2FHBA

Crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltose
Total Genus 340
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
340
sequence length
1052
structure length
1052
Chain Sequence
DVVVRLPDVAVPGEAVQASARQAVIHLVDIAGITSSTPADYATKNLYLWNNETCDALSAPVADWNDVSTTPTGSDKYGPYWVIPLTKESGCINVIVRDGTNKLIDSDLRVSFSDFTDRTVSVIAGNSAVYDSRADAFRAAFGVALADAHWVDKTTLLWPGGENKPIVRLYYSHSSKVAADSNGEFSDKYVKLTPTTVNQQVSMRFPHLASYPAFKLPDDVNVDELLQGETVAIAAESDGILSSATQVQTAGVLDDTYAAAAEALSYGAQLTDSGVTFRVWAPTAQQVELVIYSADKKVIASHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPEGWDGLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAQESNMVQHLKQLSASGVTHIELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLTQLKQNDSKDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMLYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDAVRGGGPFDSGDALRQNQGVGSGAGVLPNELTTLSDDQARHLADLTRLGMAGNLADFVLIDKDGAVKRGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRSSDDGSNYDIIARVKDAVATPGETELKQMTAFYQELTALRKSSPLFTLGDGATVMKRVDFRNTGADQQTGLLVMTIDDGMQAGASLDSRVDGIVVAINAAPESRTLQDFAGTSLQLSAIQQAAGDRSLASGVQVAADGSVTLPAWSVAVLELPQGESQGAGLPVSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of pullulanase: evidence for parallel binding of oligosaccharides in the active site
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords pullulanase
total genus 340
structure length 1052
sequence length 1052
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2005-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fhbA03
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2fhbA01
2.60.40.1130 Mainly Beta Sandwich Immunoglobulin-like Rab geranylgeranyltransferase alpha-subunit, insert domain 2fhbA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fhbA05
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2fhbA04
4QOKB 2EIEA 2ZIDA 4XAWH 1SBBA 2HG5B 1KPUB 2D0GA 2R23A 2EICA 3GB7B 3MA7A 1HXYB 5EUKA 5DT1H 1RFDL 1FFNA 2L4OA 4JM2F 1TMCB 3SY0B 1D5RA 2AERT 2EDQA 1XSJA 4YHIB 1CCZA 4UZGA 1TENA 2DQIL 5IVNA 3N06B 5JHDB 4WK9A 3ISWA 2Q76A 3LXCA 2F61A 1KNOB 12E8L 1GC1C 1PZ5A 2XIBA 1XCTB 4HDIB 3OKLB 2NZIA 3X3FL 1JI1A 4XCFH 2J72A 3EJUA 2PYED 3VGDA 1YY9D 5EIIA 5HYSA 5SWSB 4EXPX 2VIRA 3IJ9A 3ECBA 3WFCH 3GFUA 4PRIE 5H35B 2E9JA 1CFQA 1MCOH 4PJXB 1DR9A 5GGSY 3VMOA 1OGAE 2GW5A 4ONFL 1NCDL 4EXKA 5A2FA 2QJDA 3TBVB 1V3MA 5GZOC 3MMWA 2YXMA 4U1LA 2OLHA 4GKSB 3WV0A 2G3NA 2V3GA 2ADFH 2NY3D 2PN5A 5L0QB 2Y8KA 4M03A 5FGCB 3AIVA 2EYRB 4JRYE 2X7LA 4GS7B 5ABFB 1Q9KB 4F9JA 2AVGA 3MRQB 1I7UB 4U1IA 4ZQKA 3W24A 4YXHL 4XX6A 1A7QH 5EG6C 2A9MH 3QNZA 2AK1H 4HKZA 1Z9LA 3FQTA 2VLLA 2Q8XA 3KPSD 3VDBA 5TH2B 3GI8H 1I7RA 5K9KA 4JDVA 1KPVB 2VT0A 3D39B 3SE9H 3R1GL 1IV8A 3RWIB 3DX3A 3KE0A 5I1EH 2C4XA 1KBGL 4J3SA 4RISH 3VXUD 4UNIA 4E8CA 3MV9A 2UZXB 1LQSR 4H5SA 4UTBH 1RHHB 4NCC1 4MWFA 4N90E 1RUMH 5CGYD 4MDPA 2AXJA 3QPXL 2PYEB 5IJKC 2AJVH 1N7MH 1U8IB 4GXUM 4QRUB 1Q0XH 5E8OB 1Q4NX 4S0TD 3F12B 4ZUVB 2QTEA 2AKRA 4EI6A 2Z35A 1Q0XL 1A1NA 3O3AA 4P5KA 3PV6B 4U6XB 3BVWA 1MAKA 3KEHA 3B8YA 1EGJL 1NAMH 1Q72L 4LKCB 5TQ2H 3DBXA 3LD8B 4LYRA 1U3HC 4N0CC 3O11A 2H2PC 3U1SH 1S9XB 5B39B 3IRZA 1JDCA 3FFCE 4YDVA 2HMIC 5E8OA 5BRQA 4PRPD 3MRFB 4N0YH 3BH8A 3QCTL 4YHOH 1A7OL 4P0DA 4QOKD 4RE3A 3UTQA 4Z7WA 1FYTD 2DLIA 3HFMH 1CXFA 5BW7A 3K74B 3Q48A 4D0BA 1F00I 4FZ8L 3ALXA 4KXZH 4PRIA 4U1NA 1XHGA 4QAWA 4P2QD 5A8OA 3MSGA 2YL6A 1NQBA 5TE4H 4ELMF 2F74A 3FQXB 3WCYA 3RGVD 1US2A 4DKFH 4FTVB 4HUXB 1DBAH 2O92A 4P46D 3RIFF 5JQ6L 1DBJH 1NAML 2EC9U 1YPZE 1V05A 4Y2DB 2X7LB 2XZAH 4NFBA 1NDMB 4H0HB 1GGIH 1FCGA 3I2CH 2DQFB 2J7CA 1UQYA 4U2YA 1BLIA 3W0KA 2WIIA 2XVPA 1ORSB 1YEDA 5A69A 5F7FA 1N7ML 4HWUA 1FNSH 3HS0B 2H45A 3ECBB 1QBML 1GYAA 1T7VA 2VDOH 4Z7QE 4OF5A 4P4RB 1L0PA 3S4SB 2WB5A 4M29A 2Y8VA 5HDRA 3OAYH 4KRNA 4IISA 1L0QA 1D6VL 1DHKA 5BZDA 4KTEH 1BGGA 3AREC 4XZUA 1OF2B 5IBTL 1QNRA 5DYOA 2OZ4A 2IAMB 4HD9A 1JRHH 2BVOA 1FRGL 3K2UL 2CJUL 3LN4B 1WITA 2WSKA 3UEZA 4CVZA 2I60L 2RAMA 1A1NB 4HU0A 4HG4J 1ZGLP 2J43A 4GUPB 4PJGB 3T4YA 2OSLA 2VR9A 1ZBCA 2P45B 5E2TL 3OJ2C 4LLQA 5JIPA 1GVYA 1MHHA 4CW1A 4Q9CA 3TFKD 5I73C 5LVEA 1OAZH 5IROA 3O0RL 3P0GB 5AD0B 4NNYB 5DJAA 4CADB 1CF8H 5K59E 1JBJA 4XMKH 4KK9D 2O9RA 3O9WD 4JLRB 3NPSC 1YEFH 3AWEA 3FB5A 1U8IA 1P9MA 4YC2B 3G6AA 1BFSA 2E9IA 2UY6A 1FGVH 1GHSA 1V7ML 5I79A 3C09B 1C7TA 1DFBL 4K3DL 4WHDA 3SDDD 1WWCA 5IB3A 3IJSB 2XPGA 2IAND 3PXJA 2EYTB 1I3GH 4FHBD 3IKCA 4PRID 3MJ6A 3CSBA 3VGGA 5I74B 1B4JL 1CT8A 1N2RA 4Z7NF 1E6OL 3T1FB 5BXFA 2ESVE 2CK2A 1U36A 4UV4L 5TFSL 3VWKD 5I2IA 5JW4N 1BAGA 3QIWA 4LVHB 1H41A 2IANE 5EU4B 1G01A 1JP5A 1KJVB 1GGUA 1KCSL 3ARDB 1B6UA 1W8OA 1ZT1A 4MA1B 3RDTD 1P7QD 4KHXL 4FFWD 5KTEH 3P4NB 2IPTH 2YK1H 4GSDH 3GBMH 3ECQA 3N1AA 1FIGH 3HZYB 4Z2HA 3VU2A 4H1LH 2PF0A 5T3XH 5HGDA 2XOTA 1ADQL 4UQ3A 3V5KA 2NT1A 3AS2A 4MXWL 3SO3C 4L4OA 4WW1B 4M1GL 3I6LE 3KPQA 5GNXA 1WF5A 2XYCA 1R75A 3UTTE 1MFAH 1I9IH 4K3EL 1UVQB 1D5BA 4L29B 5E1AA 1P6AB 2L0DA 3F5LA 3GMNB 3WHXB 4HKJA 1MFEH 4JFPB 2VN7A 3STZB 1K8DB 4UIMA 3IGAA 5I30L 1NOWA 3KJ6H 1HQ4A 2CPCA 4U1KB 2Y07L 4RRPG 2J6EH 2ZX6A 3ULUD 2PCPA 5IF0B 1H0IA 2PF6A 1WFTA 2DIBA 1KIPA 4HX1B 3QO1A 2X1WL 2HKHL 4LYPA 3VXPA 1JAKA 2HJKB 2VCBA 2GFTA 3SJVB 1U2YA 3L3KA 1JNJA 5I23A 2BSSA 4HPOH 4E41D 4AH2B 5C09B 3ARVA 5IGXH 4XPFL 1NSNL 2ADGA 1TXKA 1QFWL 4AMKH 3CVHL 3W9DB 5BW7C 2C26A 2X70B 3VH8A 1U8NB 5AWNL 1I3VA 3CUJA 3ZE0F 1TZIA 5I1AB 1EK3A 4Y5VA 4ZXOA 2DSWA 2X44D 3M8OH 4X9YA 3O0RH 2G3JA 2HT2C 3VD3A 4C7FA 5GS1C 1BF2A 2XTLA 5AZEL 2CO6B 1P2CA 2VXSL 3PHQB 4JANA 3PWVA 4P9ML 1P7QA 1O7SA 2B0SL 4FG6C 4JCLA 2VZUA 1P5VA 3FQRB 1JF1A 1HIMH 4LHUB 4XV0A 4H26B 1BQCA 2ZUQC 3MLYL 1W3KA 1QP1A 3VWKA 1Y7VA 1D9KA 3B5GA 3B9KB 4FQJL 2P7TB 4JM2B 3IB4A 5J1SC 3V4VH 1BECA 3UPRA 2ZSWA 1HHIB 4KAQH 4PMQA 3DRTB 3BP4A 1E4XI 5EZIL 2OBGA 4HT1H 2DL9A 3EJYD 3VIOA 4JREB 3BUIA 3V6FA 3MACH 3WH8A 4U6VL 2WK2A 3PQYA 3SQBA 1QBMH 2LVCA 4WW1A 1HKIA 4YDIH 3FFCB 3SQOH 3QCUL 1RZJL 4CDHA 2V3FA 3I3DA 1A4KA 2DLEA 3W9DA 3HLAB 4A3YA 1R3HA 3CPLA 2CKRA 1ISVA 4WDIB 3CO4A 4QRPD 2B7DT 1VGKA 3LRSB 4UQBA 5SWZD 1ZT7A 3G08A 3A4AA 1IEAA 1GQKA 1N0XH 1AQ0A 4WTZG 5DA4A 2BNQD 2BERA 3SKUD 3SCMD 3NUKA 4Y5YA 3K46A 1M05A 5IROC 5TQ0L 1A4KB 1VACB 1NMBH 1VEPA 1T1YA 1A6PA 5D8ZA 1F45A 3PNWA 2YC1B 4KI5C 3ROOA 4K7FB 2B1AL 4P8VA 4H0IA 4P2QE 4RAUB 1GHRA 1JRHL 4BKLB 2CXKA 2I5YL 3PHAA 2IPKB 5C07A 1OGGA 3S88H 4AENA 2WLZA 4I1NB 1MVYA 4J3WA 4I4WB 4LCWA 2YXFA 1BG4A 3TIDB 1ZHNB 2Z91B 4W7WA 3KPMA 3FZUC 2K7PA 4OZHB 1BZ7A 1SM3H 4OKVA 1UKOA 2Q6WB 5IFJB 2J4WH 4JFEA 2EH8H 3LSOB 1J0KA 4MD5B 2R0ZL 4PY7B 3BPCB 2E27H 1JF1B 5L9DL 5EZIH 2OK0L 5L8LB 4JFDE 4YE4H 3L95A 2YBUA 4WHTB 5FYKL 2EDBA 2XWBB 3VW3H 4M7LL 1KC5L 1LP9A 3UG4A 1UWTA 4PG9A 3MYJB 1G6RA 1WIOA 2VXTH 4TUKH 2BSTB 1XGYL 4JHBA 3GSNH 4DGIL 5F7HA 3JWOL 1YJDH 2ZUYA 1J18A 1HWHB 3PWPD 2X1OA 1XFPA 4Z77A 1NH6A 4R4BA 5J13C 5A94A 1NDGA 3T4AB 3M1BA 5JBEA 1FN4A 1ZHKB 1AGCB 3KYKH 2YIHA 4LRNL 5BYWA 5M5DA 2VLKA 4JO1L 3VRLF 3C8HA 4YFDB 4MJ6A 1RP9A 3U7WH 3V4UL 4XI5D 2A3HA 3GMQA 5AWNH 2MOVA 3D87B 4G9FD 4JG1L 3CZGA 4TULH 1ZU8A 3S5YA 1MCIA 3IF1A 2XHYA 4POZD 3BKYH 3H9ZA 4NUJA 3RM9A 3HC0B 4WEMB 1CLOL 5EBMB 2OX5A 1TITA 3HUJA 4LVNB 5FOBA 4W68A 2NW3A 4PMRA 1A3RH 1QO3A 4KKLD 4YHLL 2VAAA 1YC8A 4URIA 5IQ9A 4U7SA 2ED7A 4PGDA 5DQJB 4GI8A 4OLUL 3MUGB 4XGZB 4XUYA 5I78A 4MA7L 5HVHC 3CVHB 2OTWA 5E8EB 4DZBA 3W2DH 5FCZA 1JMZA 4W86A 4GMSH 2E5EA 2VDNH 5SWQA 1JV5A 4Q9QH 3OKMA 2I25N 5ALCH 5DUBB 3U30B 1XYFA 1T5WB 4E0RB 2P8MB 2E3VA 4CMMB 1S7WA 1AD9B 1MVUA 1NC2B 4OD3L 4LPXA 1W9DM 5L7XH 4KV5F 4DWSC 4HXAL 1J5OH 1K85A 2HMID 1D2KA 3Q6FB 4U33A 4XNYL 1JF5A 3C5ZB 1MW2A 3W38A 4QRQA 1W91A 5I74C 1ZA6B 3OV6A 4HJJL 3D25A 3QEGL 4HXAH 2ATPA 1J5OL 5HHNA 1E4LA 3L3HB 2NY6D 2WCGA 5D1ZC 1TG7A 2Y1VA 2CKBA 2XWTA 4FFZL 4OQTL 3KXFB 4M6OL 2VC2L 4ONOA 4C56A 1PG7X 1UR2A 5DRNB 2F74B 4HIXL 2BC4B 4WY7L 5DFVD 1KIQA 4JFUA 4Z7VE 3IDGA 3BJLA 2UVEA 4Z7WE 4R2GD 3C08L 3RGVC 4M6AA 1DCLA 4X5WA 3A47A 5CXPA 4GRLC 2CCRA 5J0BA 4CNIB 5CJXA 4FABH 1A6WH 1GGYA 2J5LC 2UYLA 3DDFA 4D0DA 1T21B 3F7YB 3JBG7 2YBRB 1JD9A 4OFIA 4NGHL 4CUCA 2ORBL 4NWUL 1WAAA 4PJGA 3X14B 2W9DL 4P5MB 3BVVA 2R69L 2X41A 4NHUA 2FL5B 3RTQC 3IU4L 5JOFA 4QTIH 4LLYA 3HAEB 3WH6A 5KAQF 4YBQD 4PRPE 4MAYB 2F8XC 5E2TH 2WWKO 3PZQA 4WEBH 2FR4B 1OY3B 3CXHK 5FYKU 4TULL 3U48A 1ZJAA 1EFQA 1EUTA 3IT8D 4P2YA 3V0AC 5IB5A 2OW7A 4NQDB 1PX8A 3G6AB 2BNUA 4RZCB 1I8KA 1OSZB 5C0BD 4W8BA 3FJTA 1W1YA 2V2WA 4CN4A 3AIEA 1XSIA 1IKNC 5DUPL 2Q3AA 4LRNH 5GRVK 4HH9A 1YPZF 1LO0L 1I1YA 2R2BB 3E3QC 4W6WB 4X98A 3KNBA 3V8OA 3S37L 5D93C 1BD2B 4QTIL 1WBXA 1JGUH 3GEWB 4ENEC 3EHBD 3LMJL 4PY8I 4BA8A 3MA9L 1U9KA 4N90D 3MLTA 2ED8A 3UTSA 2CK0L 3TZVB 4B7IA 5CP7B 1ES0B 3C6LB 4N8VG 1NQ6A 4PJ5D 3GSOB 3DX8B 5C0GA 3RVUD 3RMEA 3T3ME 4UAOC 4NKIH 5C08E 2FGWH 4HOZA 1ODAA 5KVEH 4Z7VA 3T0VA 1JD7A 1I3RB 1SZNA 5FV2A 3D1MC 2E7BA 4OI9A 2YKLH 1PFCA 3B43A 4YBHA 1U33A 5E9DB 5CAYB 4XVSH 4MQXD 5GGUB 3WJJC 3DX4A 1AFVL 3QPQD 1JZ8A 4D8PB 1MFCH 4BK4A 4A6YL 5FKYA 3VXNB 3ZE2F 3BUTA 5DJ6B 3K81A 2NXZB 1NEZB 3VGBA 3BN9D 1WEJH 4WFFD 2AJ3A 2E3ZA 3KYMB 4A4AA 1EZVY 2QKIA 3RP1A 2P8LB 1C16B 4O2CB 4R26L 3AHYA 3QO0A 3KWXA 1QYGH 4XVTL 2V5DA 1UWGH 1JXJA 4ODUB 4YH6A 4KRLB 4UQCA 3PP4L 3H3BC 4P4KB 3PZGA 2J88H 4TOYL 2YD6A 3DI2B 2WCAA 3C6LA 5C0AB 1NEZA 2HKFH 1LEKB 3FL7A 1UFUA 1VEMA 2OK0H 1PY4A 2CIIB 4ZUWA 3BP5A 3RDTA 3BD5A 5I1LA 2D0HA 3OAUH 2OR7A 3QFDB 1ESWA 2PYEE 3WDIA 1AIFB 3U82B 3WN5C 3QDAA 2DSVA 4CD7A 3SDCC 2KZWA 3CFBA 3A24A 4RMQA 4LIQH 1QFWI 4Z7UF 5J8OA 1NLDL 2HFTA 4LDOB 1XGQA 2KZ1B 3F12A 4ZUVA 3VG0L 2EIZA 1DN0B 3HU7A 4NN5B 5D96C 4XZWA 3PZVA 1SYSA 5D1ZD 2CDEA 3IU3B 4NO2A 4YHKH 4OQ1A 4DZ8A 5F1NA 4OGAC 2E6PA 5EU6D 1T04A 4BQ4A 1RK1A 3F4VA 2D0FA 3EFDL 5FV1L 3BIKA 1UHVA 3RM4A 5TPWL 4YHML 4O2FA 3PJSA 4NSKA 4PJAA 4U1JA 1MRDH 2A3EA 1FZOA 4TUKL 1ZA3B 4UIKL 4TX8A 5DSCB 2D4FA 2R1YA 4G8EB 5IIEB 32C2B 4MDIA 2EC9T 3OR7A 4NYLA 3VM5A 1RIUL 1BD2E 5EB8A 3KLHD 5T3XE 1UWEL 1VFMA 2EDEA 3DETD 4NF7A 2HJLA 4HSQA 2ICES 2BZDA 1ACYH 2D31A 4MWFB 4OZHF 1RUAL 4ORZC 3B8SA 2AK4B 2IBBA 4RE2A 1IAMA 3L5XL 4OGYH 3AAZA 1AXSA 1P6WA 1EMTH 3RUGF 1B2YA 1MH5A 1JNHA 2X4SB 3MJ9H 4FMFA 5T1KD 3W11C 2ZWYA 1PBGA 1RFDH 2EPLX 3OAYK 3O41A 3T2QA 3WO4B 4JRXA 1M04A 4HIIA 5ID1A 1HCVA 1FNGB 4IOFD 3FONB 4KU1A 6CGTA 3RWGB 4U0RB 1CICC 4I5BB 4OLXH 4D1JA 5J6GB 5GS1A 2EIDA 4YNYA 5IB4B 2RB8A 5HYIA 3F7VA 5DQ9B 5T3XL 3S35H 3MANA 2WUBL 3SGEH 3W0WE 1R3LA 2VR4A 1CE6A 5T1LA 3V0HA 1VADB 3BVUA 5DWUH 3CU7A 1WWBX 2P24A 5HPMA 3FQRA 1J11A 2EPKX 2CD0A 4JKMA 2YA1A 1RZFH 2C3VA 5JIIA 4KDTA 4UT7L 4XNXH 3RNKB 4G8IB 5IGXL 4NN7B 3LKNB 3MRRB 4MJ2A 3DTXB 4P49A 1KB3A 2G75B 2Y5EA 3ESUF 4M62L 1FZJA 1SMOA 4Z2KA 4JO3H 2R29H 4Z0BL 2G3IA 3MLWL 1CDIA 5DHVA 2ZOLB 4XNMA 3T0DA 5JDSA 1Z0NA 1JDDA 5DRXA 4Z0BH 4YX2H 3SCMA 1F11B 2BHUA 5C09A 3MMUA 1C7SA 4DOHB 3BZFA 1H11A 3T2OA 2PBGA 4GAYA 1ZHLA 1QA9A 3P11L 1B3ZA 2Q8BL 2R4RL 4M56A 5SX5H 5DD3L 3WMBA 5CJ8A 4U1KA 4F15C 5M3WA 4BF7A 1EFXD 1TCMA 3EO9H 1WISA 4IDLA 3EYQC 4ZFOA 4PGEA 1C92A 4JFFE 3VFTA 3OKLA 3RA7H 3U5YA 4KI5D 1UH4A 5D6CB 4GG6A 1V02E 1T1XB 5DVKA 4LRIC 4G6MH 4LAQH 5GGVL 5IB1A 2PWHA 2GJRA 3TESA 3WIIH 3DX6B 2OS7A 2IPTL 5JZ7C 3MNZB 4BZ1H 1EXUB 1PKOA 1KB9K 3MRGB 2EH7L 1HKFA 1TZIB 2AJUL 5I6XC 3WFBH 4JN2B 5KSAC 2BRRL 1U3ZA 3G6JF 4WF7A 5F7KC 2ZX9A 3GHEL 3LS5L 4BCEA 1BEYL 2WP3T 4Y16D 2VLKE 4OGXH 4AQ1B 3CGTA 5KVDL 5D7IE 2VQTA 5FA4B 3I6KB 4NJ9H 3QO1B 1M71A 3SDAB 4IMLA 4LHJB 3TA3C 1HIZA 2YL5A 3KJ6L 4OZHA 3HE6A 2I9TB 3A0OA 3MI6A 1LJYA 1RZGB 1R3HB 3ARGC 1S7VB 5IVXF 1D5IH 2WLYA 5DJCA 1OIMA 2AJUH 5KBNC 3RWGA 2A83A 1QW9A 4HKXB 5DHYA 1IZJA 3VXRA 3RBGA 4QXTB 2J75A 5GS3A 4X83A 3E8UL 1CD1B 1BX2A 5E94B 3QRGH 1VDGA 4J1UB 2AXGA 4JCMA 4LSRL 3EO9L 1QNQA 2B39A 2WMHA 3BH4A 3N9KA 2BSSB 3SCWA 1N3NA 1KGWA 1UJTA 4XP4L 2C3VB 2X0YA 3POHA 5DI8A 1A9EA 1OP5K 2AK4A 1IEAB 4ZS7L 1MVFA 4JANB 3U7AA 4LLUB 1P7QB 4F7PB 2IADB 2EE6A 3V95A 2B2XL 2Z91A 2FDBP 5FHAL 3TVMB 1S9VB 2ZJSH 2WSPA 4WUUB 2GCYA 3DXAD 4PJHB 3NZHH 5I16B 1VESA 1DQMH 3O3DB 3VVGA 5JOPE 3IFOB 3ARBD 5F7NC 4GO9A 2BXZA 3GMMA 1NAKL 4U6YA 3S5ZA 1NKRA 3BP4B 4ODVL 5CP3H 5A6KA 4F7EB 1FVDB 4V1DA 4KK5C 3EOAB 1BJ8A 4OLVL 1CFNA 4UQ3B 2NYYC 3QPXH 4OM1H 4EDXB 4IHOB 3Q5OA 3D39E 4OM0H 4AY1A 4D0CA 1R3LB 3KPMB 3W5MA 3HLAA 3CPUA 4PUDA 2B4CL 3ZYZA 5LQBH 3O9WB 1JGDA 1O7AA 2VUOA 3LRSA 5CPTA 5ERWB 1IGMH 3NH7L 3U2SB 1EFXB 4UFKA 3WMSA 4GRWB 1HP5A 2Z1SA 3NN8A 5D8WA 2BOBA 4GG6F 5FEBA 2EXYC 4U7KA 3QWQB 4KJYB 2HLAA 1R46A 5FIEA 1ZHBA 5J1AA 5HDBF 4UV4H 5TFSH 3RVUC 5MHSE 3S5LA 5BUGA 3L3OA 4C7GA 3U0TA 1NUFA 4NQXB 5A2JH 2C1PA 4P3CL 1RJZA 1NCAH 3BPCA 3GO1H 4LLMA 4NC0B 3UJIL 3G04B 1G1CA 3NVQA 3PXHA 5E09A 4PJBE 5FKPA 4L9LB 5I1CL 5IMKA 2R0KL 3LKRA 2UZIH 3GSVB 4GQRA 4XBGA 3PQYB 1Z3GL 5DHYB 4QHMA 4JPIB 1J05A 1T7ZA 3VGEA 1DBBL 2HTKC 4Y4HC 3S4SG 2Z31D 2EO7A 4AD1A 4U4BA 5C0AE 2BOCA 3H3PL 1H5VA 4HJGA 5TE4L 1QSEB 5FO8A 3AVEA 4Z7UB 3BLPX 2OI9B 5DK3A 2FIKA 2G60L 4GXVH 4KMQA 5F1OB 2PWEA 5FAAA 1YMMA 1Y0LB 5C3LD 3QQ3A 1DBML 3OHXB 4Y16C 3B3IB 1RP8A 1EOMA 5HHXH 4HK0B 1CGTA 5CZKA 5GGSA 5IMMA 1CYGA 1XF4A 3HR5B 4LSSL 3WNPA 3CUHA 4LSDA 1MAMH 3HS0A 1NL0L 5KN5A 1LE5B 5B3NA 3PV7A 3SOBL 1FV1B 2F7PA 1LDPH 4W8AA 2X9YA 4LVOB 4V1DE 1BD2D 4XWGH 2P5ED 1VA9A 5E4EB 5EZOH 2OSXA 3VW3L 1RV6X 5HGBB 5K9QI 4Y4FB 3DVIA 4AIXA 3VRJB 2HRPL 5INCB 1QOXA 3ZDXF 4AEIH 4ODHH 5I76A 5IFAH 3L4VA 1T0PB 4NIKB 5HDOA 4HA1A 2BY0A 4L5FH 7FABH 3HE7B 2CERA 5DJDA 5E6ID 1WNOA 3CMGA 5BO1L 1I1WA 3LKSB 5BRZD 2OM5A 4OF0A 1G6RH 3QNXB 3WD5L 1E1FA 3N1GC 5FO9A 3AXIA 2VDMH 1H3WM 3V4UH 5HYJE 2CGRH 4HH9B 3C9NB 2EDDA 2GITB 5KN5B 1DWJM 1HJUA 2OR9L 4AD2A 3RPIB 1IGML 3SY0A 2DT0A 4FXKA 1BD2A 4URTB 1O7DC 5C2UB 1MJJA 4FTVD 4HBCH 3WFDL 5I6XB 4DWHA 1IGYA 3BT2L 2C9AA 4PMUA 4UT6L 2X6MA 1EHNA 5C9JA 5FGSA 3IKKA 4WO4A 4LVOC 2Y6SD 4X5WB 3VIFA 1I8MB 2E7LA 2OWWA 1UR4A 2N4IA 2FJFA 2VIRB 2Z4QA 3LB6C 3S36H 4JVPA 2H2PD 4EANA 3WHE0 3D18B 4PJ7B 1VPOL 4L8DA 4WKFA 5I5RA 4NQVA 4RE4A 4U3XA 1MW3A 3SCQA 3GXDA 2N1KA 1NP0A 4P5MA 4N0FA 2DQCH 1FZMA 4RFOH 3OPZL 1YN6B 3QXAA 4NZDA 2PUQT 5IEKA 2WBWB 4ML4A 4MCYB 1G9HA 3A22A 3ZSSA 1CGWA 3WFZA 3S88L 3IDXH 1G9EA 1HXYA 5EUKB 3GXTA 2NLJA 1IC4L 4AL8L 2YKKA 3VM7A 4TSAH 3E1F1 4GZEA 1IZKA 4JDTH 3JTSA 3WMCA 5C0GB 1AHWC 4OCRH 3RL2B 3HNVL 1MJUL 4JFOB 4X4XA 2WINA 5GGTL 3W9EB 2VZOA 1QSFD 1IGJB 1WUNT 4OF3A 1CFTA 3VFPB 2P8LA 2ZG2A 1N6QL 3UETA 4LLYB 1G84A 3D0LA 3B9KC 4JB9H 1UXSA 1H3GA 4UINH 5AYUL 3M8OL 3TJEL 3WQWA 2ZUNA 3BIBX 4PRBB 3UZQA 1ODUA 1VF8A 5BV7C 3VI3F 4RGNE 4AEHH 1X4XA 5C0FA 3X3FH 1FFPB 1W3JA 1S7QA 3EOYG 3NIYA 4JPWH 2VTFA 1JFHA 1MQRA 4LASH 1R0AH 1JPFA 3DMMC 3QR3A 5GRUH 3PZUA 2ZX5A 5CILH 1HH9A 5INCA 2AP2A 2DB8A 2G5BA 5EORL 3RI5F 3H2WA 1QRNE 1CDUA 4HQQH 1I3RA 3TZVD 4PMXA 3CCHA 1GC1H 4X7TA 4KJPD 2J78A 4QHUB 3BKJL 3OF6A 1J7VR 4F7CB 4JLRA 1E28B 4HDIA 5D1XC 4DAGH 3O8XC 4CD4A 1GH7A 1E4WL 1KN2L 4X6CB 4YHPA 3TT1L 2VLLB 4YUEH 3P73A 4UFJA 4XTRD 3V6OC 1AKJA 3INUH 3QSKB 4FP8H 3APGA 4HUVB 2FH6A 2OSLB 1MFDH 5DJYB 5ECUA 4DTGH 4WUUD 4IRJD 4WCYH 5DA0B 5IUSA 1WFOA 1ZE3C 2CIKA 3ZKXB 3H6JA 2H32B 2NPLX 3GZAA 1HXJA 3IDIB 5IBUB 5GHWL 4HV8A 4XXDB 3AIQA 2LU3A 1CDHA 1A6UH 1F90H 4RMRA 2YRPA 3O6FB 4OCLC 1JUFA 2DTML 4DN4L 1QFHA 2ARJQ 4JRYD 4P4RA 5FOOA 4PTVA 3CVHH 2WW8A 4YUEL 2ITDA 4MXQD 1XGRA 5JPMA 2X4RB 4GBXB 2NTFB 4WLCA 4BM7A 3B2VL 2JF1A 5GS2D 1SQ2N 1UM4H 3C6SA 3O6MH 4AZHA 3DX9A 1WICA 3O4LA 1B3XA 1P53A 3VOCA 5F88A 2DYPD 1DQML 1FAIH 3SGDI 3GHBL 2VVSA 1QPKA 1YEJL 5KVDH 3SCRA 1LE9A 1VACA 3AHTA 1YECL 4L8CB 3QUXB 1BQHB 1QRNA 3GHEH 3LS5H 1KWKA 3F6LA 5C0DA 5EBLB 3KS0H 3BD3A 4ZNEA 3VO0A 4XP5L 2NZ9C 2VLJB 5F9OL 4GAGL 5IJVA 2AQ2A 4XPTH 4MXVE 3DI3B 4Y5XA 1CK0H 4GJTB 2JIXB 4UINL 1JN6A 3HG1B 3EKCA 3IXAA 1U92B 1G6VK 2WUCL 3DJ9A 1AQKH 1RHFA 4IDJL 3TM6A 2O5ZH 1ZHNA 4K2UL 4KC3B 2QPUA 1HEZA 3V5DB 1U8HB 2WUCH 3GJFA 1JHTA 4XMPL 4AIZA 4AQOA 4OCRL 3PIQB 3Q6GL 1Q6DA 3Q5TA 3GBEA 3QPQC 4ETQA 4M6MH 4LCWE 1LDSA 4RGOL 3ROLA 3VIKA 5A6MA 1FRGH 2D3NA 2RHEA 3JXAA 4ODXA 3VD5A 1NSNH 2NX5D 2GSGA 4PRHD 4LPTA 2A1WL 5FYKH 4NUGH 4WW2B 1YECH 1WAAE 1HHHA 1IAOA 4JRXD 4ORGB 4PJGE 3ZDZF 4DGYH 1KJ3H 1RMFH 4U3CA 3DSFL 3HC4L 5F96L 4I2XE 4GO8A 4LHUG 1PQZB 3LPGA 4WFHE 3IJHB 3IDJB 1T0NA 5FYLL 1DE4A 2ICWJ 5HYSB 3I6KA 3QFJD 5D70L 5F7DB 1QFOA 4APQD 4JR9L 4XBPA 3LKQB 3FN0L 5EO9B 3BVTA 5EUOB 4HPYL 3BJ91 4JY5L 2GAZB 3TCLA 5JO5A 4BZ1L 3NDYA 3WEMA 1CIDA 3IFLL 1RJYB 3OX8B 3FT3B 2F8VA 1A4JB 1FL5B 1NWSA 1AI1L 4UQEA 1A7NL 1FVCB 5FL0A 5HJ3B 4KH2A 3CFCH 3UJJL 1K3ZA 4L9LC 1UZ8A 5AZEH 3QAZB 4UMGA 4W6YB 5F89B 4ENED 3VXSA 4KTYA 3DDGA 4LLMB 3VFNA 4MNLA 4P2OB 1BJ1J 2XN0A 4APQB 3V0IA 2ZOKA 4O02L 1RZ7H 5HBBA 5FCUH 1UEYA 3B4NA 5C0JA 4IPNB 3CU1A 4HH8A 1CFQB 4CL7A 1FH8A 1VGKB 3D3VA 3BKCH 3PWLB 3IAGC 4KRPB 3EYFB 4AL8H 4JY5H 4H88H 1G7MB 4FTVE 4PJBA 3OKDA 4CU8A 4F33A 1KB5H 1WGOA 4UFHA 1KSRA 1AC0A 3CZJA 3EJPA 3ZKMC 1H3TA 1AMYA 1FOBA 1YEIH 4Y8AA 4JM2C 2HT3C 4K68A 3L5XH 3CVIL 5HPOA 1NBZA 1S7TB 3FNDA 2R29L 4PJ9A 4KRTA 5F96H 2MQ3A 4PMOA 4PGZA 3VSVA 2F8OA 4UFIA 1FZJB 1MFEL 2EKSA 1OWQA 4Q74A 1MIEH 5CJXC 4W4OC 4KKNA 5KANG 2X2HA 2ITCA 3VXPB 2NX5A 4PRHA 5FA4A 1OAQL 2QBWA 5IFJA 4CCEA 3TV3L 4M43L 2V7NB 3ZTNL 2DIAA 3WO3B 4DVRL 4HXBL 2N56A 1ED3B 5IIEA 1QSEA 1QI0A 2YUVA 4U1HB 3MNZA 3DC0A 1ODZA 5EWIL 1W1PA 4C58B 2VDML 2IXVA 5M94B 2YD5A 1CU4H 3PF2A 2RQ8A 3V6ZA 4NDMA 2UUDH 4PJFB 3WNOA 4YIQB 2FX7L 1SJEA 2CNCA 4MB1A 2FO1A 4LCIL 1TVBA 4BA0A 4M1RA 2QSQA 1JXKA 3IU4H 1G7JA 2IG2L 4YDLB 5L0QC 3VSTA 4M3KB 5D9SB 5DLML 4MAZA 3NIDE 1UYWH 2LTQB 2AXHA 3GMNA 3IJYA 2AGJH 4RSVA 5J06A 1N8ZA 3RUGA 3C60B 4JN1L 4FXGA 3O45B 2AV1A 2JCCA 5I2IB 2LABA 3D6GA 4LLVA 2A9NH 3SE8H 3V79C 1B30A 1B90A 3FT3A 4PJXF 3VXRE 5KVGL 1S7XB 4NQSB 4JM2D 4P3CH 1ITCA 3VFGL 4J3VA 5CSZA 4ZUUB 4JKWA 1LEKA 2ZCLH 4MZ2A 1LO0H 1JYXA 4LQFH 4YDJB 1LEGB 1IE5A 4ZFOL 3HZKB 4HF5L 1YMHB 1VB9A 3ZHKA 1W9BM 2WM0A 3K80A 4R4FH 1GL4B 5L2KB 3PWLA 4X7FC 3T0ED 4OV6F 2CLRA 3SGKA 3K2UH 2NXZC 4PG2C 2YPVL 3QOMA 3QCTH 3TO4B 5EC2B 1SJEB 1E43A 1I1XA 5CWSB 2BDNL 5E08L 2C7FA 1UVQA 4EIZC 4TTDC 5J9PB 3FT4A 2WWMC 1V8HA 2CO7B 3VWJA 2HTLC 3RTQD 2IEPA 5IB2B 3KPPA 5I8KH 3DX1A 1SJXA 1G7HA 3T4YB 1WZKA 2DQCL 4N8CL 5KVGH 3QXWA 5GGQL 4GIAA 2FEEI 4OJFH 1R47A 4ACZB 5IMOA 4M4PA 5CGYC 1GZQB 4OCXL 1Q9OB 4L3CB 2BXYA 4IRSA 4PRAB 5ESVA 4V2BA 3X3GH 4OLUH 3RL2A 4POUB 1SHMA 2NNAB 1PPIA 2PO6D 3LMJH 2BMKA 4AZCA 2BVQA 3H7BA 5DRZA 3H9YA 1XAUA 1ZB5A 3MROB 5IK3B 2A2QT 3ORJA 5DJ8B 1O6IA 1H9VA 2KQMA 3KPLA 5C70A 1UR8A 3CUFA 3TPUA 4G6FD 4D9LH 4MCYA 1CGSH 4HCRL 1VFBB 3KDMA 2NY5L 1ZLVK 1CWVA 4JQVA 4WI4A 4ISVB 2EZ0C 3EJRA 5I8OL 4JG1H 5JR1L 1A7QL 5C0EA 4RX4D 3DNKA 4F8TA 3LPPA 4NHCH 1DBMH 1MY7A 1J9CT 1R33A 3U6RB 4JFWA 3KPQB 5JIHA 4IIQB 3O6LL 4Y19D 3T0AA 4DVBA 2OWXA 2YLLA 3KYKL 3LEYH 3RDTB 4OCWL 5I1LB 4N42A 4LCYA 3QEQB 2P7TA 4JM2A 1JPGA 1Y18B 4DVRH 2B8OT 1KTRL 1UASA 3CCHB 4X7TB 4M7ZC 1QHOA 1BZ9A 2EYSB 3CFEA 3QULA 4X6FB 5C0IB 3O2DA 3GGWB 4BSVB 4Q9QL 4QCIA 1M7IB 1HKMA 4OFYA 5B3JE 4WO4B 2XACC 2ZUVA 3VD4A 2A9NL 4JM4H 2GSIB 1FHLA 2VX5A 3PL6A 3UC0H 4LVEA 1FVEA 3K2MC 1NCBL 4OZGA 1WT5A 3FQTB 5D1QD 4LLWB 4PJ8A 3F7QA 1U6AL 4XCCL 5A40E 4GZJA 3KYOB 3GBNH 2J5LB 1FO0L 2XI9A 2G2RA 2XG5A 5DK2B 1AO7E 1KGCD 1JDAA 4NRRA 2KQNA 2R8SH 1J86A 3Q0HA 1MQQA 5K9JL 4WO4D 4MA3B 5JW5A 1E6RA 1ITBB 2D23A 1CICB 3MS8A 1JPTL 4AMCA 4KFZC 1X5LA 3QI9D 1JGVH 5F9JA 3KLDA 1JWSA 1LLOA 3WL9B 1IAIL 3RNQA 2P5EA 1RZ7L 2NY6C 2AJYH 1NMBL 5DZNA 4C83B 1HYSD 5FHBL 1KN4H 4JPVH 2ESVA 4LAQL 4KVNL 1TJHH 3O3UN 5KS9A 4E5XB 3LZFH 3WUWG 4AXNA 1T22A 1ZA6A 1VIWA 1UYQA 3PHSA 2WBKA 3QUXC 1T83C 1RUKH 3O4LE 4HKZB 1QRKA 5CPQA 1FJ1A 4TTGA 1F6AB 1D6EA 3ARPA 1LK3L 5FGBC 3X3GL 4UOJA 2HT2D 4NRXB 4F9PA 3CZKA 5MENE 3WNNA 3QUZC 1L7TL 1A22B 1N59B 1P7HL 1E6SM 3F5KA 3MKKA 5DF0A 4KY1H 3EO1A 2EDYA 2M26A 5DJXB 3CH1B 4MVBD 3SKMA 2YBTA 3ZO9A 1H3PH 3QO0B 2G5BB 4ODTH 1MI5E 1QVBA 1TJGH 2X1QA 4M1CD 5E8EA 4M62H 4DZBB 1JZ3A 2OYLA 4MNJA 4F79A 1E6JH 1DWGM 1HINL 3CZ8A 4PMYA 2Y06L 3TVMC 2B2XH 4PUEA 4GQQA 2YN5A 3V52L 4X9GA 2EPNA 1BBJA 1UWSA 4M1CC 3MQIA 4UUJB 4H88L 5F8RC 5GIRA 3VNYA 4E2OA 3UCRA 4HJJH 1UC6A 2DM7A 3WL1A 1K2DA 3PWPE 1KJMA 5LA0A 1N0LA 1FNAA 1WBXB 1CDCA 4GMTL 3VWJB 2J8UF 4S1DD 5DJDB 4JO1H 4HP5A 4KVCH 4Z18A 4U1MA 4L3EE 1R6VA 4KXZI 4OLEA 2N7AA 4PP2B 4PUBH 4HFWA 2YWZA 3H54A 2AMGA 1IFHH 3SCVA 2DRUA 3RCNA 1G7LA 3MCKA 3AMDA 3TN0D 5E8DL 4YHEA 4P4KA 2QMKA 3VGAC 2WZHA 4WI3A 3WLBB 2V5TA 4FQHB 1BVNP 4XCFL 3RWFB 3NABL 2WW5A 1NGWB 3BDYH 2KDGA 4OKDA 4MD0B 5CSGA 4JR9H 1A9BA 3TGXA 4JY4A 4YDVB 3RPIA 1ZWIA 2W65A 3M45A 4W7UA 3UZVB 4HJGB 3VXMB 3AY4C 3BGAA 1KYOJ 3MJ9A 3WD3A 4F8XA 3ULUF 1KTDB 1H5BB 2VLMD 5FO7B 4QHKJ 3HC4H 3VXNA 4QXGL 4KK6D 4ZUTB 4JFHE 4U1NB 3O3AB 4U6XA 3QDJD 1XF4B 1WCQA 3HR5A 3ARGA 4R96B 4DOHE 3ALPA 1AO7B 1CLZL 3QUKB 3N04A 2QADD 2VKWA 4PJHE 3WL9A 3FB8A 4KDWA 1ZBVA 4ZD3H 3D50A 5EFDA 1MWAH 4PTTA 5I18H 4ZMAT 1RHHA 1C93A 1PGRB 4H8WC 2FR4A 1JNLH 1B0WA 4G8FA 3RIFK 4JIEA 4D6FA 5D5MF 5BS0E 4LEOB 4PD4K 5IHZA 1JK8B 4GW1A 2IGTA 3C9NA 4B5EA 1U8QB 2PW2B 1YN7A 4X6DA 3QFDA 2D20A 2MWCA 3KLHC 5E6IB 4JFFD 2P1YA 1DSFL 1S7SA 1ZWIB 2W65B 3ARBC 4MNQD 2YLAA 4M6NH 4PJCA 4Z8FH 3SQOL 2W91A 4PD4J 5EZLB 4XCYB 5C0AD 4QOKA 2GK1A 4W84A 4QHLB 5IR1B 3IFPA 5D2LA 3LQAC 2Y07H 3BYYA 1U58B 4WJ5B 3G6JE 5CILL 4UTFA 1G7LB 3BO8B 3MCKB 1TQUA 5DGQA 1ZL1A 1GJWA 3D4ZA 1ES0A 2P5WA 4I18C 3OAZK 4F3FB 1DLHB 1R5IA 1WCBB 3MLXH 4AD5A 2IUZA 1KCLA 1T80A 3SKOB 4LCCA 4FQ2L 4Y5VC 4G6AD 2OMNA 4FLQA 3SO5A 2EYRA 3WHE1 1I7ZB 3GNRA 5FCUL 1A1MB 2XKSA 2OP4L 3ULVH 3B9VA 1X6NA 2CRYA 5DVOA 2AAAA 4PLJC 2BNRD 4PJHA 3LKRB 3MSPA 2O5ZL 3E6HB 3VA2C 1ZSDB 4F9LA 3C60C 2C0HA 4S1QL 1G7JB 5EC1B 1KTKE 2Q86A 1CG9B 3SUSA 2EDTA 5DR5L 2CDGA 4PBXA 4QY8B 5ICXA 4LX4A 3V0JA 3IJYB 2VXVH 3I6GB 4KHXH 2ZOKB 4H5SB 3OBAA 3EO1B 3VG0H 1FG9C 1RUQL 2DMKA 5HGGS 2CBJA 1JPTH 3FO2B 3W0WD 5F7UA 4A3HA 3QUYA 3V6ZB 3V9FA 2X1XR 2IBZX 1CVRA 4H1LB 3TZVA 1MHEB 2DI8A 1NBYB 5L2KE 3PDOB 4M93C 4RWHA 4ZQKB 5JUEH 2VZ1A 2D1ZA 5CBAA 2VDOL 3C09C 4P57A 2BSRA 35C8H 3CIQA 4XCCH 3GYCA 5I30H 2VDPL 3W26A 2QQNL 4MB4A 3U2SA 1I8IA 4IM8A 3GSXA 4GW5B 4JQXC 1MRFL 4Y4HD 2F54A 3VXME 5GNYA 4FQQA 4NRZB 5E5RB 3AHVA 1J1OL 2W60B 2JB6B 4W4OA 1J87A 1KIPB 2HFGL 3D69A 1QPXA 4HX1A 5JIKA 1DQDL 5FYJD 3H7LA 4FQXD 2F58L 3WS6A 1V6UA 4KKCD 2LAAA 1T1WA 1DUYA 4X7EC 1KG0A 2HVKA 5DFAA 3WQ5A 3C87A 3U0TB 1P5UA 5CLTA 3VGHA 3OR6A 4WJXA 4ZFFB 4HA4A 2DAVA 5FHBH 2UY4A 1QWUA 2W59A 2O5YH 5DD6B 5DMGC 3PN8A 4NO3A 4OZIA 4ACZA 4YPJA 4RNRB 4EI5B 3QXUA 2VOTA 4X6EA 5MERB 4CMHB 2FHFA 3U9PL 1CFSA 1XV8A 3DTXA 3ILPB 1MCBA 1HINH 2XFYA 3HG1A 1YUHB 1MIMH 1HTYA 1VRXA 2WANA 4YX2L 1EMTL 3CXDH 2YUWA 1AE6H 3FQWA 4LKXB 5BXRA 5CP3A 1UGNA 1MI5B 2FX8L 4O2EA 2P44B 1FNSL 2VLJD 1J01A 3PGFH 2FIKB 5F1KC 1KXQA 5FM5M 2V5CA 1A6VL 1TZGL 4M8QB 5CUSH 5IDIA 3V5HA 4TSBH 1HHJA 1I9IL 2IPKA 5C07B 4ZXLA 1NCWL 4OJFL 1FBIH 4G9DB 4M7JL 4HJ0C 4TUFA 3VXRB 2B1HL 2ADJB 4YAQA 2MKLC 4UTAL 3EOTH 3IFOA 2AOSA 3K8MA 4NQSA 5D6CA 3FT2A 4GG6B 1EEUA 5SWZB 1NL0H 1E6NA 4M82A 3U36A 4M81A 2RJMA 5D7JC 2GQHA 4Z7UE 5HTSA 1NC2D 3UBXI 3KPRE 3X12A 2DQDL 3GKZA 1TA3A 3EJYC 5ACZB 4RFEB 1P2CB 4K23H 5A3IC 3L4XA 1CXEA 4DAGL 3WJLA 4DN3L 4UOZA 4DKAA 2K9UA 1TJGL 2W9EH 1MFUA 5IBLD 2A73A 2YUZA 2BJML 4PR5B 5A2LH 5CEXB 1S7TA 4M93B 1HVXA 1FL6A 1PBYA 3VH8B 4NKMB 4PSRA 4EUPG 5I75B 3MXWH 1VFAA 2E7LC 4L4VD 4X4MA 5EU3A 5TDNB 2UZIL 4DWSB 4LASL 4N68A 4LHUD 2YUXA 4RFEA 5DJCB 5FDYA 2XVNA 3IF1B 4FS0A 2ITCB 4GRMB 4PY7A 3DVNB 5MI0C 5D1ZB 3NA9L 4C57C 2LU4A 1PSKH 4EKXA 5I1IL 1NAMB 4MNHA 4H26A 1IEHA 1NBQA 2IAMC 3UO1L 4HKJB 1U3HA 4JFPA 2W9EL 5E94A 5A16B 1IBGL 3BGMB 2VZVA 2ZJSL 4DWSA 5F9WB 4HKXA 2UY3A 1H3UA 2YEZA 4S3KA 4X6CF 3QEGH 2BCKA 3SE3A 5B8CA 2UY5A 3DRTA 2DQXA 4NXSA 1A2YA 1CD9B 4R7DA 4QEGA 1Z5LB 2J12B 4F7TA 3MRJB 1Q38A 1UR9A 1I9EA 2F53B 4WHTA 1E27A 5J1TC 4HZLB 3WUBA 1UM6L 3P4OA 3CZSA 1YYML 1ERNA 1XGYH 1PEZA 1OLLA 2AK4D 4M3JA 2ZUUA 3VXUE 1IT9L 1XD0A 5EN2A 3UESA 4PJ8C 4XXDA 4U05A 2I24N 3KL0A 3BZFB 3CLEH 4PJFA 1ZANL 5EZJA 3EYUH 4KDVA 3RTQA 3NDZA 5E8NA 4GRLD 2MNUA 3V7AE 4OF8A 4UTBL 3WNMA 2COQA 2DH2A 3NZHL 1NJ9A 4WY7H 1CWYA 2XN9E 3UPRB 4NKQB 2X4RA 3O2DH 5DMIH 1BAFL 3WUGA 3P30L 4JAMA 2XA3A 1HNFA 1J8HA 3B9AA 4PJ7F 3GSRB 3TOPA 3O8XA 4XPBL 4AM0B 5L8JB 1W9UA 3CFDA 3FB5B 1OGAD 5E70A 2YD8A 4JFFB 2Z8VC 2EDNA 1AXSB 3PWJA 1M7XA 4LHUA 1HSBB 1IKNA 3VGFA 1GOFA 3WSQH 3SDDB 2X4OB 1VADA 5E5MA 2G60H 5FYJH 4JEGB 4K7PX 2FO4A 1U41A 2CH8A 4WDIA 4Z7OF 5EBLA 3RQ3A 1OM3H 3SGJC 3KLAA 3NCOA 4XAKE 4L3EA 4M1DH 2Y24A 1MLCB 4N5EC 1T66C 4NQDE 5EOCL 4UNTA 4Y5VB 3QUZD 1RAMA 5HHQB 2O61A 4I5BA 2J1KA 5FO9B 5BV7B 4V1DD 4X5XA 2C8NA 4ALAH 3BUDA 4PGBB 1E4XH 5E8PB 2R2CA 3IDMA 2AXFB 4ZAKB 4ZYKB 2HVMA 3CMOL 3RWFA 1F4XL 4AG4L 2EACA 4PJ5A 4ZDHA 4IRJB 5C8JB 1RZJH 1FSKB 4HJ0D 4MHHG 4HZ7A 5EFIB 3KWWA 4PJAE 4F80A 2A6DB 2Z31C 3HZVA 2VQ1B 2APWA 1A02N 4XNUL 2CETA 3FHAA 2FX7H 2EXOA 1QSFE 5C1MB 3LH2L 4L4JA 1UG9A 3GJFK 3L5WA 4ZUTA 1S5HA 5TH2A 1EERB 7TAAA 4NXKA 4ZODA 3ZJ7A 3O6KL 4S2SB 1NEZG 2EC8A 5GISH 1X5FA 3U46B 3ULVC 4R97C 3MCG1 1F3JA 4OIBA 3QAZC 1OGTB 1FFOA 5K33A 2CXGA 5DJZA 5DS8B 5JPMB 3SCPA 5BXSA 1I8LA 3QXAB 3SCUA 4HIEA 1NCCL 1C8XA 5EUOA 5D1QA 4CNIA 3P77B 1CVSC 4Y1AE 4X4YA 4AISA 3LV3B 4PTXA 2IQ9H 4OB5H 3SDYH 1Z9SA 1G5AA 4LU5H 4Z95L 1C8QA 3SJVD 3AOFA 4JFDD 2P5WB 4ZD3L 1JZ4A 5B38A 1J8KA 2NW2B 4AM0A 3EYPA 2D03L 3VRJA 4NWUH 4MX7B 2QHAA 1MWAA 3L6FA 4PJEE 2XM1A 1Q8MA 4Z2GA 3QXDB 3F6IA 2W0FB 1T7WA 3QUML 5C8JA 4KK8D 4NC2B 3GH5A 2WWDA 1S9XA 2ARJB 3U9UA 1U8OA 4RAVB 5BS0A 1SY6H 4DVBB 4DUXA 3MTRA 2VCAA 3MLVL 2ICWI 2J4WL 3CSGA 4AEEA 2J25A 5BZZA 3HMCA 4I0PD 4LLDA 1QKZL 2DBJA 1WDQA 2ZXQA 3ARWA 2Z35B 4MJIA 2FB4L 2CBIA 1YMMD 3Q1SH 4LLWA 3MOBH 3N9GH 4QXWA 5FK9B 3SE3C 3QZWA 3BESR 1IGTA 4LOUD 2VDKH 4C56D 3PL6B 5K9OA 2Z1KA 4WSKA 4Z7VB 5F9JB 5T1LD 1XF5A 3H7BB 5DRZB 3BKCL 3ARFB 2WINB 1U3HD 4N0CD 3RBSA 1HT6A 4ZDHB 1AO7A 4XPAH 3W29A 4D6DA 2F1BA 5ITBL 1E55A 4JKKA 4AK1A 3NACL 3P77A 3T0XA 3BH8B 3FKUS 5GNZA 5HBFA 1TJIH 1HK6A 3L9RB 3ZLQC 3FFDA 3QDGE 1TCRA 2VURA 2WIIB 2JB5H 1UKTA 5CHNA 5F9AC 1I7UA 1QLEH 4U1IB 1OWWA 5E24E 1F6AA 3C60D 3D9AL 4PMDA 3O6FC 2VAAB 2H41A 3TV8A 4Y1AB 3A23A 1FBIL 3EBVA 1KJMB 1OP9A 4XP5H 5DO2D 4LSQL 4E5XA 4NBZB 3R0MA 4P2CG 3FN0H 5J12C 1LWRA 3DIFB 1FV1A 3VXMA 2Q87A 4X0KA 3TPUB 3MGAA 4IBLT 1VJZA 3VXQA 2HG5A 5D2NE 3ULVD 4UU9A 1NUDA 4X8JB 5IB5B 4LGRB 1JV5B 3JTSB 2NW0A 1NUGA 2QADB 3MNVA 1OB1B 1PYWB 4YWGL 4PRWA 1AO7D 1WZAA 4XZBA 3VIGA 3FB6A 4OLWH 5C0BE 1KFAL 3K1KC 4EEEA 3QDME 1FFOB 1YEFL 1TPXC 2HJFA 5DR5H 1HIML 1JGLH 3R06A 4GRLB 2X9XA 3L9RA 2WUBH 3F7YA 3LPOA 4C56E 1GIGH 3C60A 3BSGA 1WC7A 3JWDL 1JNLL 5C0AA 4D9QE 3HCVB 2VWEC 5F6IC 2H1PL 5SWQB 4EDWL 5EUOF 2V38A 2WQRA 2P5EB 1SJHB 2DJSA 4JZJA 2GJZA 4ZO8A 3BUPA 2X0HA 3B83A 1RJLA 5JZ7D 4HFWB 4JHWH 4J27A 1R3IL 2EXWC 4QFUA 5HHOB 3MJ8B 5DC0A 3AJ7A 5C9JB 1WCGA 1M1SA 3MJ9L 3AUVA 2PO6B 2FYVA 2JALA 5T1DH 2MCG1 4PV8A 3O9WC 3DHUA 2Q7YB 3UTTD 2XG9A 1KQZA 3TO2B 2CLVA 2J6EL 3MV01 5EH1A 5JHDA 2DICA 3T09A 5ANMA 2DQTL 2PR4H 1F3JB 4F2MA 1MHPL 5CWSA 4NQVB 3TTSA 1CD8A 1SY6L 2R9HC 4CAGA 3QHFH 3PP3K 1SVZA 5GGTA 3EUUA 1S3KL 4LCUA 4PJXA 3ZKMD 4Z0XA 5D93B 2YRLA 1D5MA 2CQVA 1U42A 4E0RA 4AD3A 3OGRA 4I0KA 1LL7A 1FIEA 1M6OA 3D2UD 2BNQB 5EIIB 3SBWC 3BUQA 2J2ZA 3LX9A 4GZIA 3DETC 4C7DA 4U1GB 5TPWH 1Y0LA 1E0WA 1NC4D 1W8NA 2V5RA 4MSWA 4QO1A 5H2BA 2JIEA 4M48L 3OF6D 1EJOL 3PQYD 4PRAA 1KTBA 1I1CA 4HUUB 1J1XH 4R2GC 5EOTA 2WBJB 1FL6B 2VRJA 2QR0B 3W37A 3OJDA 3PABA 3ILQC 1F3DJ 4NHUB 4PS4L 5D71L 5TGBB 3EJQA 4JFSA 4QTHA 3KPRA 1K9DA 4LGXA 3JTTB 4WWKA 4PG2A 3UTPE 1RIHH 1S9KC 3L7FB 1KLGB 4Z2IA 4LVNC 5D8JH 5JORA 1E9LA 3K7UA 3IGUA 5TDOB 2WZEA 3HAEH 3VWJC 2NY2B 5I19L 1KB5B 4YR6B 4JGJA 1ORQB 5HHMB 1V0KA 4M5ZL 3LB6D 4U6HB 1CFVH 4KAQL 3IK2A 1WBYB 4ZOEA 5EU5A 1PDKA 3H9HA 1GOIA 5EU3B 5TDNA 5HHPA 1F3RB 4PJFF 4LFHG 5ETUB 3QCVL 1YA5A 3VRIA 2NY7L 4PGJA 1XF2A 4JFHD 4IMKA 3CD4A 1EBPA 2VNCA 3ULSB 2IMMA 1HILA 4AW7A 1AXIB 3NPSB 4I2XA 4NRYB 5EOCH 3FOMB 5AUMA 2WVSA 1JFQH 2V2XB 1DUZA 2WMJA 3CFJA 3SE9L 1B4RA 4UQ2A 2UY2A 4ZEPA 2XT1B 5D7JA 2VN4A 4G80A 1MELA 1RZKC 3KPOA 4NNPL 4I8DA 3UBXG 4AJ0A 5HVGB 4O9HH 3TP4A 1YEEL 2XICA 4MQSB 3GXNA 5E4EC 3I6GA 4DUWA 3I02A 4JQVC 3EYFA 2IH3A 4O00A 1TZHA 4UV7H 1JGEB 2I9LB 5IW3A 4UT9H 3L5JA 1LO3H 2F15A 1E71M 2YSSA 1SEBA 1T6VN 4NX0A 2IMNA 4WFFE 3Q1SL 1GJIA 5JXAL 1QFWM 1WPCA 1NFDE 5T1MB 5LAXB 3JV4A 3BQUB 4R0LA 2ZKHH 2DIEA 4NO5B 4AMXA 4TNVK 3AFBA 2BSRB 1U8KB 3ZE1E 5A8NA 5ID1B 4M7LT 3PABB 4HOWA 3OSKA 3G5XB 5EBWB 3MX0A 2LTQC 2G75A 2OL3H 1GAFH 2GAZA 3GRWA 2FATH 3HG5A 4K8RD 4WV1B 5IR1A 3NMEA 3R8BB 4XC1H 4AD4A 5E8DH 3RZCC 3VIMA 4DQOH 3AISA 4OZGE 1L8NA 5ESAA 1EGJA 3MXVL 4UT6H 1IGIL 1UZ8B 4WFGE 3N1QC 2ZCKH 1K9EA 5EBWA 4AENB 5CD3B 1FVDA 1PX3A 1U8JB 1ZEAL 1PZUB 4QXTA 1J8HE 4D71A 1A1MA 1BQSA 1WZ1H 4LLVB 2YEZB 4IRJC 1ZEAH 4ZFFA 1DQJA 4OLYH 2W61A 5IQ7H 1EX0A 1GRWA 1VGEH 1DJSA 3LPFA 1T2QH 2A73B 3O9WA 2QL1A 1D7FA 4Q97A 1INDH 3OXSA 3U7BA 5ICXB 1WDSA 2JJVA 4WWID 3SKNA 2VDLL 1BOYA 3P4MA 2VDQH 1D9KB 3NCCB 3QIUB 4O2EB 3CZFA 4DGIH 1T20B 3MU7A 5BXTA 1R7AA 1E1EA 1TTFA 4OLZL 2NY1D 3LDBB 2P49B 2NY2D 2OSWA 4R4BB 1KCVH 3WLWC 1NOUA 1QRNB 2MKWA 2AABL 1OP3H 3UMTA 4YFEA 5IT2L 4H41A 2ZG1A 4JRXB 4GOSA 2EH8L 4MAUH 1P7KB 1G0DA 1FNEA 1UWUA 2NSXA 1AKJB 3TBYB 1OTUD 1S7VA 3RVTD 2H9GA 3BPLC 4WVRA 2E7HA 4KZDL 2IADA 2CIPA 4PB0L 4XB7A 5D96B 3FO2A 1WZMA 2DWDB 1UD6A 3S96A 4P9HH 2EDOA 4F33B 2NY1B 4FQXC 4M8QA 1E6ZA 1PS3A 3ARDA 1JGEA 2I9LA 4JGMA 3ZHLA 3DVFA 3A6OA 2XRAL 4L4VA 5FKAB 3QXVA 1QNZH 1M71B 2P8PB 3SDAA 3TC9A 4BK5A 1YEEH 4HWEH 2GK2A 2R39A 4GAYB 1KENL 5KG9B 1T3FB 1DEEA 3PWPA 5D7IA 5JPNB 1ZVSB 1QWNA 4F58H 1IMHC 4O51A 5IFAL 3TH3T 2DLHA 5HVFB 1J0JA 4B41A 2CESA 4QLJA 3N13A 4K7FA 4UZUA 1F58L 4OCSH 4Y88A 5MERA 3NA9H 1FH5L 3WL0A 5C07D 1Q6EA 1KTLB 1U8JA 2WMKA 4HFUH 3PZIA 1EZVX 2DKMA 3TA3D 1MIEL 4M7LH 2F2HA 4B16A 5HGHB 4OCXH 5D9OA 1MRFH 4YZFF 4BFIA 3C6LC 3RJYA 4JFED 3VE0A 2FJHA 2DSZA 3DX2A 1DBJL 3N15A 5EA0H 3GSNA 4Y0GA 1ZHLB 3QEUA 3C6LD 3TBSB 5I1GH 2AV7B 2CDEB 5JA8B 2VLJA 3OZ9L 4LCIH 5DJ0B 2ZXDA 5MEOB 3R1GH 5C0ND 1TLKA 3NFSL 3BW9B 5ENWA 4B50A 1PX4A 2ENSA 2HFEB 3DRQB 3T1FA 1GOOA 4ELME 2FIRT 4JHWL 3GK8L 1F97A 2MJWA 4ZS7H 5F89A 1R24B 1CU4L 3UBXA 3KL3A 3A3HA 3OZPA 1IEBA 3QQ9D 1MCFA 5HHOD 5F6HJ 1A7OH 1WFUA 3PZ9A 5FCSH 2ADFL 4LQFL 1BQLL 3WY4A 4O4YH 5C0BB 3OKDB 1GIGL 4ZNCD 1HWWA 3LRKA 5HOSA 3NSMA 1QSVA 4YXLH 4JZOB 2O5XH 3LKNA 3WS3B 2X5PA 3IDNA 3ULUH 3HA0A 4FFWC 4UDUB 3T77B 4CU6A 1AGFA 1QVOA 4YHNA 1ROWA 2XSBA 4P7QA 1AGEB 3DV4A 1HVQA 5T3ZH 3BUBA 3VFRB 3RVTC 3PHOA 3H42H 3MLXL 1B88A 2X42A 5A2AA 3BAKA 3THCA 5IEHB 5HDLA 3O2LA 4H0GA 3QB7C 3ARBA 2JJTA 3ES6A 5C07E 4WI2A 3BEVA 1MJ8L 1V3KA 4F8QA 1NMCC 1BIHA 2FWOA 2Y9RT 5FYLH 2DSKA 4UILH 3C08H 2JEPA 3T65A 5A1AA 2DQIH 2A6KA 1NFIB 3MRLA 2GTWB 1G1YA 1YYLL 2FDMA 5GGRB 2AS5M 1YDPA 1QR1B 1PYWA 4H04A 1AQDB 1FLRL 3SJVA 5FL1A 1LD9B 4WUUE 2Y25A 4QHKI 2P24B 2JK5A 3IDJA 3IJHA 4KK9C 5K9OB 5FA3B 2HLFC 2VC9A 3UYOD 1OD7A 1KELL 3HE6D 2WWKT 3WY3A 5CEZL 5EO0B 2D7QA 1EJOH 4ONFH 5C0CE 5M17A 1MLBB 1T0MB 5EPMB 3PTQA 1QHZA 2OP4H 2GITA 5DRXB 1Q9WB 3FW6A 2HFFA 1TTGA 2PXYD 4XC1L 2XGBA 1C1EL 5FM8A 1GNXA 4FP8L 1CLZH 2YFOA 3KLAB 3ZDYE 5LCVH 5LXGL 1J1OH 2CDFB 4CD6A 3A21A 2A6JA 3F58L 4S0SD 4YK4B 2Z92A 5ESQA 2WNWA 4H1LG 4Z78B 5D72L 1ND0A 4H8VA 5D5MB 1UJ3B 2BP3A 1KIUA 1UH2A 1ZTXH 4PREA 4PTMA 3WD1A 4EJ1C 4ZSOE 4P8WA 3VFWB 1YMMB 4BFEA 4X8XA 4CDGC 1VHPA 1DANU 3IDNB 3MMDA 4YQXL 1T2XA 4UB0L 4M6NL 1G9NC 3N1FC 4OBSA 1OLZA 1RIUH 3MRMB 1OTTC 5DK2A 3TYGH 3RVXC 4XXCA 5IEKB 2B1AH 2RGLA 1E0XA 5IHLB 3MLYH 4PJ8D 2IGFH 2CLZA 3RGVB 2WVVB 4WFGD 4EDWH 1FYTE 2FECL 5A2BA 4FFVD 5IBUG 4QRRA 1DLFL 2QV2A 3I3EA 4IUGA 4D8PA 3WF4A 2BRQA 3JWDH 4B3KA 2DLTA 4AYFA 4L8DB 3ZTNH 3S2CA 2AEWA 1CZ8L 1FFNB 3QNYA 1A7NH 2IPUG 2DQUL 4MA8L 4JL1A 3EHBC 3RX5A 5MP6L 1ETZA 1B0RB 2XNAA 4G7YH 4BZ2L 1KPRA 3CH1A 1GSMA 3LV3A 1KC5H 1YY9C 1WSST 2YL8A 2JJUA 4Z78A 3V52H 3FXYA 1CLYH 3CHFA 2W66A 4FNTA 1GZQA 4HIEB 3AXXA 1UJ3C 5E03A 1MF2H 4NM8H 2J44A 4R4NC 3C5SB 1DQQA 2Y72A 3B2UD 5T5FL 4U3HA 4NM8L 4AZ7A 2IQAA 3HB3D 5I1JL 3EJSA 5D72H 1VBRA 5JHDD 3QIWC 5JOEA 3CC1A 4ZXBB 1R5VB 4GKZA 2Y2WA 3HC0A 1YNTA 4ERSH 5GIRB 1R3IH 1MEXL 5FYKD 1PEWA 1CXLA 1GGIL 3AMLA 2DLFH 1FFRA 3QQ9C 1RVFL 4CMMA 4YXKL 3HZVB 2BNQE 3MRCB 1INEL 1QNPA 3D9AH 1W0WA 4MA8H 2XTKA 1T1ZB 5FK9A 4KHTL 3AYSA 3OKMB 5C08A 3JUZA 3LZFL 1IAII 4NBXB 4FNLL 3MUIA 4GBXC 1OM3L 1NANI 2WNGA 3F5WB 3L3HA 2AXFA 4GKZB 4ZAKA 3KL5A 2YDQA 3RPKA 2EIBA 5J3HD 4E9LA 1KJ2B 1A6TA 1C08B 5J9PA 1MFDL 4OCNC 3QWRA 1E15A 3K4DA 2J8OA 4IPLA 3WIHA 1YN6A 2ADIB 1AD9A 3D85D 5C0CB 4IS6B 3REWA 3O2VH 1T22B 4YWGH 7FABL 1EUUA 3FOLA 1I9JL 2AEQH 4QYOA 5BZWA 1K8IA 1LD9A 4MJ4A 3DX8A 4GQ9H 3QXDA 5KSBE 1IGCL 1MJJB 1BLNB 3MV7D 2ZX8A 3NCJL 4C56B 1JE6A 3EMZA 3DV6A 1OSPL 3G5VA 1JF6A 2PXYB 1QI3A 2W63A 4U1MB 1AGBB 3V0VA 4MA3A 5JHLL 2D22A 2D03H 3ZJKA 3BAIA 4RMVA 1JNDA 5CPSA 1Q9LB 1MLBA 1T0MA 5EPMA 4R27A 2JF6A 4KQ3L 5C0EB 1OW0C 3W11D 1GORA 3MZGB 3BWAB 2XN9D 4UUJA 1AY1H 3N11A 3SN6N 3VIHA 4FFYL 3PGDA 1A6ZA 1CECA 1H0DB 2P8MA 2ZWLT 5EB9A 2AJYL 4FZ8H 1MJ7H 2JE8A 3GBML 3B9KD 3OKKA 2A77H 3MBEB 1AJ7L 1HOCA 1O7VA 1JPGB 1Y18A 2FD6H 3SHSA 3NCYS 3WD2A 3C5JA 3T0WA 5B8CC 2BFVL 3MNWB 3CFKA 1MHCB 4LIQL 4XP9L 3BXWA 4G9FB 4DUVA 4H7VA 3CSYB 4QRPA 1HNGA 4Z2LA 5GGRY 1GGCL 2X4NB 1FNEB 3VCLA 4NNXA 1Q0YH 4EUPA 4ATDA 4YHZL 3EJJX 2DJ4A 1EPFA 3WFEL 5DD6A 2FRGP 3D3VD 2VWEE 4NO5A 1J9YA 4KUZH 1PY9A 1AGDB 1LNUA 2W07A 2MQ0A 4X98B 4XBEL 5J7CC 1A7PL 3ZYJA 3HR6A 1F4AA 3B9DA 1JHLL 4L4VB 5DJ2A 3MMEA 3DX0A 1NCAL 1FGNH 5B38G 1KCRL 1KEML 5DD5L 4MMZC 3A5VA 1A7BA 2YS4A 3EAKA 3W27A 4MXWH 3L3IA 4XC3H 1XCXA 5I66B 1WBZB 1AGDA 1QG3A 4LF3B 2R15A 4PPTA 1EEYB 1FVCA 3ARRA 2A74A 3MRIA 2YZ1A 4X6EB 3LDBC 3MV8E 3BQUD 1VAHA 3BRDA 3BDBA 1TVDA 4EBQH 4J4PC 4KUCF 4L4VE 1RZGA 1NGXB 1JPST 3LN9A 3L7EA 4PTUB 4HUNB 3LKQA 1LO4L 3LKOB 2JIXD 4LL9A 4UTAH 4BH8A 5JW4M 2DIJA 3DECA 3TBWB 5EA0L 1IGFL 4HGKC 3BIAX 3EGSA 3WF0A 5ADOL 1G9MH 1JJUA 3NJ3A 4ORGA 3MBXH 1R87A 3OKOB 4P2RE 3CMOH 2OL3L 1ZMYA 3HNSL 1V6WA 3CHDA 3GSWA 3FQNA 1WP6A 2BNRA 1Q9LA 2VLME 5IWLC 4KV5E 4ZOAA 1G7PA 3SCMB 4R0LB 3N85H 5AUMB 3CDFA 1MCSA 2VDQL 1MCNA 1EBAA 1FH7A 4G8GB 3GXMA 4GBXA 2Z31A 4NN5C 2JJSC 3OL2A 4ZE4A 5D9SA 5FHAH 3PWUB 5ABEA 4GT7A 43C9B 3Q2CA 2AK1L 1DQTA 2BFVH 3RUGB 3ARDC 3BYTA 3H9HB 4MA1C 2J6EA 4JRYB 5IBLC 4H8UA 4LYQA 4CD8A 1MCCA 2JF7A 1CBGA 1BMGA 4Z7WF 1QNSA 3R0NA 3AHZA 4QLRA 3BX7C 5LKNA 4FQIL 4MD5A 1W2KT 4PFEA 1GJUA 2Y6SC 3NH7H 3HG3A 1F4WL 5FUOL 4NNPH 5CSZB 1S7SB 2V2XA 5D7IF 4G8EA 2EEXA 4WFHD 2GFBA 4MPKA 1QR4A 2XZCL 4NDMB 4OM0L 5GS0D 3BAJA 3WN6A 3PJSB 4KQ4L 2BCKB 1XIWC 4D94A 3OKNB 4JRWA 5IM7B 1G9NH 2IAMD 5LAXA 3B5HA 5BCAA 3GKWL 2FX9H 4TOQA 4UDTB 1X5HA 3HNTL 2HVKB 4G3YH 1KCUH 2D7MA 1DLHA 1R5IB 4NZCA 3MXWL 5BMFL 4CVWA 4MLSA 2VE6B 4NJ9L 2JFEX 5C0JB 2YMXH 5KSUA 5HYJB 1LL6A 1GPOL 3PP3H 2JB6A 3GSUA 2MFNA 1X5KA 3KPRB 3FN3A 1IC1A 2OR9H 3MRDA 1W0VB 3I84A 4NCDA 3O4LB 4F66A 4FZEH 1Q6FA 5IFHH 4PP1D 3FFCA 4AIZB 1CD1A 5ILTL 4HC1A 4NNXB 4X99A 1GCYA 1FP8A 5FYJE 4N8VA 2J62A 3UTSE 4OCYH 4OIAA 4ACYA 5H94A 4HZ6A 1T5XB 5EULV 4WW2F 1N8ZB 4OZFH 1LL4A 3SE4C 5F1NB 1E5NA 3BDXA 2F5AL 1TA3B 5DI8B 5I1IH 4PRPB 4N1CA 1XIWB 4XWOD 3IFLH 1U8LA 3VRLE 2GJXB 4P99A 5LGHH 3BAEL 1RVFH 5I9QC 3BGFC 4FNRA 1ISYA 5A6LA 2C5DC 3W53A 5I15L 3F7VB 1LG2A 1K5NA 5CD5D 4NRYA 4NKOA 1EVUA 1ZA3A 2ZCHH 5SX4H 4EN3A 4J3XA 5I1AA 2NYYD 1L6XA 5GGQH 4YDIL 5D7JB 1MCKA 1CL7I 1OAYH 3DBXB 3GO1L 1SBSH 3MUJA 2CUHA 3RWCB 4X0NA 1AR1C 2XPGB 3PUCA 3MV7E 1NGPL 1TE1A 1T7XA 1WFNA 5I1EL 3D85A 3M17A 3ZE2E 2E9LA 1UB5A 1HHJB 2FLRT 2VISB 4NCC2 3T0EC 5JXAH 3BMWA 1U8PA 1BEYH 3F7RA 1MAML 1DUYB 4PLKC 1SVCP 1VGEL 1XR9B 3VXUA 1A1OB 3MRKA 3P2TA 2VZSA 3VWKB 5DEFA 3OR6B 2DQDH 3RWJA 4NP4H 5D2LB 5ESAB 2D7TL 3P9MB 2D9QB 1JYVA 1DVFD 4HLZH 4RWYH 3KR3L 3S9DB 2NY4B 3EFFA 3RM8A 1UEMA 3QIBD 4LSRH 3D39D 5MHSD 4S1QH 4G6ML 2CMRH 1YPZA 3HZMA 4FFVC 3JWOC 4K7PH 5IG7B 1DQQB 1T83A 1DWIM 1DLFH 5DD5H 1MCQA 4BQ5A 5CSBA 4Y4KA 4ZXBC 4PJIF 5AZ2H 4XVUD 2WAGA 4RQQA 2IGFL 1NP2A 4D72A 3DX6A 3QG6A 4N1EA 5TE6H 1OPGL 3AB0C 1IT0A 3W5NA 3TFKC 2F18A 3QUZA 2NY3B 4AMKL 4EUPH 1P9MC 3LHPH 5IB3B 2AK4E 5E95B 4HWBL 2BVPA 5EFFA 3GJEA 4ZTOL 3S6TA 1NAKH 4U7MA 1D5ZA 3GM0A 3SDXB 2Z8SA 1BVLA 3MRHB 5HI3D 4PP1C 4NQDA 3LD8C 3WUZA 4E42A 1TZ7A 3NFNA 3U7YH 4Y4FD 2YPLA 4Z7VF 1S7UB 3MOAH 2OL3B 4OOUA 3SCNA 4Q6IB 4OGZA 3A67L 1UWRA 3DYPA 3H0TA 3WIFB 1KJVA 4UOQA 1A0QL 5GRVL 1E56A 3MV7B 1PKQA 1Z2KA 1EDGA 3AICA 1UXWB 5IV2B 4NPYB 3H9SB 4GUPA 1BIIB 1A14L 4WUKH 3NIFF 2DQUH 3BP5B 4R6UA 4RDQG 5LWYL 4HEPG 3V5KB 2FEDC 2CLZB 3IETB 4QRRD 4D6GA 1LF1A 4NWTH 3I9GL 3U4EB 4Y2DD 3S7GA 4PMZA 1E6XM 2VB5A 3UJJH 5ABHA 5CSUA 4Y7MA 4JHZA 1FYHB 1PG7L 1KTCA 1BLNA 1CK0L 1XH3B 3LVEA 1V7NL 4RGMC 5D7KD 1KFAH 2G9HA 4GRWF 5KAQG 2VABB 3P9WB 4FNQA 3ZTJG 2EO9A 1E4WH 4PJ5B 3VWJD 2X2IA 1UJ3A 3HI6L 5IFTA 1QI4A 2IF7A 3AGVA 1UWXH 1UACH 3OZOA 4MMXC 4F9DA 5EUOE 3UYRH 4WFEE 1VKXA 3FO0H 3CUGA 1KGXA 3ZDXE 2A0LD 4L1DA 4EI5C 2WZPD 1RUAH 5CMAB 3H53A 5HI4D 5E7BA 2AJSL 4DW2L 4CD5A 4YHIA 1BBDL 3LOWA 3T0EB 4LVHC 5A6JA 3BPOB 4WHYH 3CLWA 3VDHA 1GCFA 4K3EH 1JPSH 2VXUH 4QNPF 1V7NH 5C6TH 1DBKH 3C8DA 4GKNB 4X0KB 2DTMH 4UNVA 4KKAD 4NZUL 4RFNB 2A77L 1KLFA 3FRPG 4IMKC 3U4AA 1PZ5B 2X2JA 3VXQB 1BVLB 4AIEA 2NLJB 5C0FB 4JPKH 2WIMA 5DDHA 1NGZA 2DYPA 4WKHA 4KI5F 1TJIL 2A6KB 3ZE0E 2DKSA 3FMGL 3MJ7B 1E40A 3ARGB 3MO4A 4UR9A 3F7PC 4JDTL 5HI5D 4JJHA 5CEZE 2I60H 3QHZL 4M02A 1PKQB 4FXLA 1GGTA 4F7MA 5MEPA 1FA2A 1JPSL 3P3YA 3TBTB 4ISVA 1XR8A 5C3TA 1CNVA 4KTEL 2QQNH 3B3IA 5FKPB 3MOAL 1KJ2L 2YD9A 2EDKA 4UU9B 5CKAA 2R8SL 1KBBA 1MWAB 3L6FB 1H8NA 4QRPE 2VRQA 2FJFB 5J89A 4U3AA 2Z4QB 3QNYB 1NGWA 2VXQL 2E6QA 3UYPA 1N6VA 2ZUWA 1OAYL 3KHQA 3T0EA 2XVGA 3U7VA 2DQJL 1FHGA 3B2VH 1FN4B 2NR6D 5IOPA 4B15A 3QXTA 1OGAB 1HKLH 4N5UA 3I2CL 3UG5A 2J4GA 1FZMB 4QRQB 1MFAL 4PP2A 5J11C 5FO8B 1INQA 1YEHL 3L3JB 4QRRB 3TJEH 2AKRB 2XZCH 3ELAT 5GGVH 1S5HB 4MX7A 2H3NA 5EBMA 1SR0A 4HHAB 3TBVA 2PETA 3LRGA 4PJ7E 1JGLL 1ETZB 3P4LA 1WDPA 1E70M 1KIQB 3SDXA 4YHOL 2OTWB 4WENB 3SKMB 1OT1A 5HI3C 3QNZB 4DM2A 1H3VA 3ZTJH 2CKBB 4RBPH 4ZYKA 1RULL 5GS2H 1YJDC 1KPVA 2HWZH 5K93A 1HH6A 1QKZH 4MNQE 3V0FA 2GDUA 3HAEA 2J77A 3UTZB 1GVIA 1QLRA 4RFOL 3HUJB 5A2CA 3W81A 1MF2L 3QBTB 3BVNA 3U57A 1N82A 1CLYL 1NCBH 1NFDF 4JPWL 5DJ8A 3NABH 4FLSA 2UYLB 1H5BC 2J47A 4ODWA 3OXRA 1G9ML 3L5WB 1C5DB 3HE7A 3WUWA 3ZE1F 2XVKA 4LPUA 3TA9A 5LBSL 1PZ2A 1YEKH 2LE9A 1CENA 1RUKL 2C1OB 2RBLA 1A6UL 2DT1A 1PW3A 3T4AA 1MW1A 5T5NF 1C5BL 3MCLL 4BFIB 1ADQH 1P4LB 3I75A 5I75C 4EBQL 3A6CH 2XSAA 3I6LD 4YBLC 2EEDA 2JELL 4OIIH 1CLVA 1UQSB 3UJTL 5C09D 1JI2A 5F44A 5KSVB 3HFML 5KZCB 2GY7B 2BS9A 5JLZB 3U4BH 1N26A 4N0UE 4KRPC 1EGZA 3HKFA 3PV6A 4G5ZH 5DD0L 3LXAA 3Q3GA 1TQSA 3NGBB 4JFXA 4N9GB 4MLIA 1OP5H 3D18A 3MXVH 4KWUA 4HTYA 1I1FB 2R0WH 3H3KA 5KSBA 2OYMA 2ZPKH 4MAUL 1DBBH 5EORH 2X4OA 1I8MA 5TDPB 3QJFA 5HDQL 2P43B 8FABB 5EO1A 3SUUA 4NZTL 2DM2A 2HVJB 3S6CA 2OJEB 4RAUA 3AQUA 3BCDA 4JZOA 2CR6A 1YNLH 3CNKA 3QJHB 3T08A 3OB0H 4DEPC 4MXVF 1MCHA 2DMBA 2D2OA 1B2WL 3TWCH 4Q2ZA 4GW4B 5E1HB 2QHRH 3LAFA 1EO8H 4IIQA 2AI0H 1U8KA 4I48B 1OAKL 5FM4A 5J4MA 3S37H 3BT2H 4LF3A 5IEHA 1HJVA 3WFHA 4HUKB 3BRFA 1KT2A 3CX5J 3LEYL 2FHBA 1TMQA 1MYRA 5T3ZD 4NM4H 4OD2A 5E6YA 4Q9RH 4YPGB 1IM3A 2O9PA 3WE6A 1JGVL 2X4UB 5DJ2B 4YFLI 5SWSA 2XUCA 5DTFB 5GGVY 4LSUH 4N9GA 4PJBF 5F7YC 3FT2B 3SDXF 5JTWA 3GSXB 4GW5A 4QT5B 3VH8G 4QHNB 3WFHB 1UENA 5B22A 2NR6C 3KXFD 3REVB 1ZBWA 5D2LE 1MW0A 1IVLA 4L8BB 5EMYA 3DMMB 3TVMD 1ZVHA 2B1HH 3MUGA 4XGZA 2GDVA 2HYMA 3CH9A 2ORBH 5CZXD 1QPPA 3BP6B 1RURH 1AQMA 2WHJA 3WIJA 4P59H 2WAHA 3KJ4B 1OT2A 5E2WH 1MHCA 3AC0A 3C8KB 3GB7A 5HDQH 2EQDA 3EFFB 5IESH 3WFEH 4MNGA 1ZOXA 4OZFA 1FORL 4FK9A 1N3NB 4QGYA 3QIUA 3NZ8A 5D8JL 5D2NA 5EOQH 1AKJD 3ZZ1A 5E08H 1URLA 1K8DA 4UIMB 1ADQA 1CFSB 3BP6A 5EBGA 1F02I 3U9PH 1WVZA 5DHVB 5FYJL 4WWKB 3OX8A 5IVOA 2F5BH 4YBLB 1KGUA 4NHCL 1MHEA 1JG9A 1WZ1L 3CFJB 3C5ZC 4R4FL 1HH6B 1X5IA 4M61A 1P7KA 3O4LD 4OCMC 4QT5A 5ADPL 2QLYA 3S3SA 2QR0A 3KPNB 3ME0A 5FUCE 3TH2T 3WBAA 5CQ1A 3CZFB 1B9ZA 3UO1H 3MRRA 1P4IH 1ACZA 1UCBL 3D3VB 3TO4D 1TQVA 2FBOJ 2XFXA 3VSUA 4NJAL 1INEH 2ICEA 4M7KH 3TH4T 1U6AH 4CADA 4M7JH 5JOPD 4K94L 3WYRA 3PWVB 5FUZL 3VWKC 1PZ3A 1CG9A 1W2VA 1OSPH 4P46B 1ECEA 3M6DA 5JORB 5EZOL 1ISXA 4LCUB 5DT7A 2BNRB 4L8CA 1BYBA 4AY0A 5T5FH 4PJ9B 2D7PA 3O41B 2CIIA 4ZUWB 2R0WL 4J28A 3TJHD 4GI6A 1I7ZA 4PCTA 2AV1B 2BDNH 4P2RA 3N18A 4FFZH 3MZTA 3MNWA 3L3KB 3DXAA 3VFTB 4WU5A 3WXVL 3STBA 3T1WA 2EABA 2F1AA 2NX5B 4PRHB 3MLUH 1T0NB 4K9EL 1DE4B 4BZ2H 1YUHA 4D3CH 3LQMA 1MQKH 2ERJB 2VE6A 4JZNB 2GT9B 4J3TA 1NWRA 4U0RC 2YD1A 3KAAA 4HCRH 4MNGB 3GDBA 3STZA 3ARDD 2SEBA 1NMAL 4HXBH 4UFLA 1REIA 4JPKL 1LNUB 2DF3A 4ODXB 3CZEA 2A74B 3MRIB 3K0WA 5AC4A 5J11B 2EDXA 3ARTA 2WWCA 1GHFL 1LHZA 3AZRA 4Y19E 4FOMA 5H37H 2AW2A 1CN4A 4JHOA 3PIQA 4IJ3C 1T89A 5GRJH 6A3HA 4KJWD 2XWEA 1T0OA 2OCFD 4GMSL 3P9LA 4Q58C 4P4KC 4RGNC 1SEBB 1NCWH 3KYNB 4OLWL 3D3VE 2GFBB 3TO2A 2XA8L 2ESCA 1GZPB 3WH5A 1FE8H 3HMWH 3D2UB 4KKAC 1BBDH 1DWHM 1MCEA 4PRIB 5I66A 4HWNA 2ZSWB 3CXHJ 3UJIH 4OZFB 1GQIA 4GQ9L 3EIFA 4UAOB 1G7MA 3JV6B 3KPSB 1JWUB 4PJBB 3QISA 3RAJL 3CFBB 3PHQA 1UM4L 3O6ML 1YEGL 2IFFL 3F58H 4TNVF 3WN5A 1I9RH 1LE9B 3DGGA 2BRRH 4JFYA 3ZT7A 5KVFL 4EVNA 1EXUA 2DQFA 4MD4B 1WE5A 3CC5A 1YN7B 4W7VA 4M8VA 2CLVB 4RGOH 2VCCA 1BOGB 1I8LC 4HS6A 4NOFA 2EYTA 2UWEA 2DT3A 1R34A 4KGLA 2EAEA 5I77A 4AT6A 1A4JA 1FL5A 1T03L 2NTFA 1U93B 1UOKA 2YN3A 3RU8L 3VG9B 2Y5TA 4PGEB 5F9DC 1R8LA 5KZ6A 1RQ5A 3BZEB 3A4XA 1MPAH 3ZKSD 2W1NA 2VX7A 3NTCL 4ELMA 1S9YA 1IAKB 1U58A 4PEEA 2HISA 2YK1L 4WGWB 4UQDA 1KXQE 1NFDB 2ICWB 4PB9H 4YGAB 3IDYC 4HPYH 1BQHG 2HJLB 1A0QH 3OGCB 3LEXB 5JW4R 2Q8AL 2A3BA 1RUPL 3OGOE 1MXDA 1HYRC 4O5LH 1Z9MA 2Y36L 3LQZB 1K4CA 3BPNB 2NT0A 1FO0A 2GJ6A 4EI5A 1EQPA 4D9RE 1RZIB 4PJEB 3LRMA 5DO8A 3GZKA 3AYRA 4DGYL 2R2EA 1U30A 1OF2A 4HIIB 5IOPB 3K4AA 5IKCA 4J2XA 4DKEH 1PAMA 3QQ4B 3P4NA 5I1DA 3V6BR 1C1EH 5E0QA 1KB5A 5CEYA 1RJCA 2X4PB 1D5ZB 3GSQB 2OW6A 1UT9A 3DUSA 4PYHA 1MCWM 3PZNA 4YXLL 5GJSL 3VIPA 4D1IA 1CICA 1CLXA 5CEZH 4X9IA 1Z0MA 5DRWA 2OJZH 2H3NB 4R9HA 5IMLB 1CGYA 1Q9WA 2BHZA 3HRZB 4R4ND 1BHGA 3MUY1 4D6JA 5B3JF 5A6AA 1BFOB 1TNNA 4OQTA 1ZS2A 2LV4A 1EHLL 1R86A 4ZFGL 1KEGL 2VDKL 3BP7B 5JA9A 4C59B 4WTZA 5CZXC 3VGAB 1E3ZA 2OYKA 5T3XD 2VMFA 3NFPB 3G9AB 1DWAM 5D70H 3QDJA 3DV4B 3OZ9H 1JVKA 5FOJA 3TZVC