA 2PI6A 3OKNA 4OJFH 3AIWA 5C08E 1QNRA 5TQ2H 1JYVA 3C5ZA 4HPOH 2DJ4A 3R06B 2CDFA 1ZT1A 1NCAL 4X6FB 2AMGA 1OAXL 3IDNA 1EFXA 2CKBA 1MHCB 1WE5A 1NMAL 4RCAA 3WF0A 4R6UA 1FJ1B 2YPKB 3DX1A 1TJHH 5I8EB 1E5JA 3BQUB 1XR8A 1MJ7H 2V17H 1RVFH 3NSNA 3OGRA 4I5BA 2OYKA 4KK5C 2EECA 1I75A 3IVKB 1TUXA 4XWOC 4I18B 2WIIA 1T89C 3SO5A 5GGQL 2B1HH 1HSBB 3V7AG 5HHOD 3EDDA 4OCYL 1T21A 4PBWD 3EMZA 5L6YH 2ATKB 4FN0A 32C2B 3RKDD 3SO3C 4PS4H 4QO1A 4IOFC 4PN2A 3CX5J 1JK8B 4TUJA 3LRMA 3AREA 3GSOA 4NX0A 1OIFA 4OKVB 5EWIL 4U1IA 3HFML 4XAKE 3NDZA 1FYTD 1ZTXL 5F1NB 4U7MA 5ESAB 2VITA 4Z5RA 3AQUA 2VRJA 1TQUA 3WNOA 1FNEB 1JZ8A 2CNCA 3FQRB 4U6TA 3AHZA 5HBBA 1L4IA 5C7XH 1XH3A 1E4LA 4GSDH 2HLFC 3QWQB 5I74B 2WKGA 4CVXA 1F11A 4HBQA 4FK9A 2OK0L 5KN5A 4P2OA 4LEXH 2GHWB 2XZCL 2YDQA 2A9NH 5IMLA 3VE0A 1H15A 1MQKH 2E0PA 5HHQB 5CKAA 3A67H 3GNRA 4HWEL 1OP5H 5J4MA 4NM8L 1M7IB 4P4KC 5DJ2B 1INDL 5JTWA 2EXYC 4U6HA 5C8JA 1CTOA 5F7FA 1Y0LA 4FNUA 4ZFFA 2ZNXA 1P7QD 4UTAL 4KI1A 3KPLB 3I6GA 3MLTA 3MV9A 1QYGH 3MRCB 4FZ8H 1KB5B 5CZXC 5BV7H 4NJAL 5CBAA 1UASA 5GRJH 3RPIA 4Q6YA 3GH5A 4I77H 3GMPA 3EJJX 3N1QC 2E27L 3MMEA 3SBWA 3QYCA 2F7QA 4KKLC 5BZWA 3GUTB 3BD4A 4OZHF 4YHML 3CFBB 1JWSB 2COQA 4LYQA 3KL3A 4C54A 1WC7A 4Y19A 1QSFA 5ADPL 3OZOA 3RUGA 5C0CA 3L3IA 3KS0J 5DFVD 3QIBA 5T33H 2GK0B 1K8DB 3CUIA 3TNMB 2YUZA 3GNMH 1E70M 4OI8A 1A0QH 3LPOA 4OCSL 2YKLL 5C0BE 2W0LA 3BVNA 4F7CB 4ZDHB 2VC2L 1F2QA 2F18A 2RBLA 3TFKD 1UH2A 3H42H 4TVPE 3G6LA 2EDYA 2L7JA 3HE6C 5J6GB 5JHDA 5C08D 2PNDA 1W72L 2PB1A 5BJTA 4GG6E 3QEGH 1QG3A 3D87B 4HWZA 3DGCR 3QPQC 5D71L 3DARA 5D96C 2CBIA 3CC1A 1KEGL 4Y4HD 4WWID 4R3SA 4V1DA 5A16A 3DUHA 3TT3H 1YEDA 3FQWA 2ALWA 3TONA 4HPHA 2D03H 4Z0BL 5CSZA 5DURB 2AEQL 4FQJL 1QNQA 1JRHL 4D71A 5I1AA 3O0RL 1TVDA 4PRPE 3ZKMC 2HT2C 1U3HA 1FFQA 3IRPX 3VWJD 3ZL4H 3HS0A 1TTUA 5FECB 4Y5YB 4PRIE 1IM3A 1KLUA 5DJAB 2G5BA 3L3HB 3L95B 3MRBB 4JFWA 4WEMB 1RIUL 2QMJA 4NQDE 4OCRH 2Z1KA 2WWKT 2Y7QB 5GGTL 3O2DH 1SEBB 4QXUL 2YBTA 1IEBB 1C16A 1R3JB 3MRMB 1TNNA 2DI7A 2Y1VA 4Q7DA 3WJJA 3V8CA 2IGFH 4PJAF 5DRWA 5F89A 5FM5M 2W4XA 2ICCA 5ISZE 1HNGA 3HB3C 1FG2B 4U6XA 4DQOL 5J13C 3WFBL 4KXZH 3RWFA 3BP4B 5E9DE 1FFNA 1GHRA 3BOVA 2AJSH 5JR1L 5JPMB 3GSWB 4QAWA 3FOLA 4LARH 4ODUA 1UA6L 1I9EA 4MD5A 2DT1A 2NYYD 3AXLA 2B2XL 5T3ZL 1YEFL 3OJVC 1I1AC 3ESUF 3T1WA 3K46A 2DLTA 1I4FA 2D7TH 4IOIA 1MIEL 1AR1D 3LN5B 3SCUA 4L9DA 2PW1A 1ZLVK 3S96A 1JGIA 1GIGL 1T1XA 2VLKE 3UPRA 4E41E 4L8DB 4P5TA 5KS9A 1N8ZA 3IJHB 4JZNA 1CE6A 3LRSA 4XH2B 2GY7B 3G6AB 3OAUL 4HKJA 4DW2H 1DBJH 1QFWL 1PQZB 3D0VB 4DN3H 4FNLH 2NPLX 3GSNB 5BO1H 3VXQB 1ED3B 2ADFL 3CUPB 2XPKA 1A3QA 3HLAB 2ERJB 1QEWB 4IRZL 3IF1A 4F9DA 3GRWA 3RJQB 3DSNA 1JTTA 4YHLH 1GQLA 5F7KC 4BZYA 2BVPB 5GGRY 4P49A 3VDCA 4C56B 4G6KH 2QR0A 2P46B 3W9EB 5A43C 3RM8A 2V5RA 5L2KA 3T3PE 5C0BD 4XPTH 4AIZB 3OZ9H 2B39A 1P2CA 4JKWA 1BFNA 2IQ9L 2ZOKA 3O2LA 5TE4H 5LA2A 2VCBA 1RZ8A 2ESVA 4I48A 2YBRA 5A6MA 2PUQT 5FOOA 3HRZB 5A69A 2NZ9D 3O8XC 3S97C 2DOCA 2G5RA 3ZE0F 1UA7A 4MB5A 1HHKB 1YN6B 5GGSA 3BH9A 5IVXF 5JA9A 1T4KA 4JAMA 1NMBL 3Q3GA 3PZMA 3KYKL 5IEKA 1OL0A 1WZAA 1FZJB 2DYPB 1NJ9B 5DI8B 2DTML 2DQEL 2VXTH 5DRZB 4LOUD 1DWHM 1ZOXA 1E1EA 4PRPD 1H5BA 3SIMA 4JFDB 4OOUA 2EO1A 3FT4B 2HMIC 2IH3B 4PJ8C 4XCFH 2O5YL 5ANMB 1JHTA 4PRID 4NRRA 3CK0L 3TPKA 1GOQA 1WZLA 3EDKA 5I30L 1RURL 5T1LD 3LVEA 3H9ZA 3EUUA 2P43B 1U2CA 5CZVH 4R7DB 5E8OA