2FHBA

Crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltose
Total Genus 340
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
340
sequence length
1052
structure length
1052
Chain Sequence
DVVVRLPDVAVPGEAVQASARQAVIHLVDIAGITSSTPADYATKNLYLWNNETCDALSAPVADWNDVSTTPTGSDKYGPYWVIPLTKESGCINVIVRDGTNKLIDSDLRVSFSDFTDRTVSVIAGNSAVYDSRADAFRAAFGVALADAHWVDKTTLLWPGGENKPIVRLYYSHSSKVAADSNGEFSDKYVKLTPTTVNQQVSMRFPHLASYPAFKLPDDVNVDELLQGETVAIAAESDGILSSATQVQTAGVLDDTYAAAAEALSYGAQLTDSGVTFRVWAPTAQQVELVIYSADKKVIASHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPEGWDGLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAQESNMVQHLKQLSASGVTHIELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLTQLKQNDSKDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMLYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDAVRGGGPFDSGDALRQNQGVGSGAGVLPNELTTLSDDQARHLADLTRLGMAGNLADFVLIDKDGAVKRGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRSSDDGSNYDIIARVKDAVATPGETELKQMTAFYQELTALRKSSPLFTLGDGATVMKRVDFRNTGADQQTGLLVMTIDDGMQAGASLDSRVDGIVVAINAAPESRTLQDFAGTSLQLSAIQQAAGDRSLASGVQVAADGSVTLPAWSVAVLELPQGESQGAGLPVSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords pullulanase
publication title Crystal structure of pullulanase: evidence for parallel binding of oligosaccharides in the active site
pubmed doi rcsb
molecule tags Hydrolase
total genus 340
structure length 1052
sequence length 1052
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2005-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fhbA03
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2fhbA01
2.60.40.1130 Mainly Beta Sandwich Immunoglobulin-like Rab geranylgeranyltransferase alpha-subunit, insert domain 2fhbA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fhbA05
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2fhbA04
1QRKA 2E4TA 3WIIH 2RGSA 4WTWA 1JPST 1J12A 3U82B 3CD4A 3W53A 4HA3A 2NY1D 1NCCL 3C60D 1WZLA 4MVBD 4Z7UE 5IVXE 2F2HA 3CHFA 2ZIDA 1RUQH 1QWUA 5TD4A 4RMTA 1UCBH 4AD3A 4HIXL 1ZA6A 3N06B 3ARFD 4LLUA 4G9FA 3F5KA 2OMNA 1A3LL 4E41D 4WEBH 3WFDH 1ZA6B 4HUVA 2YUVA 4LLUB 4G9FB 1I85C 5EMYA 4IOSD 4RIRA 3MV9B 4HUVB 1HINL 2AS5M 2VOTA 3L3IA 1R7OA 4RIRB 5TDNA 4I13B 4RGOH 4CD8A 2DLEA 1WTGT 3ZE2F 5TDNB 3BYYA 4OM0L 5BV7B 3BEWA 2JB5H 1G7PA 2JALA 5CUSL 1XYZA 3VXUA 3BEWB 5DMIL 1G7PB 4PD4J 2VLME 3VXUB 3IFLL 4JN1H 1G0CA 2FEDD 1LO3L 4AMWA 5AYIA 3G6JF 3AREC 1CTOA 2XZAH 3I6LD 1QSED 1KGXA 4FQ2H 1GPOH 4PJEE 3VGAC 1GCYA 2MCPL 1VSCA 1HJSA 4Q22A 4ENEC 5DJYB 1MCSA 5D7JD 4U1LA 1BYDA 4KKAD 1KFAH 5IHZA 4U1LB 1OIMA 1IE5A 4UINL 4LVOC 4ORGA 4L8SC 5IHZB 2DPEA 4ORGB 1JGUH 4PTWA 2W9DL 5EFDA 2BVDA 4MNQD 4KTYA 3BZFA 4GBXC 2D0GA 2Z35A 4QRRE 1QW9A 1NCBL 6A3HA 4XP1H 1JMXA 3BZFB 4UIKL 4M4PA 2Z35B 1M4KA 2EO9A 3ARRA 3C2SA 2EADA 3OXRA 4PJ9D 1RIUL 3CLFH 5LAXA 2WNWA 5GZOD 3VNZA 3CFEA 3OXRB 5A8OA 5LAXB 2VDRH 3CFEB 2JELL 1FZKA 5ENWA 4NM8H 3IRZA 2HJLA 4F8TA 4AQ1B 2ENSA 1FZKB 1JCKA 2HJLB 3QDMD 1BD2A 2IEPA 1R85A 3APGA 4M6ML 1OARL 3FW6A 1BD2B 2H2SD 3P3YA 5D7SL 3SE8H 2Z8SA 3ILPA 5GS1C 4OQ1A 1CR9H 4W4OA 4M1CC 3ILPB 4DFHA 4D0DA 3HC3H 4XHJC 2YC1A 4RGNE 2XPGA 5DD6A 4D0DB 2YC1B 1QNZH 4JCLA 5DD6B 2XPGB 2P7TA 3DMMD 2VL5A 5F96H 4YHKL 3S3PA 3FONA 2R56L 1HSBA 2P7TB 1DBKL 4Y0GA 2VL5B 3O9WD 4Y16C 2X4UA 4JFDE 5EOCJ 4JFHE 1OM3H 4GIAA 1SQ2N 3FONB 4PJ8C 1HSBB 2A9NL 1I1XA 2X4UB 4JFQA 2APVA 3OJVC 2ZP0T 5KOMC 4JFQB 5D7KD 4FFVD 3QIBA 5A8NA 3QIUC 1FL6A 1CDUA 2V17H 3OX8A 4WTZA 5TE4H 3QIBB 3QP3A 4XCCH 3NABH 2GDVA 1E6JH 3EDJA 1FL6B 4QHUA 3WQ5A 2EDWA 2AQ3A 1QI0A 1D5IL 3OX8B 4KHTL 5ECJE 2HISA 2OZ4A 2DT0A 1OTTD 2DIAA 5H8DA 4IDJH 3W38A 4M29A 1LGVA 4RAUA 5IGXL 2DBJA 2GFBB 1CGYA 4RX4A 4MDJB 5FYKL 3VXTA 4Z7UF 3WF2A 1T83C 4RAUB 1I1AA 2A6JA 5IVXF 4L3CA 3ZJ7A 3TO4D 4DEPB 1ACYH 3VXTB 1I1AB 3VMPA 2A6JB 3BW9A 4L3CB 2CR6A 4O00A 3QCUL 3NSXA 3BW9B 1GAFL 3JV5A 2IMNA 1J10A 1FCCA 1FLRL 1J5OH 1KGCD 1N6VA 4ZFFA 3GUTA 4PD4K 5HI3C 2DWDA 4ZFFB 3GUTB 3VGBA 4WHYH 1TQUA 1VA9A 3G6DL 2WZHA 2DWDB 1H0DA 2OR9L 5CLWA 1PSKH 3S36L 5EH1A 1KIPA 1US3A 5TF0A 1H0DB 1KPRA 3KLHD 5I2UA 3QXTA 1NMAH 4I9WD 1DBAL 1KIPB 4O4YL 4HEME 1KPRB 2O5YH 5CILL 1TVBA 1YEKL 4MA8L 3LEYH 4XT1C 4Z7WA 1CVSC 3VIMA 3QDGD 1TVBB 2AABL 4OKDA 5A2CA 1OAXH 4YFDB 4M7LT 3HNTH 4YWGL 4Z7WB 1EHAA 3RAJL 4ZOAA 3DI2B 4PJEF 2DKUA 5IJKA 3AWFA 3HRPA 4CVZA 3BUQA 1LF1A 4PRBA 4GW4A 4CVZB 1FE8L 2QSTA 4PRBB 4GW4B 3ARDD 5LA0A 4X8XA 4HAFA 3QUKA 3BPOC 4LSPL 1WDPA 2EDQA 2X5PA 4C56A 2XTJC 4KKBC 1HNYA 3K80A 3ZKMD 3WSQH 1A7PL 4C56B 4TUKL 5IB2A 4D6EA 4PIRF 5HDLA 3SBWC 5IVZA 1BQUA 4JM4L 5DHVA 1ZANL 4W86A 3R8BB 3WFEL 4L9LA 4LQFL 1JHLH 4TVPL 5IB2B 1PLGL 2F19H 5IVZB 1H5BC 5CJOH 5DHVB 4YDLB 3MXVH 4L9LB 1MVYA 3U7YH 2G5BA 2FH6A 1AC0A 4DKFL 4P23A 4B50A 4JO1H 2QHLA 1AQDA 1MEXL 2HLAA 1QFWL 5DRWA 5E8DH 4P23B 5A8MA 5C3LD 2HLAB 5DMJB 4J6RH 2W92A 1A02N 3VX1A 1DQML 1V3HA 1TVDA 3WH6A 2W07A 2CQVA 5SX5K 5JBFA 4RAVA 3NH7H 1H3VA 4L8CA 4ATWA 4RAVB 4L8CB 2NYYC 4KI5D 5BRZD 3AICA 4UTFA 4UILH 2ZJSH 1YQVH 2FX8H 2JJTC 3MRHA 1JNNL 3SCTA 2MJWA 3LS4H 3RPMA 3SGEI 3MRHB 1IJ9A 2EO1A 3RVTD 3H9SE 4LSQL 5T3ZH 4JL2A 2VQ1A 3D25A 4KJYA 4YPJA 4JM2C 5D4QA 3JTTA 4XP9L 3R4DA 4M93C 1MWAA 5AYUL 4HOXA 2VQ1B 1KN2H 3UTZA 3D25B 4KJYB 2HTLC 2XN0A 4P3CL 1JP5A 4YHNA 1MWAB 3TTOA 3UTZB 4YHNB 4ZS6C 1BQLH 4L8DA 1KEGL 15C8L 2ESVA 2F18A 2UY5A 3GO1L 4L8DB 4LHUD 2Q8BH 5LYRA 1RFDH 4QRPD 2B7DT 4JFZH 1A22B 5MP6L 3GXIA 1T03H 1MJ7L 3SDAA 2PO6D 3VXSE 3AFBA 2GTZA 2H32A 2AJUL 5A1AA 1O6IA 2CCRA 3H3KA 3SDAB 4YQXH 2H32B 4NOFA 4H0HB 1HQ4A 1L7TH 1WWWX 3AHZA 4M61A 2PYFA 4NHUB 4ERSL 1HQ4B 3D39A 2NT1A 3VFNA 4PJGA 4Y19A 4F79A 1HNFA 2WP3O 2WBJC 1Q0YL 2XV6B 2HAZA 4PPTA 4M61B 2PYFB 3VFNB 4PJGB 4Y19B 2VCCA 5GS1A 1BAFH 1NJ9A 4N8PA 2VT0A 2DQIH 1MW3A 3HAEA 5GS1B 4GLRI 3U48A 1NJ9B 3N17A 3QUZD 3HAEB 4OZHF 3AIWA 1V5JA 3EDKA 3DO3A 2YD8A 3F7PC 3DDGA 3BAEL 4WHCA 1UWEL 5TE6H 1HL9A 1QBMH 3VH8A 4DN4H 4Y16A 3G5YA 3O81A 3VH8B 3QEQD 1LE5A 4Y16B 5HGGS 3G5YB 1CDGA 5EU3A 4OLYH 1LE5B 3ULVC 5KAQG 3IAPA 4L4PA 1HJVA 5FUOH 2GY7B 5B39G 1KPUA 4LGRB 4R4FL 3IAQA 5CWSA 1A6WH 1TTUA 2WCSA 3DC0A 3ARQA 3RWJA 2X2HA 1R86A 1WB0A 5T1MA 3SE4A 1KPUB 5CWSB 4NHCH 3RWJB 3M07A 5CGMA 2Y1VA 2DQTH 4N8CH 4HC1A 4A3YA 2PCPA 2CRYA 4NXSA 3WKML 4NQDE 1E43A 2FL5A 2ZUYA 1XRVA 4ZNEA 2PCPB 4KGJA 3LRKA 1PFCA 3WL0A 2B0SH 2FL5B 4Q9RH 5E2TL 1T83A 2J7DA 3V0WL 5GS0H 1RZ7H 1U0QA 4FA8A 3QJFA 4EN3D 3MOBL 4RBPH 4LCCC 3VDBA 5F9AC 5T1DH 3W9DA 5HOSA 5A2JH 3GNPA 2GSGA 1I3GH 3VXPA 3CUGA 3W9DB 3LPWA 2GSGB 1PJ9A 1MI5E 3VXPB 3X11A 5FIPA 1U58A 2KPNA 2DOCA 3X11B 3NIFE 1U58B 3GJFA 2XRAH 3K8KA 1JFXA 5D71H 2ADFH 3FL7A 5K9JL 4M62H 3GJFB 2W62A 1KCUH 1V3KA 4GKZA 4OJFH 4ZSOE 4GKZB 1EJ6A 2XTLA 4X9IA 2YBTA 1HF6A 3WD5H 3QWOA 1VENA 2X4OA 3VWKA 1PAMA 3QWOB 2F74A 5JQ6H 2X4OB 3E8UH 3IRPX 1H8NA 1Q9KA 4KUZL 4NFBA 3VWKB 1EERB 2ZXQA 3TH4T 2F74B 2OTUA 1Q9KB 3OGVA 1N3NA 4N68A 2Z1SA 1S5IH 2C1OA 5EDXA 2CMRH 2OTUB 3V0JA 5A6BA 4TULH 2KUTA 4S1DC 2Z4QA 1WPCA 2CK2A 3KLDA 1N3NB 4UIMA 3EAKA 2C1OB 2CJUL 3AIEA 5BS0E 3UPCA 1CTNA 1KELH 2Z4QB 4UIMB 4B15A 4JKWA 4JRWA 4N9GA 4WFHE 1E6QM 4XWOC 3NGBC 4N9GB 1C5BL 4R4NC 1RUKH 5DQJB 5E8NA 3BPOB 1U8KA 1VPOH 2MHAB 4FNRA 2XTJB 1UG6A 3GMOA 4UT6L 2VCAA 3SBWA 5E8NB 3CZGA 4ZD3L 1MREL 1OGAD 2OWCA 2D7PA 1UYQA 4F37F 4X6DE 1U8KB 5T3ZE 1KC5H 3GMOB 2F7RA 4TSBH 1H5BA 4K94L 2K9UA 3AMGA 3T09A 2P48B 1JGDA 5T5NF 1V3IA 1H5BB 2D7TH 3T65A 5ESQB 1KB5L 1CFVH 3K2UL 5CKAA 5HVGB 1BJ1J 1JGDB 2B2XH 4GRWB 4Y4KC 3T65B 2FCBA 4LLWA 3RI5F 4YJZL 4PN2A 1GIGL 3RX5A 4NZRL 4LLWB 1TETL 4WUUA 2MFNA 3D3VA 2J4WH 3MLSL 2Z92A 3T0EE 1EZVX 4WUUB 3SCMC 3L7FA 3D3VB 4ONHA 2Z92B 4XPBL 3KNBA 3L7FB 1NEUA 4ONHB 1GGIH 2NY6D 3MRBA 3O3BA 4UT7H 1MJ8L 3QDHA 1T1ZA 1M53A 3N1MC 2B20A 3C5SA 3KNBB 3C6LD 4M24A 3O3BB 3MRBB 3W0WE 1T1ZB 3OKLA 3C5SB 4WRLA 3AYRA 4XMKH 3GXDA 1UR8A 3OKLB 3GXFA 3SGKC 2W59A 4UFKA 2ZXAA 4R3SB 5JIWA 2VC9A 1QRNA 2Y23A 5BXSA 4LRIA 4XPHH 2HYMA 5CD5D 4DOHB 1RU9L 1DFBL 3UTSE 3VGGA 4G80A 1QRNB 1VGEL 3MLTA 5F7YC 1L6ZA 4X98A 5FXCH 3I3BA 4G80B 4M81A 3MLTB 1NMBH 4Q6IA 4X98B 4L4TE 4XVUC 4I2XE 2QADC 3CMOL 1IAOA 3TIDA 2X8RA 1HSAA 2A83A 4Q6IB 3MJGX 2KDGA 1IAOB 1UM5H 3TIDB 1HSAB 2A83B 5DZOA 4IRJC 1F90L 3AQUA 2WMPA 2NX5A 1ITXA 1EIBA 4OQTH 1Q8MA 3MV8D 3QHFL 4GQRA 4GMSL 2NX5B 1ZT7A 4PYHA 5ACLA 2VH5L 3QQ4A 5DFVC 1A4KA 1T80A 4XPGL 1JWSA 1ZT7B 1FH5H 1TE1A 3QQ4B 1C90A 4YHML 1A4KB 1JWSB 2WBJA 2D0HA 3MANA 4OUUA 2O5ZL 2DTSA 1RP8A 1KJ3L 2WBJB 1Y6NR 4OUUB 4R97C 5JIPA 1YEEH 1DZBA 4GKLA 3MRLA 4ACPA 2OTPA 5I1HL 4F9DA 1MCPH 2O26U 3ETBF 4IIQC 1J7VR 2DIJA 3MRLB 1Q9WA 1M01A 1PX8A 3FB8A 4LFHD 2R69H 1WVZA 3B6SA 5EA0L 1A7BA 1Q9WB 1ZB5A 1KB3A 4N5ED 1UZ1A 3FB8B 5ESAA 3NIFF 1RVFH 3ZYJA 3HE6D 4YEFA 3B6SB 1RY7B 2AGJL 2VC2H 2N56A 4XGZA 5ESAB 5SWZE 4M43L 5FDYA 3CUIA 1Q72H 1I1RA 1DL7H 2YKLL 4XGZB 1BOGA 4M7ZC 2C3XA 5ERWA 2YFNA 3GTNA 5BXRA 4HMEA 1ZLVH 1BOGB 5ERWB 2NT0A 3UTTA 4BQ5A 4RQQA 3UYRH 4EEEA 5I23A 5A3IC 3MA9L 3S34L 3UTTB 3F8UB 3S35L 1J0YA 5FHAL 2AEQL 1H8SA 2ZUTA 3GH7A 4FQIL 1JGVH 2EICA 3GSUA 1VFOA 5JXAH 1JD7A 5CP3H 3GSUB 3QEGH 3S37L 4LCCA 3OLDA 3WL1A 3ZLQC 2ZUSA 1W1PA 1H0IA 3VIHA 4LCCB 4W7UA 5HD8D 4DFIA 3RL1A 1BYAA 1QD0A 2PW2A 3AUVA 3VFOA 4TRPH 3HG4A 3LIZH 3PQYD 4OB5H 3RL1B 3KPOA 3TN0D 1BOYA 3KHOA 3VFOB 2PW2B 4X6DF 4XB8A 4PJ5E 4FFWD 2NY0C 4JREB 2FATH 3KPOB 1KCSL 1QFWM 4FK9A 1R0AH 3N1FC 5FYJH 3HNVL 1JPFA 5IK3B 1HEZA 3BUYB 3ROOA 1IAIL 1JPFB 4K68A 1EZVY 2OLDA 1GZPA 2EDDA 1HEZB 4P4KB 5E9DD 3ROOB 2FX7L 2P45B 1GZPB 4CMHC 3E1F1 1F6LL 4HWNA 4QEGA 4N0CC 4WW2F 4XX1G 3O6LL 1W0WA 1RMFH 1NLDH 4ZE5A 3OIHA 2GQHA 4FQ1L 1W0WB 5JW4N 1N8ZA 4RRPG 2BXZA 4NZTL 3WY1A 2DDQH 3MFGB 1N8ZB 5HI5D 3ZIZA 2RFXA 1RJLA 3TV3L 4O02H 1WK0A 3JV6A 2XIDA 2RFXB 1RJLB 1HJUA 3O4LD 3JV6B 1H11A 1NC2A 2VURA 3NCEB 2XZCH 4D6FA 3C5ZD 1NC2B 3TJEH 5IMKB 4ZAKC 3B4NA 3U7WL 3CZKA 4HF5L 5FM8A 4WCYL 1JTPA 1KENL 4JPWH 4XP6H 4JFED 3CTTA 5FA3A 1FORH 3FT4A 2F54D 3RVUC 1TJIL 1R3HA 4N0RA 5FA3B 3FT4B 2XQYK 3C5JA 2Q6WA 2C7FA 1R3HB 5E4IA 1N64L 1FHGA 3C5JB 4NKIL 2Q6WB 5A2BA 2HFFA 2FJFA 3RKPA 4TSCL 4XI5D 5AAMA 2P5EE 5HHMB 3KPPA 2C8NA 2HFFB 2FJFB 3GH5A 3I50L 3KPPB 4PS4L 4ZO6A 4ZUSA 3SCVA 1ORQA 5DYOA 1XGUA 5DVKA 2EZ0C 1Q6CA 4ZUSB 3KJ4B 4RFNB 1O0VA 1ORQB 1UJ3A 3CX5J 2K1MA 1BJMA 1XGUB 2HFGL 4G7VH 2BNRA 4KUCF 4X6EA 5IF0A 3RM4A 1UWQA 5LBSH 1BBDL 2FDMA 1UJ3B 4PFEA 4YXLH 5IF0B 4X6EB 1QOKA 2BNRB 5D7LA 3P0YL 2Q87A 1VDGA 1RK0A 1OD0A 5D7LB 1TPXB 3T2QA 2YPKA 1YN6A 4Y5VC 1QBAA 4HIEA 3U4BL 1RK0B 3HPJA 2BJML 5D1ZC 4D2NA 1WTLA 5A6LA 2YPKB 1YN6B 4HIEB 3HPJB 4ZMAT 4BSJA 3O2WH 3EBAA 3MC0A 5I6SA 2R29H 3KLLA 1A9BA 4H1LA 1UD3A 1EBPA 3VFGH 3GIVA 4HJGA 1A9BB 4H1LB 2NY7L 4M6OH 3BZ4A 1CGTA 3GIVB 4HJGB 1DQJA 3BZ4B 2AJSH 2VZ1A 1OSEA 3BSGA 1OQOA 1DQJB 4UFJA 1S9VA 5E6IC 4G6ML 4DM2A 1S9VB 3MGAA 3ARPA 3AIBA 4KROC 4YHEA 3MLVL 3NCYS 3OPZL 2F53A 1V7NH 4LEXL 1CDCA 3M6DA 2BP3A 4QXUL 3RWHA 1OD9A 1GNXA 2F53B 5E2VH 1A4JA 2C3HA 2VLMD 4IIQA 4P3WA 3HI1A 3RWHB 2VXTL 3B2VH 3MV11 4S1SL 4IIQB 2WVUA 4EXKA 1B31A 2V5CA 4GG6A 3HI1B 5E1HB 3N12A 3ROLA 2OYKA 5C3TA 3LOWA 2J75A 2XFRA 5EBMA 1BSIA 4EK7A 4LASL 2YWZA 5FCZA 4GG6B 3ROLB 2J8GA 5DT5A 5EBMB 4NZCA 5TH2A 1OGGA 5TJWK 5TH2B 4U4BA 1IEAA 4JY6A 3DXAE 1IFHH 3QWQB 1XFPA 5LGHH 1IEAB 4JY6B 1B4RA 4NRYA 2DQCH 1LO2L 3FCTA 5AYQA 4N90E 4M02A 4Z2GA 4JQIL 4NRYB 4OAWA 2V2TA 3RA7H 3FCTB 3GZKA 4M7KH 4P2QA 5D2NA 5C0AA 1MRCL 1J0KA 2HLFC 4OAWB 2V2TB 1WCGA 1E6XM 5IBTL 5D2NB 1A6TB 4P8VA 1MQKH 4YXHL 5SWSE 4U6HA 2IJ0C 3BT2H 3MSDA 3ULUL 1I8IA 4UT9H 4QRRD 2OSXA 3U1SL 2AI0H 4U6HB 4R5EA 2IGFH 5IKCB 1KCRL 2V2WA 4LMQE 1CGWA 3VWJD 4AZHA 4G6KL 4X4YA 1B3JA 5A6JA 3GMQA 2ZG1A 5GRJH 2ARJA 3GM0A 2DQGH 3BQUD 1AXIB 1ZVHA 2IBBA 4X4YB 3GMQB 1GGUA 5D2LF 2ARJB 2A3AA 1NUFA 1BLNB 5C07E 1AGDA 35C8H 3KDMA 4D9LH 1GW1A 3WFHA 4A3HA 2BRRL 4Z5RA 4JQVA 4M48H 1AGDB 3I3EA 1LL7A 4CVXA 3KDMB 1BF2A 3CVIH 4U7MA 5HYSA 3WFHB 4NCDA 4CVXB 5FHBH 1BM3L 5HYSB 4GFTB 3U9UA 2EACA 3OZ9H 1VACA 1QUNA 4Z9KB 4OCSH 2XXMB 3V52H 4RISL 4PJCB 1AR1D 4NSKB 2BSTA 2B1AL 5HDRA 2AJYL 1VACB 2VMFA 3KXFA 4J4PC 4JHAH 3L1OH 2BSTB 3WN5C 3H7LA 4RGND 3KXFB 3SEPA 1WFUA 2F8QA 4TYUA 5ILTH 4JR9H 4CMHB 4ZUWA 3CX5K 3AC0A 4ODTL 5DURB 4HWBH 5DJCA 3KL3A 4FXGA 2VKXA 4J23A 4ZUWB 1FNSH 4XP4L 1I1YA 2MWCA 1OTUD 4JFHD 5DJCB 4FXGB 1EDTA 4OGYL 1YJDL 4KRUA 1I1YB 5IB5A 5KSAC 4L29A 2O92A 3PHAA 3QH3A 1OQXA 4HZLA 1I7ZA 4B5EA 3BRDA 5IB5B 4EVNA 4L29B 1MIML 1H8OA 3EO9H 4JZJC 1I7ZB 4EVNB 4RMSA 5JW4M 2WQRA 4WTZG 3LSOA 4NGHH 1IQWH 1INDH 3MJ9L 3LN5A 5ITBH 5CMAA 1MIEL 3BVNA 3LSOB 4WUKH 3BAIA 2WZEA 3PZVA 3LN5B 1QEWA 5CMAB 2AEIT 2IPKA 5I1CH 3BVNB 5F7KC 1A14H 3BKYH 1LD9A 3OB8A 4PP2A 1DWHM 1V02A 1QEWB 2W9EH 2IPKB 4WWID 3QUYA 1LD9B 4PP2B 3EFFA 3S5LA 2VUYA 3QUYB 2DF3A 2R1WA 5IDIA 3P4NA 1K2DA 5IMMA 3EFFB 3LHPL 2DSZA 3S5LB 3GBML 3GSOA 3P4NB 1K2DB 3GSVA 1S8DA 1W91A 2DMBA 3GSOB 3GSVB 3DX4A 4HS3A 1S8DB 5T3XE 5GJTL 2HVJA 5DC4B 3W9EA 1XSKA 1UQSA 3POHA 3S3SA 4HS3B 4FQJH 5I1JH 2HVJB 1L7IL 3W9EB 5DJZA 1UQSB 1A9EA 1IGFH 2VXQH 5JZ7C 5DJZB 3AMCA 1IM3A 3MLRL 1A9EB 1LJYA 1C91A 2EYTA 1I3VA 4IMLA 1K6QH 1UM4H 1WCQA 1MCEA 5CCKL 1BPLB 3RTQD 3X17A 2EYTB 4IMLB 3E6FA 1EAJA 2D9QB 5D1ZA 3QO0A 3E6FB 4LGSB 5D1ZB 1YYLL 5E6YA 3LB6C 4HMDA 1F97A 3AS2A 3QO0B 4XAKE 1QKZL 2Q8AL 3MUAA 1C08A 5FM5O 2Z9TA 3KYKH 2F8VA 4N0FA 4EDWL 1C08B 1MJUL 2OMBA 1NOWA 2XN2A 2ZSVA 4QHLA 1EJOL 1LO0H 3A67L 1M05A 1NFDA 3RPIA 4EI6A 1BGAA 5FO8A 2ZSVB 4RMVA 4QHLB 1TNNA 5LWYH 1T0MA 4OT1L 12E8L 1M05B 1NFDB 2AAVA 3RPIB 4EI6B 5FO8B 4QHNA 3S6TA 1FPTH 2ADGA 1T0MB 2FD6H 3THDA 2EJ1A 1B88A 2JK5A 2FBJH 5JOPD 1UA6L 4K23L 3V9FA 2NR6C 2ADGB 2XQBH 1HWWA 1KXQA 3QI9D 2JK5B 1TTFA 1AD9A 5JOEA 1MFAL 3MI6A 3H7BA 3CHEA 1ZHBA 1R3IH 1AD9B 3JWOL 3FFCA 4XMLH 3H7BB 1JPSH 3P4LA 2X9XA 1ZHBB 5J8OA 2JIXD 4HWUA 3CSPA 3FFCB 1G9NH 4XC3H 1TCMA 1YECL 3HG1B 4EUPA 3QWRA 3IDGB 2YLAA 1WEJH 5GRWA 1VB9A 3PV6A 1KFWA 2CHNA 2Y8KA 2G75A 3LQAC 5ID1A 1FZJA 5F9WC 3PV6B 3ARED 4MD0A 2G75B 5ID1B 2GTWA 4PCTA 4FLQA 3MV9E 4A2MA 1N5YL 2GTWB 3EYQC 5DSCA 5F7FA 4FLSA 4FABH 4P49A 4CN1A 2BXYA 3QFDA 4ALAL 2YBRA 5DSCB 3FN3A 3NA9H 3H9SD 5E5UB 1WLHA 3QFDB 1LDPL 4LLAA 3RBGA 3MRKA 2YBRB 1ZXQA 4ENED 5C08D 4D9QE 2WC4A 4ZXBC 1JZ2A 4BQ2A 5JO5A 2DL9A 3MRKB 4AY1A 1GZJA 4NRSA 5JXEA 5JO5B 1P69B 3LRHA 4C7FA 3HUJE 3SJVD 2LU3A 3OGOE 1PGRB 2VLKE 1I8MA 4ZS7L 4GO6B 3W6MA 1OSPH 1X1NA 3VRJA 2PYEA 1Z3GH 4GBXD 1ZA3A 4H5SA 4MJ4A 5KS9A 1IGCH 4KY1H 3STZA 3VRJB 4LHQB 3ISWA 4KVCH 3KPRA 2PYEB 4H5SB 4Y4FC 1ZA3B 1F02I 5KS9B 3NVQA 5HHOA 3STZB 1DQLL 3VXSD 3KPRB 5TFSH 4NRZA 2VL4A 5HHOB 2AK1L 5JW5A 2HH0H 4YUEH 3G6MA 4NRZB 3ECQA 3WF1A 3AIRA 5JW5B 4WY7H 4MAUL 3TWCH 4M5ZL 1A0QH 3RX8A 4GRLB 3FRUA 4PB0H 3V4VL 4KK9D 4LNRA 3SCQA 1LO4L 1DUZA 4NKMA 3FRUB 5T3XL 1NBZA 4LNRB 1JGEA 4PLKC 2A77H 1DUZB 4NKMB 4UV4L 4J4PA 4FQLL 1NBZB 4PRIA 1JGEB 4MQ7A 3WN5A 1N59A 1W72A 3FO0L 3KYNB 3RVVC 4PRIB 5TGBA 4MQ7B 4HLZG 3HMWH 3WN5B 1N59B 1W72B 3PDDA 2J8OA 4XHJD 3UBXI 5TGBB 3LRGA 1P4LA 1ZMYA 3DVGA 2VDNH 5DD0L 1N0XH 1CE1H 2UWEE 1P4LB 3DVGB 2WQ8A 3AVEA 1RIHL 2EEAA 3FOMA 1CGXA 4XNUH 3MLYL 4JE4B 3CLEH 3FOMB 4PJ8D 5FUZH 5TE7L 4ELKA 2XFFA 3HZMA 4K3JH 3TC9A 4ELKB 3KWXA 4GSDL 3HZMB 2BVYA 4JN2A 1KN4L 5ID0A 2X4RA 3O8XA 4OZIE 4JN2B 4IRZL 3QIUD 1YYML 5ID0B 2X4RB 4NQDD 4AEFA 1CI5A 3O8XB 1MWAH 5E5RB 1EHLL 1YEIL 4PYSA 1QTYT 2GT9A 4FNQA 3Q5YA 3UESA 4YDKL 4NQEA 2OX5A 1HWHB 2GT9B 1GHFL 3SCWA 5I71B 4TOYL 3BXWA 2H41A 4NQEB 2BY1A 4XPFH 1D5BA 5KVDL 4Q6YA 2ZPKL 3WH8A 4QLLA 3AY4A 1FAIL 2YPVH 1RZKC 3QULA 2A3BA 1D5BB 1MCWW 2CUHA 2W60A 3KR3H 2WPGA 1FC2D 4UV7L 3UJIL 2ICWA 4JJ5A 1QFHA 3BUBA 3QULB 2O9RA 2W60B 5CGYC 1P7KA 5SX5H 3FNDA 2ICWB 4JJ5B 4F33A 2QHRH 4ODWA 1KPVA 4QDMA 1P7KB 3MOQA 4G8EA 1WZ1H 1FJ1A 1CQYA 4Y1AA 3Q3GA 1DSFL 2R0WH 4HPOH 4F33B 4ODWB 1KPVB 5D70L 5HI3D 1OPGH 4G8EB 1JZ5A 1FJ1B 4Y1AB 5I16A 3Q3GB 3PHQA 3VD7A 1P4BH 1JHKL 5IVOA 1HXMA 4L4JA 2CSPA 1N82A 1XF1A 1M6OA 3PHQB 3OLIA 2EH8H 1YQ2A 1DBJL 1RZIA 3KPSD 1HXMB 1ZEAH 2QSCL 2NY5H 5ETUA 1W1TA 3HAEH 4UFLA 1M6OB 1FVEA 2Y6SC 2VNCA 5EOCH 1K9DA 3BSZH 1RZIB 2DTMH 3IS0X 5ETUB 4HTYA 3U83A 2G3IA 1FVEB 2IPUK 3PE9A 4MSWA 1YEGL 4APQA 5BV7L 4N0UA 2FJGA 5DUPH 4MB5A 3OQ3B 2CBUA 3S2CA 1DE4A 2Y07H 5EBGA 1QWNA 4MSWB 3UC0H 4APQB 4N0UB 2FJGB 4FZ8L 2AEPH 1DE4B 5BS0D 1LQSR 4QCEA 4WI9A 5C6TH 1J8HA 4NP4H 4WFHD 3FMGL 3MBED 1J8HB 4DO4A 5CP7A 5IP4A 2L0DA 2DQHL 4NQSA 2D1ZA 5CP7B 3FO9A 4KKBD 5D1XC 2ZKHL 3M8OL 4NQSB 4Z6AT 5T3ZD 3FO9B 1GGTA 3EDDA 2FE0A 3PWPD 5KSBA 4XCYA 1P1ZB 3X3FL 4G8GE 1WBYA 4QWWC 4P7OA 1JDAA 5KSBB 4XCYB 4Q74A 1KACB 2ARJQ 4MNLA 3SDXA 1WBYB 3VSUA 4M7LH 4UQ2A 4AD5A 3SDXB 3H8NA 3BISA 5GHWH 4J3WA 4UQ2B 2G2RA 3IU4H 3L4XA 1BZ9A 5E56A 2G2RB 4LF3B 2ERJC 4YX2L 5C7XL 3DYMA 4UQDA 1BZ9B 3C8DA 3L3HA 2E6PA 3PP4H 4D0CA 4CUCA 2B4CL 1U3HC 1DEEA 1U6AH 1ZHKA 5D5MA 4F7TA 1XT5A 3QXDB 3L3HB 4OFIA 1TJHL 4C56E 1DEEB 4DGIL 1N4XL 1ZHKB 5D5MB 3W0WD 4F7TB 1JTTA 2ZX8A 3O2DL 4P8UA 5AZ2H 4NN6C 1G9MC 3RUGA 1JGLL 5E8OA 3CZFA 2C0HA 2R0LL 3RUGB 4LAQL 5E8OB 4PLOB 1EDGA 3PBGA 3UTSD 4J28A 3CZFB 2AKRA 5C9KA 1BFVH 3VRLE 1EFQA 3RY5A 2X1PA 1RD6A 4JM2D 3BO8A 2AKRB 4MJIE 2UWEF 4JFFA 1LO5A 3D0VA 4XTRC 4LVNB 1PIFA 4L4TD 5B3JE 1AKJA 3W11C 3EYOA 3BO8B 3IJ8A 4JFFB 1LO5B 2DL2A 3D0VB 4XPTH 1KCLA 3DRTA 1AKJB 3GI8L 1LMKA 3NUKA 4ZS6D 3DRTB 4PTTB 1E4MM 4MB1A 2KQNA 1ZVYA 3VVGA 4Y8DC 4K8RH 1RH9A 1LK2A 4FP8L 1NSNL 1SZNA 3QHOA 4XMPH 3SCUA 1LK2B 3T1FA 1T22A 4OZIF 1HI6A 1E55A 5GJSL 3SKMA 1T22B 3TP4A 1FH7A 3SPVA 4G7YH 3UP1A 3MUJA 1QYGH 3MOAH 3SPVB 1G9MH 4U5IA 1IM9A 2X89D 3IJSA 4M00A 4K71C 4KUCD 1PG7X 3RFZC 4EOWL 4GRMA 1IM9B 3IJSB 1V6WA 2WYSA 3S88H 4JRYA 5F9OL 4HZ6A 3D1MC 4GRMB 1OCWL 5B38A 4JRYB 4Z7VA 4PJDE 1A6VH 2OZ4L 1WDRA 1T5WA 2ZNXA 3D50A 5B38B 3U2SA 4Z7VB 3GDBA 4KQ3H 1T5WB 5DT1L 4JFTA 1ZT1A 3U2SB 2J73A 5SWZD 3I2CH 3FRPG 1ZT1B 5EU5A 3MV7A 2IALA 3K4DA 7TAAA 1DTUA 3HFMH 2WHMA 2OL3A 5EU5B 3MV7B 2IALB 2Y36L 2DWEB 1INEH 2OL3B 4OGXH 3U0TA 4PJGE 5K59F 3AI0A 2W66A 4B3KA 4HS8H 3U0TB 1CCZA 1FIGH 1B9ZA 2DD8L 1FP5A 3W0KA 2VX5A 1Q0XH 4S1QH 2Q76A 3LKSA 3LVEA 3EHBC 4PJ7A 4B41A 4KTDL 3WQ6A 2WZIA 2XVLA 1MF2L 2Q76B 3LKSB 5I1GH 4PJ7B 3IJHA 4XVSH 1JNLL 3LZFH 4HA1A 5F72S 3IJHB 2IG2H 3BESR 4NZFA 4NN5C 4S0SD 3VFWA 4G5ZL 2FIKA 5KVGL 2ZCLL 1W0YT 1OAUH 5IB1A 3ZSTA 3VFWB 2FIKB 3S8WA 1HYSC 4FLOA 4PJ5D 5IB1B 1BYBA 3BE1L 5CIPA 1FL3A 4YDJA 4V1DE 3RZCA 1S3KL 1U2HA 5CIPB 1FL3B 5ICXA 4H88L 4YDJB 3PABA 2UUDK 1T2JA 3RZCB 2ZG2A 2WMHA 1AR2A 1UG9A 5ICXB 3L5XH 3PABB 1EMTL 3WDRA 2ZOKA 4EJ1C 3LH2L 3THCA 3Q0HA 4HIJA 1T5XA 2ZOKB 3V0AC 5BO1H 2HJFA 4HIJB 4Q0XL 5KN5A 3HS0A 5JDJA 2DGAA 1T5XB 3VGHA 4GS7C 4F9LC 5INCA 1AE6H 1YPZE 2HJFB 4OD2A 5CEZL 5KN5B 3HS0B 1KGUA 1R24A 3GB7A 1V7MH 4KZEL 5INCB 1JUFA 1MCCA 2CR3A 4FQPA 4HMCA 1R24B 2WWKT 3GB7B 5I1IL 3BCFA 3MRIA 1H5VA 5JW4R 2PBOA 4IPNB 2MPAH 1JUFB 2UZIL 1UADC 4BSWA 4IBLT 2ED7A 4PSPA 3UROR 3MRIB 3BX7C 3PG2A 4NM4L 4DGVL 4MA3A 4AD1A 4BSWB 4RDQG 2EH7H 2QQLL 1NWTA 3KPMA 3AHVA 3DLQR 4MA3B 3A47A 1H3PH 4XWOD 3K1DA 1Y7VA 4IUGA 4R4ND 5LJYH 3VRLF 1U8OA 3WENA 3ZHLA 1XF3A 2BHUA 4L8BA 3AFLA 1J8KA 1U8OB 1R6VA 1E0OB 1XF3B 5B3JF 3KPTA 6TAAA 4L8BB 2V7HA 4PLNC 5B22A 3AIQA 5FKAA 2V7HB 5IROC 1J0JA 2FHBA 3DSFL 4JB9L 5TPWL 3WNMA 5FKAB 3EUUA 1NL0L 4Y4KD 3F7QA 1F00I 5F6IB 5J12B 5CSUA 2DT2A 1X5GA 4W68A 3ALGA 1BWWA 4RMQA 1QNZL 4GAJL 3U6RA 3SKOA 4D6DA 3GXPA 1ND0A 3U6RB 3SCMD 4MMZC 5BXTA 3SKOB 3RQ3A 5IFAH 2NTFA 1K3IA 2AXJA 4WSJA 2CKNA 5A6AA 4LARH 4KPHL 3LXAA 1ND0B 4PY7A 4W89A 3K2MC 5BMFH 1HT6A 2YPLD 2E9LA 3T2NL 1K4DA 5EUKA 4PY7B 5LCVH 4Q9QH 2OYLA 1GQLA 4WI7A 1K4DB 5EUKB 4R2GC 3F58H 1OM0A 5ADPL 4DKEH 4PR5A 1UXSA 1J0HA 1A5FH 3KS0H 3VILA 5D96C 2VXUL 3GKWH 4O9HH 1IGIH 3ZL4H 1UXSB 4PJDF 5MENA 1UWXK 2Y06H 3DGGA 5EBWA 1G7MA 2R1YA 1OSZA 1KJ2A 4P4RA 5MENB 4P9MH 3DGGB 4OD3L 5EC1A 5EBWB 1G7MB 2R1YB 1OSZB 4P4RB 3SKNA 1NUDA 4K2UL 4NNPH 3W26A 5E09A 1E4KC 1VADA 1DVFC 3SKNB 1HCFX 4XVUD 2QADD 1VEPA 4IISA 5DLMH 4P59H 3ZDXE 1MCOL 1VADB 4CW1A 2FHFA 4H1LG 4WWKA 4G3YH 1AO7A 1NAMA 4QXGH 4CW1B 1SM3L 4WWKB 4IRJD 4PJGF 3SCNA 5A3HA 2GFTA 1SBSH 4NO0A 1AO7B 1NAMB 1HWGB 1QQDA 4XCEA 3JUGA 3CMJA 2BOBA 4NO0B 3WSUA 1BJ1H 1QQDB 3LY6A 4U5KA 4XCEB 5DFVD 2CLVA 5B4MC 4MAYA 2J6EH 1EXUB 5B21A 2PR4H 2MQ0A 4GG8A 4KKLC 2CLVB 1UHVA 1U8PA 4IM4A 4MAYB 3SO5A 2ITDA 4GG8B 2XA3A 2YD2A 2D7NA 1U8PB 3FHQA 2E6QA 3QGVA 3WF0A 1CLZL 2ITDB 4GAYB 5HYEA 1ISVA 1OAKL 4OFYA 1QI2A 3TT1L 4HC1L 3RL2A 3QCTL 1F45A 4AW7A 5C0ND 3RDTC 3WNPA 3RL2B 2XVPA 5I73B 1JFQL 2D7QA 4OCYL 2R8SH 1IT0A 4JHZA 4RFEA 2NX5E 1YC8A 1KF9B 2BFGA 4TPRL 3UTOA 4X9FA 1OP3K 4RFEB 1JMZA 4DW2L 3A6CL 5KZCD 1F2QA 25C8L 1FO0H 3AB0B 3DXAD 2ADJA 4GO8A 1CGSL 1KYOK 3DARA 5FYJD 2DSWA 3A4XA 3MRRA 4X99B 2ADJB 3BN9C 4JGMA 1CPUA 5FCUH 3IVKA 3RILA 3JXAA 4N90D 4LCUA 2Z31C 3Q6GL 5SWQA 1KR1A 4PMDA 3DSNA 3MRRB 1NCDL 1E5JA 3WUEA 4POYA 3IVKB 2XN1A 4LCUB 2VDKL 3WLBA 5SWQB 4PUDA 3O6ML 1DBBH 3W37A 4B7IA 4NBYB 4HZ7A 1YPZF 4JO3L 3BH8A 3WLBB 5A3ID 5GGTH 2DT3A 2VLLA 5FF6A 1PBYA 4FNLL 2QQNL 4YZFE 5SWSD 4PMQA 3BH8B 3C60C 3U4EA 1MELA 3ZTJG 3WXVH 2VLLB 3V4PL 2D23A 3NDYA 2VX7A 2EPOA 5KOVC 2CDFA 2F5BH 3MLZH 2M26A 5I18L 3W4RA 5IB4A 1I3RA 4HQQL 3QOMA 2CDFB 1RURH 3S36X 3TZVA 5AEAA 1UD6A 3ARFC 3U9PL 3RO8A 5L2KE 2IWGA 3DV4A 5IB4B 1RIVH 1S7QA 2YD3A 3TZVB 4OZFH 3L3DA 3DV4B 1JRHL 1KLGA 1S7QB 1B90A 2FB4L 2P44B 5HHXH 5GGQH 5KW9H 2FECL 4QGTA 5ICZA 1MFNA 3RIFK 5J3HD 1KLGB 5HYSG 4ODSH 3UJJH 5ICZB 1PYWA 5FYLH 1YEJL 2NY0D 3V7MA 3UTTE 4YEEA 3TA3D 3MRNA 2DSUA 1PYWB 5FL0A 4DVRL 4UQBA 3G9VA 2X0YA 3VIFA 3MRNB 3EOBA 3VXRA 4OLUL 2QKIA 2YUZA 1JXKA 1U8HA 3EOBB 4IMKA 3VXRB 1MY5A 5BXPA 2QKIB 4LHJB 1CXEA 1U8HB 2AXHA 1QG3A 3BD3A 5J11C 4JZOA 1MFUA 1D6VH 4NRRA 2D03L 4JFWA 2XXCB 3W27A 4N0CD 4OTXH 2WK2A 2WSKA 4JPKH 4JZOB 3ZOAA 1C5DB 3WF3A 4MCZA 4OBRA 1WZAA 4H26A 4MB3A 1MAKA 5CZVH 2VSDA 1NGQH 4MCZB 2CGRH 1VAHA 1MFVA 1GOHA 4H26B 3P9MA 5T33L 5J6HA 3RBSA 3N04A 3CFCH 1A7OH 3GBNL 1RV6X 3P9MB 3H3PL 4LCWA 1XIWC 5J6HB 5E08H 3WDPP 5GSRA 1CICA 3LRLA 2BRQA 3IB4A 4LCWB 3BP7B 1ED3A 5GSRB 1CICB 4QOKA 1R5WA 3V6FA 2C3WA 3WHXA 4QOKB 1R5WB 2EDEA 3WJLC 2EXWC 3AAZA 3KJ6L 4ZAKD 3V6FB 3WHXB 4NNYA 2XWJA 5JW3H 3AAZB 4P5TC 5IMOA 3O6KH 2A3HA 3U30B 3M7SA 4NNYB 2XWJB 2EDFA 3N1AA 2E9BA 5IMOB 3BXNA 3MRCA 3AGVA 4JFYA 2OI9C 4PJ9C 2GITA 3RVUD 3D52A 2Y9RT 3MRCB 4JFYB 2GITB 1AMYA 5CSBA 1ZGLP 5BVJA 4MDPA 1W3LA 4U6VH 3RGVC 4P7NA 1RJZA 5HDQH 5BVJB 2W65A 2EYSA 4B16A 4KRNA 2A9MH 1RJZB 1IGJB 4N0YH 4Y5XC 1HXJA 2W65B 1QSFA 2Z93A 3HNSL 5DJDB 2EYSB 3TH3T 1U8QA 3V6OA 1CBVL 1F4XL 1JWMA 3BI9X 4AIUA 3D0LB 2Z93B 1QSFB 3F12A 3RU8L 1KCVH 1JWMB 3BAXA 4UAOC 2VKWA 4HWEL 1KCKA 1GQKA 3HE7D 3F12B 1QBBA 2RR3A 3QHZL 1IRAY 1UVQA 2J7CA 1QNPA 3FXYA 3NCOA 5E4EC 3HZ3A 3DMMC 1UVQB 5KSUA 32C2A 1S7WA 3O9WC 1E4KA 5KSUB 4UTAH 3CVHH 32C2B 3WFBL 1S7WB 3QHMA 3B5GA 5CJQL 4XAKD 3VI4E 1DWGM 3ZT6A 2ED8A 2ICCA 3DWTA 1OGSA 3TVMC 5DTFB 3MYZA 4JG0L 5I19H 1IGTA 4L1HA 3ARBB 3AM8A 3VXMA 1YEDA 3BLPX 5ABHA 5IFTA 2XG4A 3GSNA 1IGTB 3L95A 2J7FA 3VXMB 1YEDB 1U41A 3MYJA 4LLQA 3OJMB 3GSNB 2VITA 3L95B 5FM5M 2BNRE 3VOCA 3IANA 1Q94A 4JO2H 3ULVL 3MYJB 4YZFF 4LLQB 1XGQA 4OI8A 3WIHL 2VITB 5KJRH 3VM7A 1HDMA 5E6ID 3D51A 2FX9H 5D7LE 1XGQB 3CV5A 2OJZH 3PHOA 3ARYA 3MZTA 5J4MA 4LEOA 1HDMB 3K81A 5E0QA 1ZLSH 5A8QA 2YK1L 3TO4C 5D9OA 4KROD 3LEVH 2FEEL 1C8PA 1KBBA 3PHOB 3N18A 3QDJA 4LEOB 2Y5TA 3F7YA 3FQXA 4U1NA 3CC1A 2CBJA 3QDJB 2BZDA 1UGNA 3BRFA 2Y5TB 3F7YB 3FQXB 4U1NB 5DD5H 3QEUA 4EUPG 1BFNA 3RDTA 2RGMA 1PG7W 4HT1H 4GI8A 4Y4HC 4JIEA 4FTVA 2ADIA 3QEUB 4W6WB 3RDTB 3VA2C 4FTVB 2ADIB 3OF6A 2OJEA 1XGRA 1TQCC 4X4MA 5T5FL 5DVMA 2BNUA 5F1KC 2PWEA 3MV9D 4MS8C 1ZU8A 4UZUA 2OJEB 1XGRB 5LQBL 2BNUB 1R34A 3KZSA 3P11L 2BVUA 3KLHC 4Y2DC 3BVUA 3L2MA 1F4YH 5FYLE 5DQDL 5FECA 1W2PA 2AJZA 3QG7L 3EYUH 1OB0A 3CNKA 5FECB 1G6RA 4D9QD 2AJZB 3FJTA 5L0QC 3VFRA 2ZUNA 3P30L 5ESVB 1G6RB 1EO8H 1QLEH 2DQUH 1A6AA 2F53E 3VFRB 2EE6A 1B1YA 3WV0A 3P4OA 3C60A 1A6AB 4OCMC 2VLKD 3NA4A 5MEOA 3L5IA 3P4OB 1HHHA 2NY1B 1CLCA 2BDNH 4HAGA 1FHLA 1EV2E 3FQNA 3NTCH 3L3KA 5MEOB 1HHHB 4G9DA 3BDXA 3FQNB 3ARFA 1B0GA 3ARDC 3L3KB 4LMQI 4PV8A 3UDWC 3UZQA 4E41A 2BY0A 5E95B 3UO1L 4TVUA 3V7AG 2XA8H 4H20L 1B0GB 4PV8B 1JE6A 2WUCL 1WE5A 4E41B 1D2KA 3MUGA 1FGNH 1KXVC 4U7KA 1VBRA 4LYQA 3MUGB 3QFJD 1Z9MA 3UZVB 5LVEA 3K4ZA 1RZJC 3TYFA 4AIEA 1PW3A 3AXIA 2X4QA 2F58H 3TYFB 3VKKA 1UZ4A 2YMXL 3QXAA 1P84J 1HKMA 1OBAA 2X4QB 3SDDC 3QXAB 4PBGA 4DKDC 5EO9B 2EDJA 8FABA 2UYLA 1K8DA 3BDYH 1IVLA 4R6UA 5M03A 4Y7MA 5CJ5A 4NN7C 8FABB 1A6UH 5HHVL 2UYLB 1K8DB 4NKDB 4AIXA 1MJJA 1HOCA 2B39A 1QSEA 2GSIA 3NAAL 2A38A 4OCRL 4RDQF 5IFJA 1MJJB 1HOCB 1LWJA 1G1YA 2GSIB 3L4UA 5I9QB 1MWOA 3SDCC 6FABH 5IFJB 1NUNB 3IYLW 3V79C 2WB5A 3ZYOA 5IW6A 1MNUL 3NZHH 4M80A 5KSAD 2HVKA 5IW6B 3CJJA 3TCXA 5D7JA 3RVTC 3N85L 4XP5L 1RZ8A 3RY4A 2HVKB 1WDSA 3DX3A 3CUFA 1GGBH 1A1OA 3FTGA 5D7JB 5L9DL 3HR5A 4PJCE 4ODUA 1RZ8B 4XVTH 3NSNA 3BAKA 1A1OB 3FTGB 2D7OA 3HR5B 3PGFH 4ODUB 4BZ1L 3GKZA 4MNQA 2D24A 5H2BA 3BN3B 2V5RA 1SJVA 3K8MA 4MNQB 5H2BB 3MXWL 4AZBA 3VI4F 4PRAA 2XKUA 5AZEL 4JGJA 3MS8A 1V8HA 3MODH 4PRAB 3WCYA 4PJ9A 4OCLC 1FFRA 1M04A 4PJ9B 1CLYL 1E4XH 3N0PB 1QR1A 3IKKA 4H2CA 3MCKA 4MA7H 1QR1B 2XYLA 3EMQA 4ETYA 3QDMA 2N7AA 3MCKB 4J27A 5IEKA 1KSRA 1ONQA 4KDTC 2VLJE 3QDMB 1FNAA 1G0DA 1X5HA 4XC1H 2EXYD 5IEKB 2WANA 1ONQB 5IBUB 2C1PA 3MCLL 5HI4C 4BS0A 2C1PB 5SX4H 2P5WE 4JPVH 1G9EA 4UAOB 3QUZC 1UD2A 3DX2A 1CGUA 3BJ91 1V02E 3DMMA 3V95A 4WJXA 3NFSH 2LTQC 1ZVSA 5J1TC 2P1YA 4D71A 1FFQA 3O9WA 4URIA 1MRFH 2WP3T 4KZDH 1OLZA 2E9JA 1XD1A 5F1SA 3LB6D 1NBVL 2R4SL 3CZJA 1S9KC 4F9JA 2J8HA 1CDHA 3IGUA 4W4NA 2J7EA 3UEZA 3QUMH 4XBEL 1ZLUK 3KYOA 2HKFL 3FQTA 3T77A 1UYWH 3HR6A 3LEXA 1FG2A 3TNNA 5LXGL 3KYOB 5TQ2H 3FQTB 1GC1C 1KB9K 3T77B 5ADOH 4R4BB 3LEXB 1FG2B 3TNNB 4Z8FH 2CNCA 5H94B 4LPWA 5JNYB 5DK0B 3MRQA 1ZWIA 4YHYC 2Z8VC 2ZOLA 3A6BH 4G8GD 1CDIA 4UTBH 5EO1A 3W25A 3B43A 3GI9L 1ZWIB 3MRQB 4OI9A 5DR5H 2NR6D 5EFFA 4HJJL 4LSSH 3TO4A 2ZOLB 4M3JA 5EO1B 4LVHC 1GQJA 1FFPA 2OP4L 3UAJD 1NWUA 3W5NA 3U7AA 4OCXH 4K7PH 1EGJL 2X7LA 1FFPB 1S9WA 4HK3N 4AYFA 1WC7A 2F7OA 1P84K 2KZWA 2ZWYA 3VO0A 4W85A 2X7LB 1S9WB 3BPNC 5DK3A 1WC7B 2C26A 4XX6A 4HULB 1F8TH 3K8LA 1P9MC 3ABZA 2HWZH 2DJ4A 3ZKQD 4TTDC 4R0LC 4NXKA 5DD1L 2VSCA 1NC4D 3S35X 5F9JA 5KVEL 4MNMA 7FABH 1NCAH 1T0NA 2A1WH 3OKMA 5D1QC 1CU4L 5F9JB 2J71A 1YEFH 1W9BM 1T0NB 3OKMB 2ZCHL 4PRDA 4RNRA 2JFEX 3EYQD 4M1DL 2JLLA 3S37X 1FGVL 1SEQH 5E2UH 4PRDB 4POZC 3CH8A 4EI5D 1KXQE 2DQJH 4RNRB 4HKJA 1OB1A 3ARVA 2QBWA 3QDGA 1IT9H 1UM6H 1CNVA 4HKJB 1OB1B 5IT2L 2EPKX 3QDGB 4ZXBD 3VJ6A 1YNKL 4U3XA 4MJID 4TUFA 2QEJA 1NMCB 4R26H 3VJ6B 2YN3A 3HG1E 3V0VA 3MR9A 4CNIA 5B8CA 3A6OA 1E0WA 4DAGL 4PGEA 4MXWL 2VQUA 1H41A 2PWFA 4CNIB 1T1YA 4LSVH 5B8CB 3MR9B 5I1KL 1C93A 5F93C 4PGEB 2F5AL 2P46B 2VIRB 1H3WM 4YAQA 5HBBA 2M2DA 5F7WC 5CZXD 3JUZA 4C4KT 1T1YB 4Q7NA 3ARDA 1E70M 5BVPL 2X6MA 4BQBA 4JHOA 3CZEA 4YNYA 3A21A 3CHDA 4Y4FD 3BAYA 3CXDL 1LWHA 1D5ZA 2P43B 4PJCF 1KXVA 1GGYA 4PMYA 2B1HL 4NJAH 5IBLC 1D5ZB 4OGAD 3RVXC 4ELMA 1C5CH 1P4IH 3R0NA 1Z6JT 2OW7A 4GH7B 3TTQA 3RVWC 4ELMB 3KWWB 2CH8A 1JD9A 5D9MA 3BPLC 3IT8D 2ZUVA 4PLKD 5M95B 3OR7A 3I6KA 5I0ZA 5J9PA 3NFPA 1IKNC 4Y88A 5B38G 3RVVD 3DURA 4WJ5A 3OR7B 4NN7B 3I6KB 5J9PB 2J5LB 3NFPB 2J43A 1SR0A 2GJZA 1QNQA 3DURB 4O5LL 4WJ5B 5GGRY 4JHWL 5BRZA 1ETZA 2GJZB 2R0ZH 5A2AA 3V4UH 3LXCA 5BRZB 2J88L 1YMME 5DJ2A 3LS5H 2Q7YA 1HZHH 4WFGD 3MLWH 1ISYA 3CSGA 4PJAE 3FZUC 4GJTB 1GJWA 1I7TA 5DJ2B 2Q7YB 4HBCL 4P5MA 4XNMA 2HRPL 4YHOL 1QBLH 4R90L 1UH3A 1I7TB 2X1WL 4XNMB 3R0MA 3EJJX 3H9HA 4BF7A 3L5WA 4MA1C 3CX2A 4DK3A 1I1FA 1XH1A 1IAMA 1IILE 3H9HB 2YD4A 3BKCH 1AD0A 3L5WB 2EO7A 4AISA 1F4WL 5DMGC 1I1FB 4L9DA 4C7GA 2ZUXA 1QNRA 1AD0B 3JUYA 2MQCA 3NMEA 3VFMA 1U95A 3VW3L 1IBGH 1EPFA 3X3GL 4WI3A 2EYRA 1J1OH 2D3LA 1KNOB 4QLKA 3K7UA 3VFMB 1U95B 3ALFA 1BIHA 4LHUA 4CU6A 1Z5LA 2EYRB 3DVIA 3GRWH 4QRPA 3C2AH 4LHUB 1Z5LB 2PO6A 2QSVA 3SDYH 4MNHA 4A6YH 3HMXA 2VR5A 5C09D 1CLOL 3DROA 2CPCA 3Q2CA 2PO6B 3MMEA 3OLEA 4MNHB 1MXGA 2XG5A 3DROB 5F6HI 5FUCE 1A7RL 1MFCL 5JIIA 3MMEB 3I9GH 1SVZA 2IANB 4V1DD 1F58L 3PJSA 5CGYD 4KRMB 3VMNA 3O6AA 1CL7H 4LNVA 4MNJA 3PJSB 5DVLA 2IPTH 2NY3C 1PVHA 4JY5H 5FGSA 4MHHG 3CK0H 4D3CH 3V6ZA 4G8IA 4ONFH 3QUZA 5HYQA 1EEYA 3V6ZB 1FRGL 3WY4A 4G8IB 5IHUH 3QUZB 4O58H 2NCMA 3OAUH 5JUEH 5HYQB 3P0GB 4PRPD 1EEYB 1PG7H 1P2CA 1GJUA 2Y6SD 5F3BA 2C3GA 3SQOH 5EPMA 1UZ8A 3L4WA 1P2CB 2E9MA 3OKNA 1JF6A 3QEQA 5F3BB 3WIFA 5DD3H 2DLFL 5EPMB 1P6AB 1UZ8B 3N11A 4Z0XA 2G60H 2J8UE 1NGYA 5H37H 3VDAA 4NZDA 4Z0XB 4WDIA 5IFHL 1EGZA 4FQXC 4G8FA 5IV2A 4W93A 3OBAA 2R39A 5IEHA 4OCWL 2OLHA 4WDIB 2VDLH 5B39A 2MANA 4G8FB 3PV7A 5IV2B 2H2PD 5IEHB 4HPYH 5B39B 4PP1D 1W3JA 4CADA 5FFLA 1FAKT 2J7LA 4MWFB 1IKFL 5D7IA 4X5LA 4CADB 3VFPA 4JG1H 2X2JA 3M17A 5D1XD 2F1BA 2AV7A 5D7IB 1NGXA 1KOAA 3VFPB 5L7XL 3M17B 4YHYB 2YFOA 4KRLB 2AV7B 1NGXB 3AMKA 2CRMA 4EN3A 2QL1A 4CDHA 3CBWA 3MBXH 1CDJA 2H45A 3FN0L 3BHBA 4GT7A 4Z7QE 4EN3B 4TNVK 5HD8C 3D5HA 3BHBB 1AHWC 4FZEH 4ZO8A 2DI7A 3ZKXB 4AZ8A 1FDLL 1DLFL 1U91A 3B2UD 3HPLA 3MX0A 2ZWZA 1K9FA 1P9MA 4K8RD 3OKEA 1J8HE 1AFVH 2W38A 4R0LA 4NZJA 4GZIA 1U91B 3HPLB 4XNYH 5BZXA 1HXKA 2D7MA 3OKEB 4R0LB 1UR2A 1U3HD 2XACC 4HCRH 1KTCA 3E3QE 1L0YA 2D9CA 2AAAA 2XM1A 4R7NA 4P2CG 1T66C 5I15L 2RGLA 1NCCH 2GK0A 1MY7A 4R7NB 3A23A 3CXHJ 3JV0A 5JR1L 3AMDA 2GK0B 1QP1A 1PPIA 5KS9F 3WQVA 5C9JA 1LQ0A 2XVNA 4HIXH 1UACL 3WJJC 2BNQE 1A3LH 5C9JB 1Y18A 5KSVA 4HG4J 3IDJA 2ZX7A 4PUBL 5HI5C 1Y18B 4J3XA 5KSVB 1W72L 3RJQB 1HINH 4F9PA 3IDJB 2CIIA 1UKOA 1UD8A 1G6VK 2CIIB 1UUQA 3K0WA 4PJHA 1JPTL 4LSDA 2OSWA 2ZUWA 1TLKA 1JYVA 1FIEA 1OGAA 4OM0H 2EDYA 3F6IA 4PJHB 3C5ZC 1B4JL 1AQMA 5CUSH 4CD5A 1OGAB 3DX9A 4ZFMA 1W9UA 5J1SC 4X4ZA 3G08A 5DMIH 5IESL 2VDQL 3DX9B 3IFLH 1E4NA 3G08B 3D3AA 1PZ2A 1LO3H 1AXTL 5A43C 3PZIA 3AZRA 1ODZA 2DH3A 2YRPA 1IKNA 1RULL 3F62A 2F1AA 4F8XA 1H3GA 2MCPH 1FCGA 2CDEA 3VTRA 4MXQD 1G7IA 4D94A 2CDEB 2EPLX 1XF4A 4CVUA 2GJXA 3WXWL 1G7IB 3C6LA 2NY6B 3L6FA 1XF4B 3LKOA 1SYVA 3C6LB 3VFVA 4M3KB 3L6FB 3PWLB 4UINH 4NFCA 3LKOB 1SYVB 4PGZA 1OAZL 3VFVB 4P2YA 5MI0B 2W9DH 4UDTA 1E9LA 4S1RL 2BV9A 1NCBH 1RUPL 5CJ8A 3DOSA 4UDTB 4EIZC 4U1JA 4MA1B 1EEZA 4UIKH 5I1DA 1UWTA 4U1JB 2CKBA 1EEZB 1BVNP 1FBIL 5I1DB 2VVNA 1QI5A 5DFWH 1RIUH 2CKBB 4URTB 3CPUA 3B3IA 3DVNA 4QFUA 2WMGA 2Q3AA 1QPPA 3B3IB 1NARA 2JELH 3PZ9A 3DVNB 4QCIA 2VJXA 3DI3B 4NWTL 4JZ5A 3MV8A 5L2KD 4QCIB 2L7JA 4P7RA 2P8PA 2Z8RA 1XGYL 2WKGA 3MV8B 4M6MH 1OARH 1JZ7A 2P8PB 1TQBB 5D7SH 3KL0A 4KJWC 2XIIA 3ALWA 4NO2A 1HYSD 3DHMA 1XHGA 1IEBA 3NN8A 4UQCA 4LPCA 4NO2B 4W8AA 4M1GL 3CFBA 5I1EL 1IEBB 3NN8B 2AVGA 1MFBL 1OP5K 1TQSA 4ZOEA 3SGJC 1N0LA 3QPQC 1E40A 4YHKH 1QW8A 4Z7QF 1CXHA 4OGZA 4Q2ZA 4ORZC 2R56H 2OXGA 5I24A 4Q2ZB 5LGKA 1JZ3A 2YDSA 3WY3A 4PJIE 2A9NH 1OF2A 2YZ1A 5B3NA 4E0RA 1IC7L 1UWXH 3C6SA 3HE6A 1OF2B 4PMNA 1YY9C 4I8DA 4E0RB 4FNSA 5GS2H 3O41A 3HE6B 3P0VL 2E40A 4ZG1A 2JF6A 2OR7A 3O41B 3U5UA 1BZQK 1ZHNA 3OR6A 4GQQA 4UQEA 2P42B 1ZHNB 1D5IH 1VCAA 3OR6B 4IM8A 4KHTH 4PCSA 2JEQA 2GUOA 2X44D 4X0VA 1B3ZA 3MO4A 1OT1A 4UDUA 5KSBF 1YN7A 2GUOB 5IGXH 3LQAL 4RFOL 5FYKH 3IFOA 1E6SM 1OWRM 4UCFA 4UDUB 1YN7B 4XAWL 4P4KD 3IFOB 1RZFL 5DVOA 4HUWA 4DUVA 3GXNA 3QCUH 2HG5A 3U4EB 1LVEA 3HHRB 4U1SA 1CG9A 4HUWB 3WKZA 1IARB 4PRNB 1GAFH 3CFIC 2HG5B 2OS7A 4FXKA 4U1SB 5CINL 1FLRH 1CG9B 3I85A 1JNEA 3EYPA 1UKSA 4EBQL 4JKKA 3OMZA 4FXKB 3BH4A 2GCYA 2YN5A 5GGVL 1WBXA 3G6DH 2GCYB 4YBLC 3PQYA 2OR9H 1WBXB 3LKNA 3TN0A 4BH8A 2WCAA 4HU8A 3S36H 3QIWC 4JRXB 3PQYB 3TN0B 3LKNB 4H8WL 3LD8C 4BH8B 1DBAH 3G6JE 2AMGA 3BSHA 4O4YH 3VA6A 2XPKA 5CILH 1LDSA 4XB3A 1YEKH 5FGCB 4LXFA 4MA8H 4MQXC 1ITBB 3PNWA 1OP3H 2AABH 3BC9A 4FFYL 1MVUA 4L4VD 4YWGH 3PNWB 5E9DA 3RAJH 1Q9LA 1MVUB 5C0CB 4WIQA 5E9DB 4F58L 4R2GD 4BK5A 4PBWD 2BVEA 3HZYA 4GW1A 5I5RA 1SY6A 3P73A 1WT5C 1XYFA 1FE8H 3HZYB 4GW1B 3RX7A 1UKPA 2NZIA 2NY2B 4F15C 3WJJA 1TCRA 4LSPH 5JUVA 1J9CT 4NFDA 2JCCE 3T2PA 1TCRB 3HC0A 1A7PH 4RRPA 5HYJE 4TUKH 1WV7T 4P7QA 3MMWA 1DVFD 2P24A 4JM4H 1ZANH 3HC0B 5C0JA 3MRMA 3WFEH 1IGML 4LQFH 4TVPH 3O4LA 3KPLA 1PLGH 5BQ7A 2VISA 1AJ7L 5DGRA 5C0JB 4PGBA 3MRMB 2Y25A 4GINA 3O4LB 3KPLB 2W0LA 4DKFH 2ZNWA 2VISB 1S7SA 4MB4A 5BQ7B 2EDOA 3C5ZA 3RKDD 2Q8XA 1MEXH 1QFWH 4QRSA 2J7HA 1S7SB 4BJLA 1UENA 3C5ZB 5HVHC 3F6LA 4CCEA 5L8LB 2LABA 4QRSB 5ICYA 2LAAA 1DQMH 1PY4A 2ALWA 2OL3L 5ICYB 4JFEA 3TYGL 3VPLA 4KKLD 1W1VA 4AEIL 2F54A 1I7RA 3Q5TA 1CLXA 4JFEB 3D85D 5JMRA 3VIKA 2F54B 1I7RB 2DEPA 1F6FB 1T3FB 5CFHA 2V9TA 2K7QA 1D9KC 4TQEL 2FO4A 4HH8A 2BOCA 3OTTA 5I6XC 3TIEA 4IJ3C 1JNNH 1OTSC 4OZFG 2FO4B 2BOCB 3QA3A 1UXWA 4GKOA 3TIEB 4D9RE 5A2LH 1NP0A 4OZGA 4LSQH 3QA3B 1UXWB 2ZCKL 1PKQE 4X7DC 1KEML 4G6JL 2A6IB 4ZO9A 1VRXA 4OZGB 4Z0BL 3CZSA 4XP9H 1U3ZA 5AYUH 1NQ6A 1EHNA 1RZKL 4P3CH 1C1EL 1A3RL 3O6FD 3SGDH 5F71A 5BCAA 1R75A 1HK6A 2BCKA 4RE3A 4OD1L 4OM1L 2NQCA 3BN9D 5ALCL 5E99L 5AD0A 2BCKB 1KEGH 2Z31D 1JFHA 15C8H 3MACL 3QUXD 2W4XA 1BIIA 3U0PA 2M8XA 5AD0B 2OSYA 5F1IB 3GO1H 1BIIB 1TJGL 3U0PB 2G5RA 5GS3A 4K3EL 2HT2C 4WI6A 1QACA 5MP6H 4AZ5A 1MJ7H 4Z7UA 4LPVA 5C0GA 4NNXA 2AJUH 2HTKC 5DC0A 5IVXA 2UY4A 4RWYL 3O2LA 4Z7UB 5D8JL 5C0GB 4NNXB 5IVXB 4PRWA 1BGGA 2QQKL 4ERSH 1J87A 1Q0YH 1QVBA 1B0IA 5BW7C 3V5DA 2ZICA 3SE9L 1PX3A 3MLUL 4F80A 5IJVA 3V5DB 5FGBC 4RGMB 3TH2T 4D8PA 3S9DB 1MCJA 5IJVB 5FYKE 3QI9C 4D8PB 1BEYL 1UH2A 4QCFA 3L3IB 4P2RD 3BAEH 1UWEH 3ZJKA 3SGJA 3IDIA 3WO3B 3PF2A 2R2HA 3IDIB 3OAZK 2J3SA 1NWRA 1A1NA 3BGFC 2R2HB 1U8NA 2JB6A 4RL3A 4ZTOL 4ZFOA 1A1NB 1XZ0A 5D93C 1HKLL 1DBML 1U8NB 3FHAA 4Z7NE 2JB6B 3BVTA 4HH9A 4R4FH 3QR3A 2XY1A 1GZQA 4PTMA 4PJEA 1XZ0B 4WGVB 4AL8L 2XUCA 3T0WA 2DQXA 3OJ2C 3S98A 4HH9B 1GZQB 4PJEB 1QNOA 2QLVB 5ALBL 4KAQL 5DEFA 5C0BD 1ZTXL 2I9LA 3WKMH 3KEHA 4IRSC 5F1NA 1R46A 4NZUL 5DEFB 4XPAL 2I9LB 4FN0A 4FS0A 1OAQL 5F1NB 1TUXA 1JNHA 5E2TH 4X9BA 3V0WH 1XIWD 1JNHB 3MOBH 1UD5A 2DB8A 3PWNA 3VXRE 4P46D 1NKOA 3WBDA 5DFTA 4QRRA 3PWNB 1B3YA 1I8KA 3PZTA 2EEBA 4UBDC 4F57L 2JCCF 4QRRB 4LIQL 3VWJA 2HKHL 2EXWD 5D9NA 1I8KB 1REIA 5IHLB 4LKCA 1FSKB 4ODHL 3VWJB 3TPUA 2EBNA 4OBSA 4U3CA 3BQUA 4P5TD 4B9ZA 5F7MC 4LKCB 3TPUB 4BELD 5K9JH 1P7QD 3BQUB 3O2DA 1KJ2L 3ES6A 4BUGA 2EIEA 2HT3D 2AJVL 3O4OC 3DRQA 4N8VA 3ES6B 4TVPE 1QI3A 2CBVA 3NCMA 1Q6DA 3DRQB 5EOQL 5T1LD 1JF1A 1MRDL 3BAJA 3RGVD 4KK9C 5D6DA 2PXYC 2QR0A 3IDXL 4LCWE 2VLJD 5IBUG 4KK8C 1JF1B 5ENWB 3RHWK 3QXWA 1YNLL 2QR0B 4KUZH 1NAML 4HW6A 3PTMA 3UBXA 1D7FA 2P5WD 2B5IB 2ID5A 3VM5A 1NAKL 4AK1A 3UBXB 4RGNB 4ZTPL 2CJUH 3WL9A 2KKQA 3X14A 3QCVL 4UOQA 5IXEA 3WL9B 1U93A 4TVSa 3X14B 4I3SL 1D3CA 3GHEL 4YHLL 1C5BH 1U93B 4YC2C 2DM3A 1WZKA 1UWRA 1ADQA 4UT6H 3CFKA 4ZD3H 1MREH 3SGEH 2R23A 1IMHC 3BJLA 3LPGA 5DXWA 2ZX6A 2BS9A 4I0CC 2R23B 3MLXL 5I75C 4K94H 3DHUA 5IQ9A 3TVMD 2EDKA 4PG2C 4X7CC 5I74C 1J1XL 1KB5H 3K2UH 1MAML 5EFIA 3V6OE 2XGBA 1NEZA 1WICA 1GIGH 5EFIB 1NEZB 4NQCE 4WENB 4ODBD 4NZRH 3NCBB 1TETH 2J44A 4YBQD 3MLSH 4G6AD 4QHUB 1BWMA 1A64A 5BRQA 3S96A 2VDOL 1JNJA 4LDEB 4MJ6A 4XPBH 1GYAA 4NIKB 3LQMA 3S96B 5DRXA 5EU7E 4C57C 2NXYC 3DNKA 4MJ6B 1BZ7A 1MJ8H 4TNWK 4HJ0C 1OWQA 5DRXB 2VZSA 1BZ7B 4OIBA 4OZHE 5K9KA 1NFKA 1JTOA 5I6XB 1T89C 4HP5A 2CUMA 3NPZB 4ISVA 4U1GB 4WO4C 2KQMA 5K9KB 5HXMA 3HLAA 3THML 4Y4HD 2EE2A 4ISVB 1Z9OA 1EUTA 5A2FA 3HLAB 3VXME 4JFSA 3MUZ1 4EQ2A 3SO3C 2ZXDA 1RU9H 1DFBH 3N1QC 3BKJL 1VGEH 3VG0L 4MS8D 4GLRH 2GJ6E 4HV8A 3B8SA 3RTQA 4Y2DD 2VN7A 1AXSA 5EUOA 3CMOH 4HV8B 3LRSA 3OSKA 2V5SA 3RTQB 4GXUN 1AXSB 5EUOB 1HKKA 3LRSB 4Z7NF 1F90H 1WZMA 1MHEA 4M6NL 1AQKL 3HG1D 4YR6A 3KYAA 1XGTA 2H26A 3QHFH 2DJSA 1W32A 1MHEB 4GMSH 1CVRA 4GQ9L 3DBXA 3LKRA 2VH5H 4UB0L 4YR6B 1XGTB 1VIWA 2H26B 3LPOA 2ICES 4XPGH 1OAYL 3DBXB 3LKRB 4YHMH 4FTVE 2QSQA 4EE9A 3MBEC 1GGCL 2CESA 2E3ZA 3IXAA 4GKNA 5I8KL 5EZOL 4X4ME 2O5ZH 2R2BA 3TJHC 1W9PA 3IXAB 1KJ3H 4GKNB 2HVMA 5I66A 2MOVA 1TVHA 1L0QA 1I85A 2R2BB 1I9EA 5GRYA 3QUKB 5I66B 4HU0A 1TVHB 1WIUA 3IDYC 3RPKA 2YD5A 3EO1A 5I1HH 3QI9A 1IC1A 5ACZA 1KULA 1S7UA 3EO1B 1BVZA 3QI9B 5HSFA 1SJHA 4HKBA 2DSVA 5ACZB 1S7UB 5EA0H 1SJHB 4HKBB 1KJVA 2JIXA 3MJ7A 1FN4A 1RPQA 5CEYA 2G5BB 4NBXB 4PY8J 3SDDD 2IXVA 4J3UA 2JIEA 2X4SA 2AGJH 1KJVB 1AQDB 2JIXB 3B8YA 1FN4B 3MJ7B 5CEYB 4M43H 5DRWB 3T0EC 3AZTA 2CO7B 2X1QA 2X4SB 4WW2C 4KTEL 2YKLH 1OP9A 3GSXA 3BKML 1V6YA 3AREA 3WEZA 4D6CA 4I18C 3GSXB 3IDNA 2YEZA 4OFDA 4JKPL 3AREB 2XHYA 4K9EL 1YMMD 3VSTA 3IDNB 2YEZB 4CJ0A 1FYTE 3SDCD 3MA9H 3S34H 2FDBP 3NCFB 3BVWA 2ZUQC 4GRLD 3VGAB 3S35H 3RIFF 2WMIA 3W5MA 3H9SA 4BFEA 5FHAH 4MNGE 2AEQH 1CT8A 1GHRA 1MLBA 5C08A 2WMIB 4FQIH 2JJSC 3H9SB 4UNIA 1CT8B 1G7LA 3H55A 1MLBB 5C08B 4FQCL 1ZLUH 3QQ9C 3WUFA 4AMKL 3S37H 1G7LB 2C3VA 5EU6E 2AK4E 4LCYA 4L8SA 1L6XA 3SJVA 4PMXA 3O2VL 2C3VB 4C54A 4ONGL 3JTTB 4LVOB 4DWSC 4LCYB 4L8SB 3SJVB 4LLMA 5JBDA 2EPMX 1JV5A 4GBXA 4EANA 1I8LC 3L5JA 1BHGA 4LHUG 2PWGA 3OG4B 2NZ9C 1JV5B 4GBXB 4Z95L 1KCSH 3VXSA 5EBLA 1FC1A 2LU7A 3ZTNL 4YHZL 2ESVB 3CUJA 1JI2A 3HNVH 3NPSC 3Q1SL 7CGTA 4X83A 3UZEA 3VXSB 1CXLA 5EBLB 4WW1A 2Q86A 2VR9A 5D72L 4V2BA 1XH2A 4QTHA 1IAIH 4WW1B 4I3RL 2Q86B 3D69A 5TQ0L 2OW6A 5JHLL 3L3JA 3EOAA 2GTZB 5EB8A 3D69B 2FX7H 4N9OB 3MROA 3L3JB 2CPUA 1CEOA 3TF7C 3TO2A 2KH2B 3MROB 3GXMA 2YSSA 5BZZA 2FRGP 3O6LH 3D39B 1EQCA 1C7SA 1U2CA 4JKLA 2J77A 2YSSB 4LLDA 4NUJA 5FGRA 3HG2A 4FQ1H 3GSNL 5HI4D 5ECUA 5GS0C 4LLDB 4NUJB 4NZTH 5C0FA 5C2BL 1QPXA 4OKVA 3TV3H 1L8NA 4Y89A 5C0FB 1H15A 4LSUL 3D4ZA 1CD8A 4OKVB 4M7JL 1H15B 4HLJA 2EC9U 1HIZA 3GJFK 4L3EE 1KIRA 4PJ8A 4YC2B 4F7MA 4WEUD 1WUNT 3LDBC 4KQ4L 4PLJC 1KIRB 4PJ8B 3WUWA 1E0VA 4F7MB 3K74B 3U7WH 4X6CE 4HF5H 5EU3B 1NCWL 2GUYA 1DWFM 3WUWB 3PXHA 3ARGD 4WCYH 1KENH 1KT2A 2YD6A 3CHCA 2YIHA 3QIUA 5CKGA 4NQDA 5IOPA 1KT2B 5T1MB 3QIUB 1TJIH 5I3DA 4NQDB 5IOPB 1K3ZA 4Q9BA 1E1FA 4DGYL 5M7QA 1I9JL 1KJMA 3E0GA 2J12B 1N64H 5GGSY 2IFFL 4NKIH 1JGIA 2FSEA 1KJMB 3UMTA 3BD5A 4JJHA 4ODVL 4TSCH 3W29A 2XKNA 2FSEB 2C4FU 3GIZL 2XOTA 1G6RL 1TENA 4D6JA 2XKNB 3I50H 1EXPA 5CJXC 4PS4H 1KV3A 4MDOA 3QJFB 3G5VA 2QPUA 5C8JA 3MREA 3A5VA 1H1NA 2HFGH 3G5VB 1BBDH 5C8JB 3MREB 5DUML 1C92A 2XN9E 4YN5A 2OYMA 4TTDD 3P0YH 4ZSOA 1EVUA 3GK8L 1TZGL 5D1QD 4ZSOB 3U4BH 1V3JA 3FB5A 3KPSA 2BJMH 3VD3A 1Q1JL 3V5HA 3FO1A 3WD4A 4B3LA 3KAAA 1RJCA 3KPSB 3VMOA 3V5HB 3FO1B 4POZD 3WDHA 1G94A 1IQDA 4NT6A 2BY2A 4YPGA 5JTWA 4IOFC 2R4RL 1H3UA 3RWFA 1ZKAA 1IQDB 3TPKA 4NT6B 4XZUA 4YPGB 5FYJU 4QNPE 4OLWL 4HGWA 4IHOA 3RWFB 2BNQD 2NY7H 1XAUA 4JDTL 4XZUB 3KS0J 5BS0A 4HGWB 4IHOB 4GXUM 3EW3B 5BS0B 3EJQA 3MBEA 4Y5YC 1KQYA 3TFKC 4G6MH 1EFXD 1E4WL 3PZUA 4KDWA 2IBGA 4X6DA 3MLVH 3VDHA 3OPZH 2CD0A 3D2UD 5DVNA 4LEXH 1WFNA 4Y8AA 4QXUH 4X6DB 3PWPA 3FAWA 5IBLD 4YK4C 3RVXD 3PWPB 1UR0A 2VXTH 1AY1L 4S1SH 3HCVA 4W88A 3HZVA 4BZ2L 3RVWD 3FQRA 4HK3J 3HCVB 2I9TA 3HZVB 4LASH 1ZGLA 3FQRB 3B9KC 2UY2A 3MMUA 2IAMC 3WD2A 2I9TB 1ZGLB 3T1WA 4XVJL 1WIPA 4LRNL 4WU5A 3M45A 2WKLA 1MYRA 2FLRT 3E2HC 4I18A 2HJKA 4WU5B 5CSGA 4E8CA 2PWDA 1LO2H 2V9RA 4KKCD 3W0WA 4I18B 2HJKB 4JQIH 3ZR5A 1TA3A 1E4XI 3W0WB 3EOYG 3GMNA 1MRCH 4U1KA 2JJTA 4NJ9L 5IW3A 1TA3B 4OFKA 5IBTH 4YE4L 4ELME 2ZUQB 3GMNB 3HI5L 3D87B 4U1KB 3FZUD 4YXHH 4LPYA 3ULUH 3UTSA 1UD4A 3B83A 3U1SH 1KCRH 2D0FA 3UTSB 1B2WL 4JM2A 1S5HA 4XWGL 4G6KH 4L4TA 5DJ0A 4I2XA 3QDAA 4JM2B 2IGTA 4M93B 5SX4I 1S5HB 2OBGA 5DMGD 4L4TB 5DJ0B 2DBLL 4I2XB 4AT6A 3JWDL 3ORJA 4AT6B 1UQYA 5D6CA 5HTSA 3U7VA 1CXKA 2BRRH 2VZTA 4CAGA 1CK0L 2XWEA 5D6CB 3H9ZA 1QO3A 4X6CF 4S3JA 1YMHA 1BM3H 3L7EA 2V3GA 4D72A 5A16A 1QO3B 2J62A 1YMHB 3L7EB 4RISH 5GRUL 2PI6A 2B1AH 5A16B 3CDYA 5JPMA 2AJYH 4JFOA 4B9YA 1BG4A 5JPMB 5E00A 1GOMA 4JFOB 2EC9T 1DQDL 2NPLX 2YL6A 3ZSSA 3R1GL 2X89A 3BMVA 5DMKA 5DWUL 4JO4L 5E00B 4WVRA 4GKSA 3QXUA 1EO7A 2VDML 5DMKB 4ODTH 5I1LA 4UOJA 2NY3D 1JL8A 1A1MA 2YRLA 4GKSB 4XP4H 4TVDA 4OCNC 5CZKA 2FZ3A 5I1LB 1IC5L 1F3DH 1YJDH 1A1MB 4OGYH 5J7CC 3WFLA 4LFHG 2FZ3B 4BQ3A 3RM9A 5HGDA 5C0NC 4BH7A 4LPXA 3VU2A 3GNRA 1KBGL 2V5MA 1MIMH 5HGDB 4KMLB 4R27A 5SWZA 3EJTA 1KTRL 3H42L 4PMUA 3T8XA 5SWZB 1QLRA 4OLEA 3FRPA 2IANE 3MJ9H 3T8XB 2JEPA 4XXDA 1WFTA 1QLRB 1MIEH 3WIHA 3LDBB 4H8HA 4TSAL 5GGUA 1TNMA 4QLRA 5K9QG 1OL0A 3H3BC 4FQXD 4XXDB 4LAJH 3A4AA 5GGUB 5C2UB 5C92A 2XJ7A 4FFZL 2GSJA 4KRPC 3RY6C 1NLBL 2BSSA 4PJBE 4RQQB 4KRTA 2BSSB 4QNPF 3LHPH 4BSVA 1B0RA 2YA2A 3GBMH 3H2WA 2R1XA 5E94A 5LGJA 4FF5A 4BSVB 2MKLC 1B0RB 2OK0L 5IHSA 5LGJB 2R1XB 5E94B 5DDHA 3WHE1 5GJTH 4NUGL 4YGVA 5DDHB 3IJ7A 2D4FA 4DQOL 4OLVL 3IDMA 1XSIA 1L7IH 2IADA 2D2OA 3JZ7A 4YGVB 2E3VA 4PJ5A 4GO9A 3IDMB 4Z77A 5J3HC 2IADB 1V3LA 4J8RA 4ESKA 3MLRH 1KWGA 4PJ5B 4Z77B 4D1JA 3JWOC 4QTIL 4J8RB 3RNKA 3ZHKA 3ZYIA 4U3HA 5CCKH 3L4VA 3TA3C 3PL6C 3MNVA 3HC4L 4OIIL 3H9YA 3RNKB 1RPKA 4W7VA 3MNVB 3CUPA 5D7IE 1YYLH 3CUPB 5JHDE 4FNUA 2ESCA 1T66D 1WWBX 1RZJL 2DQEL 3EJZC 1QKZH 2Q8AH 1CZ8L 4N5UA 4EDWH 2FNBA 1MJUH 3F5JA 1MCHA 1AQHA 3VUPA 1EJOH 1ZBVA 3WUGA 2YA0A 3A67H 1UEYA 1I9IL 4QAWA 4CU7A 1YHTA 5HYJD 3UJTL 4OT1H 3DX0A 12E8H 1J1PL 3HRZA 3INUL 2VLRE 2EEDA 4ELMF 1WO2A 2F8OA 4Q97A 3HRZB 1UA6H 4K23H 4RMRA 4E9LA 3BP5A 1A7NL 2NY4C 2MNUA 1MFAH 3NGBB 3WH5A 5D2LE 5F7EL 3BP5B 2UVEA 1QSZA 1ROWA 3JWOH 5INDA 2WVVA 3VGFA 4CD4A 4M1RA 3ULUE 1D5RA 1AGBA 1ISZA 3W6LA 4GXVL 5INDB 1T1WA 2WVVB 4HOWA 3EJYD 4LLYA 1GOFA 5HHPA 1K4CA 1AGBB 1YECH 4PJFA 2H6PA 1T1WB 2G41A 4GMTL 5AG9A 5HHPB 1K4CB 4PJFB 5IUSA 2H6PB 3WY2A 4Y4KA 1LNUA 5ISZE 4KI5F 3S5ZA 4Y4KB 1LNUB 5I76A 1L0PA 2O61A 2CK0L 4EKXA 4KK5C 1N5YH 2ZX5A 5I76B 4OQTA 43C9A 2O61B 3WH7A 4S2SA 3SCMA 3HB3C 2YJQA 3WD3A 4D9RD 4ALAH 2WBWB 3WQ4A 1BG9A 43C9B 5IQ7L 4S2SB 3SCMB 2XZQL 1LDPH 1NGPL 2N1KA 2YPLA 1N26A 5IHBA 2JTDA 5J06A 2YPLB 4O2EA 4AEHL 3W28A 3HMXL 3N0AA 3VX0A 3HE7C 5DYOB 4O2EB 5F7DA 1PQZA 3RWIA 3SGKA 4LCIL 4KMQA 1F3JA 5FK9A 5AC4A 5F7DB 1CL7I 4ZS7H 4YDIL 2BSED 1PQZB 3RWIB 3V0GA 2DQDL 1Q6GA 1F3JB 5FK9B 2GKIA 5C0RL 1II4E 1ZL1A 1V0NA 5ANME 2VXSL 1DQLH 3SUSA 4PYGA 3LQZA 1UOKA 5AY7A 1T1XA 2AK1H 4KI1A 4U6TA 3LQZB 2QADB 1T1XB 4ZUUA 3CU1A 2IFGA 4MAUH 4M5ZH 5HHNA 4IRJA 5HPOA 4ZUUB 3V4VH 1H49A 1LO4H 2G9HA 5HHNB 4IRJB 5T3XH 4FMVA 2NXZC 2G9HB 4L4OA 4UV4H 3V0HA 4OLXL 2BFVL 4FQLH 1JWUA 4PJBF 4LSRL 4C83A 1R3JA 3FO0H 4KJWD 5FYKD 1YA5A 1JWUB 1H09A 3LN9A 5DHXB 4C83B 1R3JB 5EZIL 1AGFA 1A7QL 1GVIA 5ACMA 2GJPA 2F9BT 5DD0H 1HE7A 1AGFB 4UFIA 3BWUC 5CP3A 1MHHA 3QPQD 1RIHH 4R97B 3NJ3A 1GC1L 2VZ3A 3QHNA 4PRHE 3HTLX 3MLYH 1MHHB 3UYOD 5TE7H 1A4JB 1BFOA 5KAQF 2W67A 1BFOB 3DYPA 4GSDH 1HKIA 4GZJA 4L5FL 1YY9D 5D4YA 1KN4H 2BSRA 2ATPA 3AS1A 3DXAA 2ORBL 5KZCB 4IRZH 4AJ0A 5D9SA 2BSRB 1YYMH 2ATPB 1CFNA 3DXAB