2FHBA

Crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltose
Total Genus 340
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
340
sequence length
1052
structure length
1052
Chain Sequence
b'DVVVRLPDVAVPGEAVQASARQAVIHLVDIAGITSSTPADYATKNLYLWNNETCDALSAPVADWNDVSTTPTGSDKYGPYWVIPLTKESGCINVIVRDGTNKLIDSDLRVSFSDFTDRTVSVIAGNSAVYDSRADAFRAAFGVALADAHWVDKTTLLWPGGENKPIVRLYYSHSSKVAADSNGEFSDKYVKLTPTTVNQQVSMRFPHLASYPAFKLPDDVNVDELLQGETVAIAAESDGILSSATQVQTAGVLDDTYAAAAEALSYGAQLTDSGVTFRVWAPTAQQVELVIYSADKKVIASHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPEGWDGLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAQESNMVQHLKQLSASGVTHIELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLTQLKQNDSKDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMLYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDAVRGGGPFDSGDALRQNQGVGSGAGVLPNELTTLSDDQARHLADLTRLGMAGNLADFVLIDKDGAVKRGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRSSDDGSNYDIIARVKDAVATPGETELKQMTAFYQELTALRKSSPLFTLGDGATVMKRVDFRNTGADQQTGLLVMTIDDGMQAGASLDSRVDGIVVAINAAPESRTLQDFAGTSLQLSAIQQAAGDRSLASGVQVAADGSVTLPAWSVAVLELPQGESQGAGLPVSSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords pullulanase
publication title Crystal structure of pullulanase: evidence for parallel binding of oligosaccharides in the active site
pubmed doi rcsb
molecule tags Hydrolase
total genus 340
structure length 1052
sequence length 1052
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2005-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fhbA03
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2fhbA01
2.60.40.1130 Mainly Beta Sandwich Immunoglobulin-like Rab geranylgeranyltransferase alpha-subunit, insert domain 2fhbA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fhbA05
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2fhbA04
2B5IB 1NOWA 1GGCH 4MJ4A 1CPUA 3VWKA 4ZAKB 1GHFL 1VFOA 4XWOD 5D2LB 4PRID 3S5LG 5EB9A 5B22A 4DWSA 1QG3A 3QDJA 1RZFL 4NQCB 3KYAA 4Q9QL 4ALAL 5CJBA 4XCFL 1T2QH 2EQDA 4MD4B 1K9EA 5IT2L 3NUKA 4JGMA 5IEHB 4AJ0A 5HVWA 3V6FB 2HKHH 5DC0A 1B3WA 3MJ9H 1B1YA 4N9GA 5DFAA 4HW6A 5I1LA 5HHOB 5LGKA 4OJFH 1M7DB 3CZFB 4OCXL 5L88H 3HN3A 3GBMH 2COQA 2ZSVA 3GMQB 1JGVL 3DX8A 5ADPH 1N82A 3EW3B 3QEHA 1FN4B 3IDUA 3TZVD 3OTTA 3VCLA 1AHWA 3JTTA 2HTLD 3W6LA 3GO1L 3MACH 4G8GB 5B38B 2EIDA 5FHAH 5ID1A 5I23A 4IHOB 4ZSOE 3OJDB 4TXEA 5T1LB 2ILLA 3SKNA 4W8AA 2ZICA 4Y1AA 3FQTA 4FQCL 1SJHA 3F8UB 3SCMB 1OAKH 5DRWB 5ICYA 3HZVB 1Y7VA 2VCCA 1OD7A 4J8RA 1HF6A 4IRSD 4LMQI 3QDGA 1W3KA 3D9AL 1MSPA 4Y4HA 3IDGA 4Z0BH 3W11D 1DQDH 1FZJB 3SGEI 3L2LA 3JTSA 2R2CA 5FA4B 1OAYH 4HZLA 2XG5A 3EO0B 4U6HB 3L2MA 4EAMA 3GXMA 3H42L 3HPJB 3SJVB 3K80A 3MRLA 2Y36H 1A4JB 4IDJH 5I8KL 2IAMD 3TTYA 3PWNA 2EDQA 3VFOB 1EXUA 2MPAH 2YPKA 4OM1L 1JZ6A 9CGTA 3PZIA 4WRLA 1UASA 4W8LA 4NQXB 4Y5YB 2RGLA 4MTVA 4A6YL 3GMPA 5KG9A 2EH8H 3LIZL 1MCRA 4TVPH 5TE4H 3QFJD 5HGHB 2CUMA 1OINA 3RO8A 4I77L 3RWCB 1Z9LA 1DVFC 1G9MH 1KNOB 1OQOA 1VEPA 3PUCA 1VFBA 2GHWB 2IANA 4LLUA 4O2EB 2BVQA 2M2DA 4C4KO 5I16B 3VUPA 2V5RA 4YWGL 4MB4A 4BQ5A 4W84A 2AQ2A 3TJEL 2X4QA 1OM0A 1NGPH 3RIAK 1RD6A 4JAWA 1G1YA 3MO4A 4RWYL 5JXAH 1LK3L 2QHRL 1FNEB 4RGMB 4QTIH 3NSNA 5JMOC 4YDJB 3OAYH 4JO1H 3B9KC 1H5BB 2OR9L 5JHDA 1AI1H 1D9KA 3F5WA 5AYBA 1ED3A 2W60A 5E9DE 1DEEB 1JZ7A 2OX5A 5FCSH 2ZX7A 2RCSL 3GB7B 1L9NA 3DC0A 4MD0A 4OZFG 2GITA 2R4RL 2Z91B 5B39G 5CEZH 3LRMA 1OD9A 3UCQA 4LYRA 3PG2A 1MWAB 1P53A 1MLBB 2PB1A 4GBXB 1ERNA 3VGGA 1AGBA 5BXPA 3KPRA 1Q9OB 4R2GC 1XAUA 3KNBB 4HIJB 1ZLUH 4EBQH 2LAGB 2R1YB 4UTAL 3MYZA 4PP1D 3TYFA 1NFIA 1SBBA 3RGVD 1OIFA 2YK1H 3DO7A 3W6MA 4QF1A 3LXCA 5E8PB 2ADIB 4H8WL 4XMPL 4OLXL 4APQD 4I18A 3T0EC 5BRZB 1U42A 3HRZB 5C6WH 3O6FB 5FO7B 1TVBA 3E2HC 2CQVA 4N0CC 3AOFA 5HDLA 3E6HB 1QHOA 3BISA 3NJ3A 2BNUA 1CDYA 4WNQA 3RM4A 3QHZH 4PLKD 1QNOA 4U4BA 1QVOA 3F7PC 1VPOH 4NHCH 3S3JA 4NQTA 5FKPB 2HMID 1K3IA 2NY5L 4PJGA 1HIMH 1KB9K 2Z92A 5GGQL 2DQHL 3HZKB 1V0KA 3AS3A 1G9HA 4JFOA 5DLML 4WFED 2P43B 1AQ0A 2BNQB 4XHQA 4YQXH 1NCBL 5KOVC 1S7VA 5C2UB 2IADA 2KH2B 4H1LG 1L0QA 1ND0B 3BP5B 2B0SH 2GVYA 3MV9E 1JGDA 3MXWL 2DSKA 1S9YA 3MO1A 4AD1A 2E6PA 4R96A 4EE9A 3HNVL 3HS0B 5C09B 3K3QA 3S3SA 2UZIL 1JFQH 2C4XA 3C09B 3OXSB 4OUEA 5C0RL 1BOGB 4KI1A 4KDTC 4L3EA 1T5WB 3ARBD 2FCBA 1ZANL 2PTVA 2PXYA 4UT6H 5DC9B 3RZWA 3UETA 5DF0A 3ARDB 1UB6A 2BOCA 2QL1A 5E03A 1UXSB 1QNPA 4HFUL 4GMTL 5D7LB 3A23A 3V4VH 2C3WA 3O3BA 3OHXA 4PRPD 1DWIM 4TUKL 4FFYH 4P8UA 1EX0A 4YK4C 5I74B 3UZQA 5H37H 4NO5A 1EZVY 5IBLD 4MNHA 3DDGA 1EDTA 2F61A 4IOIA 3M1BB 2GI7A 3OJ2C 2WMIA 4GG6B 1J0ZA 1KENH 5D6DC 1X5LA 2DQFA 2V5YA 4HIIB 4GI9A 4P5MB 1F6LL 2MHAA 5IFHL 5D9PA 5KJRL 1HH6B 4HJGA 1R3LA 4NDMB 2JIEA 3VWJB 2A6JA 1NEZG 3IDMA 1P5VA 4PRAB 2YUVA 4QRUB 5EFIB 4I9WD 1G7MB 5BVJB 3BGFB 5KVDL 5A3ID 2B7DT 4GSDH 2IH3A 1OB1B 3FHAA 5E4EC 1PX3A 2ZWLT 3AHXA 3NCJL 4WWKB 4JM4L 4OIFA 4OQTA 1KV3A 3SQOH 4NRZA 3UTSB 1XIWD 2VDML 5IVXB 1XGZA 2VIRB 3D85A 5SX5K 5C0CD 4P2RE 1KWKA 2D4FA 4X4XA 4UFIA 1E4XI 2BERA 4OSUL 4MZ3A 1MFUA 3WDQA 1F6FB 1W9PA 25C8H 2FIRT 4O02L 1EMTH 3QIUB 3UTQB 3VMNA 3AYSA 3PWPA 4MHHG 3CMOL 4XP6L 4LVOB 2VN7A 2BSTB 1GOQA 3PQYE 4ZOBA 4LHQB 4NKOA 1LWJA 4ZYKB 3II1A 4ZTPL 1E72M 3PZQA 2XFXA 2OZ4H 4FHBD 4G6MH 4Y88A 2G9HB 1SYSB 4L8BA 3A67L 3D3VB 5C0FA 5DQJA 1WWCA 4LRIA 3S4SG 4YZFE 5E6IC 1XF4B 4JFDE 3PWJB 4P9ML 4JKLA 2WVVB 1FFNA 3VIJA 4HWBA 5F93C 3IGAA 4X6FA 3BZ4A 2AV7A 2X40A 4LNRB 1ZS8B 1A3RH 3X14A 1AO7B 2R0WL 2D7MA 3QUXD 4S2SB 2XHYA 4P99A 4TUJA 5D4QA 4JPKL 2Z0BA 4RIRA 5EDXA 5CEYB 3N12A 4DFIA 4NWTL 1WDRA 4Z77B 4PRWA 1HI6B 3HE7A 5HVFB 5J11C 2W0FA 3B2UC 4S3KA 2CETA 4HIXL 4BYHA 4L8SB 1NBYB 3NFNA 3JVGA 3B5HA 1Z6JT 4LLMA 1S5HA 1FC1A 3BEWB 3HI1B 5IQ9B 4LLQA 4D8PA 1RURH 2BXYA 5IEKB 3VIIA 1FHGA 4NJ9L 2HVKA 2OJZH 4Y2OA 3LS4L 3NCBB 4XMKH 3H9HB 4YN5A 3F65A 4PG2C 1XH3B 3ZKMC 4JDTL 2V7HA 1QFHA 1XV8A 1NCDL 1XD1A 3TA3C 1SM3L 4K23L 4RFEB 4H25B 1M71A 4LSRL 2W1NA 4XGZB 4ZAKD 3BSGA 1NBZA 5C0NC 3G04A 2BFGA 4Q22A 4PJIE 4WI5A 4NQCD 3L9RB 4ONGH 2E6JA 1DLFL 2DQUH 1HH9B 5IB2B 1K6QL 3LHPL 2VC9A 2V17H 1F8TH 3MLUH 3LOWA 4O2FA 3KLHD 1UJ3C 3L4YA 4WFGD 4X7SL 1OAUL 4Q9BA 3OXRB 1A4KB 3WN5C 5HGBA 5EZIH 5D72L 3LRGA 2X4UA 2EEXA 4J28A 1LO4H 1KPVA 3WUWA 2APVA 3HI5H 4YUEL 4B7IA 2G3JA 4AZ5A 4KQ3H 4PN2A 3S36X 4JKKA 5DDHA 4JDZA 5ETUB 1CCZA 1SYVB 5CG0A 5HBFA 1EV2E 1NGQH 3QDJE 1A02N 2E7LA 3SQBA 3HJEA 4G8GD 5LBSH 3RWJB 2JEPA 2NSXA 1VENA 4O51B 1YEJL 3QDME 4PJ5D 4ZXBA 1IAII 2V3GA 4LHUA 2X2HA 3WIIL 5BJTA 5BROA 1CEOA 3OLEA 3TNNA 5EIQA 4F9LC 1F45A 3OKNA 2YPLE 3SCMD 2EIZA 1BEYH 4DAGL 4X7CC 3DHJA 4ORGB 4CKQA 1A7OL 4AZGA 4P4KD 1R86A 5D93B 5HGDA 1J12A 4QLRA 1NMCB 4P8WA 1X4ZA 4N8PA 3FTGA 2WMJA 1PBYA 1P1ZB 1UM6H 2A74A 4J3XA 3RCNA 4DM2A 1GAFL 4LCCC 4NSKA 4XXDA 5FDWA 5I73B 3FCTB 3SJVD 1HILB 4PS4L 5DSCA 3HUJB 1WCGA 3P73A 1VF8A 1JPFA 2A38A 1KXQE 3HPLB 3OJVC 4HHAB 3T09A 3CAFA 5EU6B 4LSSL 1FYTA 4FABH 5HYSA 4H8UA 3BQUB 1MCSA 2XG4A 3VFNB 5MHSE 1S78D 1ZHNA 2GAZA 3OAUL 1RZIA 2VQUA 3ZDYE 5JDJA 3D5HA 6TAAA 4FQ2H 1DFBH 5JXEC 2WXDM 4JPVL 4XP9L 1H8OA 2BP3A 5CBAB 3CV5A 3O45B 3QDGE 4ZUUB 5E24E 4QRTA 5EUOF 3R4DA 4O5LH 1NLDL 4HUWA 1U8KA 1GHFH 1HDMB 5J4MA 3PNWA 1AQHA 1TETL 5AZ2L 1B3ZA 1UYWL 2P5WA 2YN3A 1SVZA 3C5ZA 3G08B 1BQLL 4HIEB 2D4DA 2IG2H 3LEVL 1CD0A 3WL9B 2UWEA 2QQNH 3FL7A 4YHYB 1YY9C 4FQXB 3UTTA 1YN6B 1S46A 3EJTA 5DTFA 5L0QB 2VDOL 3DX7A 4R97B 3WSQL 3CHDA 4UT9H 4KGLA 3UTZA 1ES0B 3DHMA 4OCXH 5C3TA 8A3HA 5DD0H 3HMCA 1B2WL 2VUYA 4IOFC 5DZLA 2J7EA 4NJAL 5HGAA 1LDPL 1WT5A 5FYJU 5F70A 1I1XA 1JGVH 4HXAH 4C4KT 3V6ZA 1MF2L 4RAVB 5C2BL 1ZGLB 1OOAA 4YBQD 5GS2D 3H9ZA 3FOMA 1I1YB 1UZ6F 4S1RH 2R0KL 4FZ8H 4B41A 1C3FA 5D1XD 3WJLA 2X7LB 3MUGA 3U6RB 3HC3L 2V7NA 4WW2B 3TIDA 4F33B 1NAKL 2EKSA 1RUML 1YMHB 2EDEA 3QSKB 4OGAC 1MFVA 4AEIL 4JHAH 5HSFA 5GS0C 1YEEH 5JHDE 5BS0B 2ICCA 4HWNA 1CLOL 2VMFA 5BRZD 2DQTL 3C60A 1ONQA 2FHBA 3OBAA 4GUPA 3D9AH 4JFZL 1ZLWH 1J01A 4WO4A 1H09A 1HYRC 5I78A 4Z76A 4JFQA 5D7IF 2VL5B 2QADC 3ARUA 2GK1B 1MCHA 4QCEA 4PMDA 1T89C 4AD3A 4R8WL 3H42H 4U6YB 2WSKA 1FFPB 5A2CA 5I8KH 4P3CL 3WO3B 3CLFL 2Z31C 4PRNA 4EIZC 4PJBE 4FG6C 5FK9A 3KPPB 1DBBL 4WI2A 5J1SC 3QXAA 5GSRA 3QPQC 2V5MA 3FN0L 1FE8H 1GGBH 4QRSA 4JFXB 3LIZH 5CP7B 4JQVC 3P9MA 2Q8XA 3ZT7A 1XGTB 3MCLH 2WMPA 5ENWB 3RWEA 2AJZB 4JB9L 1E3ZA 2WMGA 4K8RC 1X5AA 2JF6A 5ACMA 1RP9A 1T0PB 3OAZK 3BEVA 1IJ9A 1EJ6A 2WWKO 5FYJD 3WQWA 4JCLA 4FFWD 5DRXB 3OF6D 4LLDA 3ARFA 5HD8C 1NP2A 4RWYH 1IAIM 4D9QD 4L9LB 1MRFL 4OQTL 3ARDD 1J7VR 2QHRH 4NO3A 4LLWB 5CEXA 2IFFH 3VXNA 4UOQA 1TQUA 4Z2LA 1TJIH 2MNUA 3CZLA 5D7LD 4Y4HD 2D3LA 5DJ8A 1R0AH 2OJEB 4RGNE 5DJDB 2HFGH 2Y07L 4B16A 2P4AB 2OSWA 1XZ0B 2ZCHH 4TSAL 1TUXA 3AU1A 1I9JL 2RCSH 4MNGB 4NC1E 5E8DH 4EUPH 2J77A 2R4RH 3IKCB 4LMQE 4MDIB 3ULVD 4OZHA 4F7PB 5DMGD 2DDQH 4G9FA 4F57L 1TJGL 1JNDA 3DIFB 4PMOA 3A21A 1G0YR 4J4PA 1IVLA 3WY1A 3OMZA 2F8OA 3BX7C 2XZAL 1SR0A 1AE6L 5EZOH 5C6PB 4MA8L 1QWUA 3T4YA 3TFKC 3NCFB 4ODUB 4OLXH 2AEIT 5EFFA 1T20B 4L8DA 5LAXA 5IF0B 4ZFZA 5CJ5A 3OZOA 5ESVA 5I66B 3MRIA 4HWEH 5GS0H 3WXVL 1YEGL 2JJSA 1MNUH 1NUGA 5C9JB 3DVNA 4HS6B 3VIKA 4LLAA 2F54B 2J8HA 3UTSD 7FABH 4JIEA 4NZJA 3H3PH 4LKXB 4NFCA 4WKHA 2W67A 1V6YA 4XVUC 1ZLWK 3MMWA 3BE1L 3POCA 3QUMB 3MBEC 5GGQH 1DQJB 5GISH 3UROR 2DQHH 4E8CA 4RNRA 1JV5B 1RQ5A 3CHCA 1D9KD 1YHTA 3MREA 1X6NA 3STZA 4U3AA 4WF7A 5CZVH 1MEXL 5E00A 2YUXA 2DT3A 1MCCA 1N6VA 3TO2A 2VZUA 2G4FA 3T4AB 1DEDA 5JORA 4DKEH 1BZ9B 3KPMB 3MXWH 5ICXA 3CJJA 1GC1C 3B9KB 1PY9A 4JJHA 4M4RA 4WHTB 4K8RH 3Q6GL 4ZFGH 3DX6B 3MNZB 2PYEA 5C0RH 4PPTA 5HVGB 3MLTA 3UC0H 2BY3A 3VXMB 4OD3H 2F7OA 1WCQA 3CUIA 3QUYD 2OL3H 4NWUH 3TONA 1A7NH 2B1HH 1HN1A 4JRXE 3V0HA 3PWPE 3TC9A 1G84A 4QRPB 4R2GB 1OWRM 3SURA 1OP3H 1M53A 3V0AC 2AEWA 5DO2C 3RVVD 4Z78B 3BKCL 4NP4L 1GGUA 3HAEG 4LFHG 3ZR5A 2OTWB 3RM8A 2X4NB 3M45A 5KSUA 2YZ1A 2VXVH 3T65A 5ACLA 4MYWB 1YNKL 3TA9A 4LCYA 2XVKA 3O6KL 3E2HB 5LQBL 2VDNH 3CO4A 5JW5A 2VLJB 4TSCL 4BFEA 4KJQC 5KJRH 1LJYA 1QHZA 1JG9A 4O4YL 3OB0K 3KG5A 5E2WH 1YEDA 2E9BA 1HJVA 2QQKL 1CDIA 5FO8A 1MJJA 3MQIA 4WIQA 2Y8VA 5IB5A 2Z8SA 2FR4A 3L7EB 3LPFA 4PJDE 3BH9B 4JM4H 5GRYA 1TMCB 5JOFB 4PEEA 4J3OC 3SDCA 8CGTA 1E4XL 3FONB 3VKKA 4AYSA 4LYQA 4U05A 3TO4C 2VDMH 1F97A 4CD7A 1HXYB 5BZDB 3WFBH 4KKBD 4G8EA 4PREB 1GPFA 3VD3A 1DCLA 3L7FA 3ZHLA 4DKDC 4I3SL 2O5YL 1W0VA 4N0YH 4I4WA 4AQ1B 3EDKA 4KRLB 1EGJH 3O6MH 1UWXK 4WTXA 4N90E 1H3VA 3DRTA 5FM5O 1QQDA 4A2MA 1LP9A 2HN7B 5HYJA 3BLKA 5C0BB 4KWUA 5DJAB 2DBJA 3V6BR 3TV3H 1Q6FA 2J74A 1UC6A 3QG6B 1CFSB 2NY7H 1HL8A 5ALCH 5ABEA 1NDMA 3DUHA 3EDJA 1FVCA 2DL9A 1FA2A 2DI7A 3GSRB 5I8CA 5D8WA 3G6JE 1OGAA 4NM8H 3UTPE 2WYSA 4HIHB 1KFAL 4LSDA 4M9PA 2AJSL 3ZJ7A 1CFVL 4YK4B 2GQHA 4R0LC 1GC1H 5HY9B 1EXPA 1C08B 2JJTA 2CXGA 1BFOB 3KYKH 3HLAA 4HC1H 2RFXA 4U7KA 4JZJA 3QIWA 4XZUB 1FGNH 4QXWA 2Z8WC 3VX0A 2EDBA 4LBEA 2DTMH 3TF7C 5DUML 1A6VL 5D2LF 4PR5A 1TITA 1UD3A 3AIWA 5T3ZL 3EJZD 1L0XA 4JO3H 2BHYA 1BAGA 2IQAA 4S0TD 2Z8RA 1UG9A 5ACZB 1H1NA 2GFBB 1Y6KR 2NY3D 5IK3A 5EU6D 1FNFA 2O61B 3FFDA 4P2YA 4UIMA 2JJUA 2D7TL 4YFLF 2XTJC 4M7JH 1ZHBA 2FJHA 2P8LB 3HZYB 4F8XA 1T22B 4AM0A 5E4EB 3FO2A 1R5IA 2W65B 4PSRA 2K3TA 1JWMB 3LS4H 4URTB 1M1SA 5B3JF 2R9HC 2X4PA 1F4AA 5F7YC 3NA9H 2XQBH 4WTWA 5ESQB 2I26N 1CDJA 1QZ1A 2XZCH 1LE9A 4P0DA 2A1WH 1XC6A 5JIPA 3QEGL 1AQKL 4RL3A 2O26U 3O3EA 2RB8A 3CZKA 5GS1A 4LPUA 5CJ8A 3AS0A 4PJ8C 1F90L 4RA3A 2BDNL 1FNGA 2K9UA 2PCPB 2ZKHH 4XBGA 2Y6SD 4U1NA 1PEWA 1CBVL 2AVGA 3W39B 3IFPA 4WU5B 2ZNXA 2VRQA 4FQXD 4JFHD 4CMMB 5FCUL 1H15B 4AIXA 1YDPB 1IAMA 2GJRA 4C56A 3ET9F 3V5DB 3W82A 1FRGH 4OIAA 4LRNH 4YUEH 5EU4A 2APFA 1HNFA 1OP5K 1EFXB 4YHGA 4PY7A 4ZSOB 2FBOJ 4FRWA 3TJHD 4RX4A 5E6IB 4OBRA 3CPUA 2XICA 5D71L 4PJXA 3GI9H 3VE0B 4NC1C 4WFFD 3CFJA 4NZDA 3VMPA 2MANA 3RAJH 4HBQA 4UUJA 1GORA 2OMBA 2P5WE 1RUAL 2F58H 1T6WA 4AEHH 3A3HA 5BZWB 5F1OB 2BRRH 5KSVA 4XNYH 3IU4L 2ADGB 4OF6A 5EORH 3T3ME 3FT2B 1OW0C 4NUJB 5J11B 1AXTL 1F3JA 4P8XA 3NZHH 1CFBA 4DAGH 1OAQH 1TVDA 1J0HA 3DYMA 4Q6YA 1YY8A 2VDQL 5BS0D 5IM7B 1D3CA 3U2SA 3MOQA 4BZ2L 3BSZL 1ZVYA 1GOOA 1UJTA 1VA9A 4OZGE 4TVPD 3O4LE 1KB5A 4PY8J 4K55A 1ZHKB 1BLNB 5M95B 1FFOB 1JGLL 4PRDB 4QP0A 2O9PA 4ZO9A 5CINH 2FX8L 4GQRA 1QA9A 2LTQC 3IJHA 4UQBA 4D6GA 5A6BA 5EG6C 3TA3B 7A3HA 1QO3A 3PWVA 3SOBH 3VRIB 3FNDA 3SIMA 2H26B 4C58B 5FA3B 2IGFH 3FQWA 3LKOB 5IB4B 4OD1L 5L8JB 2CYGA 4J1UB 4DGVH 5FOJA 2QPUA 1UKQA 4JFFE 1E28B 1FC2D 1SJEA 1NC4D 1ADQA 3HG5A 5HJ3A 2XPGB 3BKYL 1MH5B 4QYOB 1UJ3B 1CLVA 2ZUUA 1LL6A 5SWSD 1W0WA 4P2QE 3ARYA 3P30L 3BVVA 5LXGH 4KZDL 3BLPX 4XNXL 5DD6B 1HSAB 2OYMA 2A73A 1NLDH 4JDVA 4XAWH 3SUVA 2NR6C 5D96B 3V7AG 3MFFA 4EKJA 4JFTA 5CEZD 1J1PH 1R3KA 4MJ6A 5DJ6A 1RY7B 1IGFH 2BJML 1VFMA 5DR5L 3DVFA 3CPLA 1ZT7B 5E9DB 3GBLA 5EBWA 3AFLA 2YBRB 2YD2A 4X0NA 3M8OL 3MUIA 1Q9WA 5EU5A 1FLRL 3WSQH 1K4DA 1ODZA 4U31A 1J05A 1N2RA 4Z7OF 4KROB 3UPRA 3MLWL 4BH7B 3BDYL 3U0WH 1LNUB 5L2JB 4QLLA 2OS7A 1F4YH 1LDPH 1U91A 2ZP0T 1CTNA 1MF2H 1BVLB 2BMKA 3LKQA 1T7ZA 4DOHE 5HHVL 4QHLA 3KWXA 4C54A 1Q72L 5AYQA 3GK8L 2EDYA 3IFOA 1A1OB 2XKUA 2X9XA 2R0KH 5ALBL 1UVQB 4ODXA 4Q2ZA 4OOUA 1RZKL 1UOKA 4LCCB 2NXZD 3U1SH 4N0UA 1QNRA 1ZT4B 3HC3H 3T2QA 1YUHA 2YEZB 4KDWA 4GKNB 3JV4B 3SGEH 3VXQA 1KCLA 4ORZC 4D2NA 4J6RL 2AAAA 3QH3B 1WIUA 1XF5A 1CLOH 2DQDL 4KAQH 4UDTB 2XIBA 1OL0A 5F6IC 2VLKE 4NQED 4JFZH 2ARJB 4HUUA 1PKQE 4FQLL 5CUSH 2H9GA 5BUGA 2BHZA 1KN4L 5EBMA 4YHKH 3WLBA 4QOKE 3L5JA 4HS3A 3VW3L 5E2VL 4P8VA 1WP6A 3QNYA 3TBTB 1FZOB 1DVFD 1OAXL 3MGTA 1V0MA 1JWSB 3MV9B 3WD5L 1YN7B 4H20H 4DN4H 5IMOB 3WQVA 5TJWK 5LWYL 1AD0B 4ELME 5DQDL 1W9BM 4Z7WE 4Q74A 2CDFA 1B0WA 3V5KB 4X7TA 4U1SB 4YAQA 4F58H 3WUGA 3ECQA 3QUZA 1OAZL 1SMAA 2P48B 4MAYA 3ULVF 4PD4K 1JF1A 1AFVL 3B9KD 2XRAL 3VFPA 4EUPB 3VFRA 3MRJA 2NNAA 3EJYC 2FJGB 3QDHA 1JAEA 1MYRA 1E6JL 3ILQD 1QSEE 4PUBH 4UI2A 1T7VA 3FMGL 2E9JA 3FO1B 4TRPH 5D9MA 4GRLC 1MRFH 4OQTH 3VXMD 1S9VA 5DHYB 4JANB 4M7KH 4ZG1A 3VM7A 1RIHL 2YN5A 2J2ZA 1E4KC 3GKWH 1KTDB 2HLAA 2Q8AL 5C0GA 4QRPD 4UZUA 1U8IB 2B4CC 3BDBA 4F80A 2J71A 4H8HA 4UTFA 2WV3A 1JIBA 4TSAH 4WDIA 5E1AB 5GQBA 5C07D 5BQ7B 1I9JH 3T1FB 1N5YL 1TCRB 3OLGA 1IGTA 1HYSC 2LAAA 2O9TA 1HHKB 4JY5L 2DIJA 2Y5EA 3D5OF 4E0RB 2VCBA 4BQ3A 1TJHH 3QI9C 3T0ED 3TBVB 4O9HH 3ZSSA 3MBXL 1JE6A 3SCVA 2PYEE 1KPRA 3FFCA 4NRYB 4N0CD 4POZC 5JDSA 3X11A 2XG9A 2VLJD 3GSWB 3T3PE 4PGJA 2WKGA 1KCUH 1KIPB 3AREA 3EYPA 3QEUA 3UMTA 4XP1H 3RL1B 2P7TA 2XZAH 1OCWL 5IBTH 3LH2L 1S9WB 5JPMB 1HNYA 3G5XB 4OAWA 2Z31B 1FBIL 4HWBH 5JQ6L 5FGBC 3LQZA 3MNWA 4EEEA 2CBIA 4P2RB 3N17A 3WXVH 3IETB 1YEGH 4HKJB 3LZFL 1KGWA 2CJUL 4NPYB 3BZFA 1IM9A 1V0LA 2BK8A 2X2YA 4FQHA 4WI3A 1T6VN 3BGMB 5FYKE 1F2XK 4ESKA 3WFLA 3PQYB 1C5DA 1AGEA 1CF8L 1BPVA 3PWUB 2J88L 4B3KA 4IIQC 2CK0L 1OARH 3E0GA 1NFKA 1BFTA 2OL3B 3D69B 4P23A 2GJZB 2WIIB 4JFDB 4GXVL 1FVDB 3SCPA 4WHDA 1KIQA 1CI5A 5D7SH 5IWLC 4NNXA 2VLME 4WWID 4PJ9B 3QCTL 1NARA 5GXBB 4J4PD 1DWAM 1G7PA 3VXUA 1MFAH 1OVZA 2ATKA 2Q6WA 1JNHB 3GZKA 4QTHA 1A7QL 5E0FA 4C83A 1XCTA 3EJUA 3WUWG 1QSFE 1KFWA 1WBXB 1RZJC 3I6LD 2X4OA 1D6EB 4BH8B 4AZCA 2AXFA 2W5FA 5AZEH 3KWWA 3RI5K 2J7DA 2CGRH 4PTTB 1OPGH 2B39A 4M82A 3CDCA 4YDIL 1R5VB 2OSLA 1LP9E 4GW4B 5HYJE 1P7HL 3I50L 4OCYH 4MD5A 4Y2DA 5ITFB 3UZVB 1XGYL 3BKMH 3GHBH 3WYRA 5F3BB 4X9GA 4LHUG 12E8L 2B4CH 1XH1A 2PW2A 4NRRA 1X1NA 4Z2HA 1FGVL 4YIQB 5J7CC 1OGAE 3EJRA 2ARJQ 2A6IB 4ZXLA 5DJYA 1IC7H 5JW3H 3NOIA 1WWAX 2AJXH 2QEJA 2EYRA 4OLEA 4PJIB 4QHKI 4RAUB 1GJWA 4LEOB 4PRHA 3K2UH 3WNNA 1QSZA 1T83C 2X2JA 3GBNL 5D2NE 4I1NB 1AGCA 4HK0A 2D0HA 3MMEB 4O4YH 4XH2A 4DTGH 1XCQB 1ITCA 3CFKB 2D7QA 3S96B 3BAEH 2VZVA 4GFTB 5FECA 3MBEB 1NBVL 3I75A 5EB8A 1D5IH 3VFGL 5HDQL 1LG1A 3AIEA 5A3HA 1GRWA 5F89B 1KB5L 4BQ2A 3MLXL 4PJ7E 2FYYB 1DQQA 4CNIA 1W9UA 1MI5A 2F15A 3IDXH 5LGHH 3GJFK 5C1MB 4EKXA 4M5YH 4HZAA 3WIHH 4NX0A 1ZK9A 4JM2C 1X5GA 3QDJB 3MRMA 3K4AA 1I8LA 4PBWD 2VXQH 4XCEA 1KQZA 1GPOH 1EFXD 3GRWL 4JG1L 1CFTA 3QDMB 3RZCA 2OSYA 3RIAF 1CE6B 1ADQL 1XGPB 3TBWB 5EH1A 4WHYH 2YPLB 1OSPH 1CLYH 1CD1A 1H0DA 5CIPA 4N9GB 3SN6N 4U0RC 5BMFL 3DX4A 4ACZB 1NKOA 1VGKA 2J5LC 5CJOL 5I1LB 4G8FB 1K2DA 2E9IA 3V6OA 5IESL 4D6DA 3MLVL 5IW3A 1BX2B 3SGKA 5CGMA 3DDFA 3LV3A 1FL3A 1KB9J 4UILL 3PZUA 2HWZH 1MWOA 2J4WH 2GJ6A 2APTA 5D8ZA 2A9MH 1O6IA 3APGA 4HZ6A 1OGTA 4R4BB 3B2UD 3VCLB 1J10A 2HG5A 4C56E 4OGYL 3BPOB 2DDXA 1P7KB 3BJLA 1RZJH 1DN0A 4ETYA 4KTYA 4U6VL 4B7LA 4ZQKA 3ROOB 1FH7A 1KXVA 4WEBL 4PJXE 5FB8B 5EO1A 1MCOL 4UZGA 1LMKA 2NY6D 5ICZB 2FB4L 1SJHB 5J8OA 1N8ZA 3QEQD 5ICYB 4FOMA 3ZKMD 1HSBB 4J8RB 3TA3D 1SEBA 4N8VB 2DQIL 5T5NF 3QDGB 4KMQA 5C08E 5E7FA 5IHUH 1K8DA 1T80A 1EUTA 1IC5L 4LASH 1RSFA 1MHHB 5EA0H 2J75A 2W63A 5A8OA 4LSPH 5KVFH 4IISA 3LMJL 4HUXA 3VXRA 4TNVF 4DCQA 2AEQL 1NOUA 3GHEL 2H1PL 3I9GH 1G9NC 1Q6GA 3IB4A 3UJTH 4UINL 3WJJC 4Y4FA 1JZ5A 3PWNB 2NY2C 3TO4B 1EXUB 4B53A 2YD7A 1UUQA 4K94L 5AD0A 2DLEA 4M8QB 2OXHA 3VIOA 3MV8A 2P8PA 1KLUB 4GKSB 2JJVA 3S2CA 1C92A 4KTEH 3ARTA 2DIAA 1CFQB 1JFHA 2GJXB 2HKFH 3ZT6A 3L4VA 2ZXAA 5HHNA 1WICA 5E9DD 1DBMH 1ZA6A 3QT2A 1CBVH 4UQ9A 4WW2F 4N68A 3SE8H 5DUBB 3SY0A 4BJLA 4LLUB 4Q9RL 3B83A 3K46A 5EOQL 1GW1A 3VD9A 4RGOL 1Q9LA 2YDRA 2NZIA 4OLYH 1P6AB 2IPUK 3W9DA 2FDMA 4N5EC 5CSZA 3UCRA 3FQRB 5D71H 2XVNA 4R5EA 1IAIH 2EH7L 3HC4L 3P4OA 4R0LB 1L7TL 3ILPA 2R56H 1Q1JH 4WY7H 4G8IA 1FV1A 3ZDXF 4NCC1 5JHDB 1RUAH 5ITBL 2CLVA 1W8OA 1VDGA 2KKQA 5FYLL 4XPHH 2W62A 3VXPB 2EYTB 5IG7A 1KIRA 4MD0B 2ORBH 4FNUA 4LPWA 1AXTH 3UDWA 3X13A 2FD6L 2JIXD 1BQHB 2G2RB 3DURA 1RJZA 3PDOA 4ZDHB 1I8KB 3CZEA 3P3YA 3DTXB 4Z7NE 3BSZH 3AS2A 2F53D 5JUEH 4PJBB 4E42A 5EO0B 5IOPB 1IARB 1CK0L 1JGLH 1N7ML 1BWMA 5JXED 3MLRL 5GJSH 4LU5L 3O0RH 4QF1B 2FL5A 5CJXC 4QNPF 3MLZL 2VR4A 4P7NA 4WK9A 3O3UN 3ZZ1A 3FY1A 2DBLH 4KUZL 4MJIE 2R4SH 3MV9D 2ZSWA 3ULSA 3MUJA 2BNUB 1JNNL 3BN9C 4WNQB 1GZPA 4PJ8B 4R90L 2JCCB 3MRRA 1QVOB 1PIGA 1KEGH 4JLRB 4EN3C 2LU7A 2Q20A 3MCKB 3BXNA 5DFWH 5DVMA 3VSTA 4CVWA 2X4RB 1YY9D 3KAAA 2Z92B 1G9NH 2J62A 4LCIH 4CD6A 5IMLA 2R15A 4BQ4A 4QXGL 5I17A 3KPSA 1U8LB 3FQNA 5HHQA 3L4UA 4RGNB 3RNKA 4IOFD 4KRPB 1S7VB 1U2HA 3BLBA 5TH2A 1ZLVH 5CMAA 2F8QA 4XT1C 4ODVL 4XP4L 1BP3B 1DLHB 3SO3C 1NEUA 3NPZB 1UM5H 1S9YB 3MLPA 3NFSH 4B9YA 2HJFA 3VGDA 1EEZB 3X17A 2XIIA 4PTUB 4AY0A 2IUZA 1RJLA 4G6KH 2CDGB 3HE6C 1CT8B 1BM3H 3NIYA 1P9MA 1S7TA 1H3PL 2X2IA 2PXYB 3RP1A 4KJYA 1LL7A 1UB6B 1T21A 4OGAD 5I1KL 1IEHA 1L6XA 1P2CA 2YD3A 1KGXA 5GS0D 2CR6A 5I8OL 3G9VA 4ZFOB 3FW6A 2WBKA 4LEXL 3LKSA 3O3BB 1R5WA 3EBAA 5IJVA 5T33L 3PHOB 3O41A 1IGIL 3OHXB 4AIZB 5ALBH 5CPSA 1FNSL 4Y16A 1V3HA 1AY1L 1E0WA 2B2XL 1RZKH 2X8RA 2Q3AA 1BYCA 2QADD 3T1WA 4J12A 5C0JB 3TWCL 4NO5B 4JG0L 1OSZA 3PZ9A 4M48H 4S1SH 5D2NC 2OW7A 4J6RH 2RHEA 3ZO0A 3EZJB 2Z31D 4WEUD 4X8JA 3DX9A 3MGOA 4FG6D 1VFFA 2VWEE 4TNWK 4P2RD 2DQFB 4Z5RB 2F19H 3TVMA 3OPZL 2YLLA 5E0QA 4PJHE 1KN4H 1S7WA 1QLFB 5KSBE 4IUGA 1MVFA 1FG2A 1A7BA 1QR4A 1R3LB 1P84J 1EQPA 1HJQA 5E2VH 3H3KA 3C2AL 1KCSH 4MNMA 5ANME 2IH3B 3FFCE 3O2DA 3PP3K 3PQYD 4K8RD 4LF3B 1UZ8A 2IEPA 3AB0B 3R1GL 2EPLX 1KOAA 5IIEA 4GT7A 1A6AA 2K7PA 4PTVA 3THML 5E2UL 4NNYA 5FYKH 4NRZB 5HD8D 2YPVL 2HFEB 2X4SA 4V1DD 4YHOH 1ZBKA 1P4BL 3VFUB 1J9CT 2WBGA 3QG7L 2ZE0A 4XVTL 1UXWA 1B4JL 3GMOA 4OQ1A 1AFVH 4Y89A 3WMBA 1E73M 5JLZA 4JRXB 1HHGB 3U0TA 5F9JB 3PWPB 1C90A 4UNIA 2DSZA 4U3CA 4EI5C 4NKOB 3OR6B 3PV6A 2BVYA 1WDSA 4PJAA 4L8BB 1U8QA 1J8HE 1MHEA 2FEEI 5DGQA 2J3SA 4Q0XH 2DT0A 5DQJB 2R1WA 1LO2L 4F9PC 4RCAA 5DFTA 3UG4A 1FIEA 2XN9E 4JRYE 3UG3A 4HLZG 3RPKA 4LAJH 1A0QL 4XBPA 1F11B 3ZDZF 1FFNB 4LSTL 4WUUD 2P24A 3IGAB 1U93A 3BZ4B 4OLUH 3AYRA 2VE6A 2H6PA 5C0IA 5LYRA 1MJUH 1Q0YL 3EO9L 3X14B 3TFKD 3KZSA 3IANA 3T2OA 3LXAA 4TUJB 3WD1A 3QCVL 3AXLA 2DWDB 3IDNB 1I1AA 1ULVA 3HA0A 1HJUA 3HE7B 4HBCH 2W0FB 2V2WB 4OD2A 2QJDA 2FBJH 1IL1A 4FTVE 4PJDB 3B9AA 1I9IH 3GMRB 3QWRD 3HG1E 3CXDH 3OKLA 2AQ3A 4LLMB 4J3TA 3H7BA 4OI7A 1BFVL 4XVUD 3KL0A 1MY5A 4MNLA 4HG4K 1IE5A 1NGWB 2HVKB 3MBED 4GAYA 3O6AA 4HAGA 3WF3A 2X05A 2CIKB 3TYGH 4C59B 3L4XA 1IGJA 3I3BA 2PF0A 4K3EH 3RUGE 1OD8A 4G5ZH 3QJFA 1B3JA 2JELL 3C6LA 2IQ9H 2XY1A 3VU2A 1GOIA 4PB9L 1ZTXH 2JB6B 1NBZB 3G04B 1QPXA 2ZUVA 3PGCA 1CF8H 4PRHE 2A6DA 1RMFH 3S9DB 3SDDC 5KVGH 1UR0A 5D9NA 4O2FB 1FSKB 2G3MA 3QDMD 1YYLL 3MRDB 2CHOA 1QI4A 3G6JB 5INDA 3DX2A 5T3XL 4XHJC 3VI3E 2O93L 3WLWC 2A6KB 2YPLD 3HCVB 4HMEA 5D9OA 4ODHL 1WV7T 2P8MA 3RIKA 4ZD3H 1S8DA 2EDJA 3V8CA 1XR8B 5HPMB 4XPAH 1UYQA 3MFGB 1D5RA 3BPNC 2NTFA 5MEPA 1JNEA 5EUKA 4AZ7A 3NA4A 1JZ4A 3DVGB 4GMSL 1VFAB 5L7XL 1EERB 1Y6NR 2AI0L 1HJSA 3LQMA 5H35A 1HHIA 4PMYA 4UNTA 3WDJA 1T0NA 2D73A 1E4JA 4G42B 4GKLA 4P3WA 3MSGA 1TZHB 4ZXBB 1CL7I 1QTYT 4Y4KC 4V28A 4CVUA 5MHSD 1VRXA 4P7LA 1FH8A 4LPCA 1DE4A 4CW1A 3TNNB 1KYOK 5T1KB 2XWBA 4KJQD 1GOFA 4XCCL 2EICA 2VR5A 3DUUA 4X4YB 3V6OE 1K9DA 4HJJL 4HT1L 4DKAA 2FGLA 3FTGB 4X5XA 5A40E 3L3JA 4K9EC 1FGVH 4LIQL 2GJ6E 2VABA 5EZJA 1CXEA 1IEBA 2A74B 2OTUB 2WVTA 3SPVB 3EYUL 1A5FH 1FQ9C 3QXWA 3BHBA 3OGVA 4K7FB 4NT6B 4RZCA 5KSAC 1WO2A 3MPCA 1ORSA 4HF5H 3W25A 2DSUA 1JPFB 1EVUA 2V5TA 5INCB 3TO4D 4Q6IC 5HYSB 1KC5L 1X5HA 3IFLH 1ZHNB 2YKLH 1QRNA 4U1JA 3GKZA 4AZIA 5C9KA 1EOKA 2EXWC 1LWHA 1JWUB 3IJSA 3GSQA 3BJ91 3QQ4A 3BIBX 3VFGH 4HPOH 4UDUA 4Z7UE 1N64L 1KEML 3B2VH 5K9OB 2GSGA 4U1HB 1J0JA 1KB5H 2XACC 3MLXH 3V0JA 1FORH 3HFMH 1J87A 3GSOA 1OLLA 4J3WA 2HVMA 2XSAA 4HUWB 3VXRE 3ARPA 3PNWB 5DS8A 4JHOA 1ZEAH 4M6ML 2HH0H 3ARWA 2XFYA 3PGDB 1JGUL 4OFPA 3BRDA 1J5OH 3V4PL 4QT5A 3QULA 3J7HA 5GIRA 5EIIA 4HEME 1RUPH 3KXFD 3SDYL 3GJEA 4KH2A 5TDNA 1J9YA 2CITA 1ADQH 1RJYA 3IDYC 4XNZC 5TE6H 1MCPH 1G6RA 5DTFB 1JHTB 3DX7B 4L5FH 5DMIL 4UBDC 3TN0C 1BZ7A 5CJOH 5IESH 3U9UA 15C8H 2ADFH 1XH2A 3SGJA 4UILH 2EE2A 3AQUA 2DLGA 4WU7A 4PUDA 2JK5A 4OZGB 1A47A 1U8OA 3O4LB 5HGAB 1K5NB 1T2XA 1J86A 1WEJH 3O81A 4XPFH 1MRCL 1T4KB 5IMMA 5E8NA 4C7DA 5I1AA 1EEYB 1NUFA 5TDOB 3UBXI 1NCAH 3PWLB 3FOMB 3WEXA 2CDEA 1G7LB 5F3HA 1WCBA 3WXWL 2MTPA 2XTJD 4OCSL 1GQJA 4M03A 5IHRA 1JPGB 3LKRA 4ZFFA 2XT1B 2VWEC 1VGEH 4NO0B 1CE1L 1MCOH 2VDRH 4JFFB 1XF2A 2R9HD 1W9XA 1NGXA 1I7UB 3D39D 4L1DA 4DGYH 3SDXE 1E6PA 4YGVA 2ICEB 1ZL1A 2DT1A 1WTLA 35C8L 4ZOCA 5IJKC 4P2QB 1ONQB 5FGCE 4GUPB 4HX1A 5F1SA 5DWUL 2CKRA 3N1AA 4BK4A 2OW6A 1U0QA 1WWWX 4Y19A 3P4MA 4Z76B 4JFQB 5FF6A 4KKCD 3BPCA 3LMJH 3U36A 1JHLH 1KLGB 3LN5A 4X80H 1ZSDA 1F5WA 4PJ8D 4UINH 1JRHI 1Q6DA 5I3DA 3IVKA 1G7HA 4PRNB 3O9WA 4Y7EA 1RHFA 1NCWL 2CHNA 4RISL 3BD4A 5FK9B 1I85A 1DBJL 1C5BL 4JM2B 2EIBA 3BIKA 5JW4M 4U7MA 1E9LA 4U5KA 1GXEA 1QBAA 1F4XL 1PLGL 2ZUQC 3P9MB 4OKDA 3AWEA 3EJQA 4TVCA 1JPTL 3RWEB 3L3HB 3MV7E 1I1FB 5AY7A 1P7QA 1RIUL 1VADB 2UUDH 4Q9RH 1P6WA 4U0RB 3QIBC 4QLJA 2J5LB 4KVCH 4DOHB 3O2DL 1LLOA 1TG7A 2JIWA 1W1YA 3ARFB 3L1OL 2J73A 1R87A 1CS6A 4H0HB 5AUMA 1XT5A 3TT3L 3LRLA 3WE6A 1Q0XH 4HK3J 3VXNB 2N56A 3N9GH 4MXQC 2GTWA 3KPSE 1K8IA 1B6UA 2X89D 4PGEB 3U4BH 3LPPA 1IC4L 5GSVA 2BSED 5J89A 3CCHA 1I7ZA 2VLKB 3AU1B 4E41E 1PKQB 3OX8B 4CCDA 1FVEA 1I4FB 2OYLA 1UM4L 2VXUL 3NBNA 1CQYA 1PYWA 4PRBA 5LJYH 4MXVE 2FD6H 4QOKB 2EYSA 3ROLA 4F37K 1JK8B 4QRQA 2GT9B 3D2UD 3M17A 1D6VH 1NUDA 2DQGL 1YEKL 1VJZA 1ETZA 4JFEE 5DQ9A 2ZG2A 2X9YA 3B6SA 3D1MC 3EYVB 3MLRH 4ZE4A 3KYOB 1SYTA 4Z7VA 4YC2C 3EOBA 3T4YB 3NPSB 1GL4B 1HHHA 3M46A 4LU5H 3H55A 1MCJA 3JZ7A 3MLZH 4ELMB 4DEPC 4Z7WB 3I85A 1OHQA 1FDLL 4L8DB 3CXHK 1Y0LA 4KUZH 4M8UA 4AIEA 4UFLA 3I3EA 2NR6D 5J6HB 1E1EA 4PG9B 2D2OA 5F6HJ 3QBTB 4W5UA 1J0IA 1JNNH 5E8EB 5DJ0A 4X5WB 4JY6A 4KHTH 4OF5A 1QSEB 5CHNA 3VX1A 1E4LA 4A2LA 2DD8L 4X6CE 2QMKA 3U30C 3GSNH 4P4RB 1BBJA 4HKBA 3UBXA 4M93B 4RNRB 2YBUA 2XZQL 3S37H 3MREB 4PJFE 4NYLB 3S36H 3CLEL 4JRXD 5GGSA 5E00B 1G7QA 1E4WL 1UCBL 3H9SE 1KT2B 4PB0H 4QLKA 3TO2B 1BD2A 3REVA 2QKIA 1P69B 4G3YL 2O92A 3H53A 1QNZH 5J9PA 2ADJB 5JORB 4X9YA 3LEXA 3SKUD 5ICXB 1HZHH 3JV6A 4ZUTB 4DJMA 2H2SC 4DGIL 1A7RL 1A1NB 2MCPH 2PYEB 4NF7A 2EEAA 4YE4H 3EKCA 1H3PH 2H32A 3VTRA 3UXFA 1MAJA 3V6OC 4LHJB 4NKDA 4GS7B 3SGKC 4BSJA 4P2OC 1JAKA 2E3ZA 3QA3B 5T33H 4LEXH 5E2TH 3GXTA 1IGIH 1NCCL 4HWZA 4WVRA 1FNSH 4IBLT 3D18B 5KAQF 1AY1H 2HTKC 1PX4A 3S5LA 3AIRA 1R3HB 4GW5A 4YDKH 3WDPP 1FL6A 1T0OA 3GM0A 3PN8A 2F1BA 2FEDD 4LXFA 3AIVA 5L2KD 1YZZA 1KJ2A 5H2BA 1G0XA 5DD3H 5IMKB 3VXSE 1G7IB 5KEZA 4PJEE 2FATL 2ZUYA 1WFOA 2E9WA 4PLJC 5J12C 4R7NA 3OQ3B 1CICA 4N90D 3SGDI 2CUHA 4GI8A 5CJQH 3PZVA 2F9BT 5DHVH 3VFWB 4EN3B 4PGBB 1RULL 1UH4A 1GGIH 3IRPX 5EOCL 1MJJB 3AXIA 2NT0A 3QWOB 2D1ZA 1K4CA 5FL1A 5IW1B 4KMLB 3C9NB 2VSDA 2EDNA 3B43A 1NQ6A 3EJYD 2C3GA 5KW9H 5E2UH 1JHKL 3MJ8B 5B8CC 5J06A 4LPXA 5KN5B 2VDKH 5ABGA 1IEAA 1GJIA 2AEPL 3TP4A 4G8EB 1QSFB 3PTKA 1P4BH 3WQ8A 4GRLD 5I18L 2IXUA 3G6DL 1MLCA 1SMDA 1U8HB 3SO3B 4LCWA 5C7XL 4BA0A 3KLAA 5FKYA 2YWZA 4RQQA 3AHZA 3W28A 4OGZA 4A3HA 5E70A 1C16A 5DEZA 3C5JA 3DRTB 2Y2WA 3OB8A 5D8JL 1LP9B 3HE6B 4QCIA 4Q7NA 3N85H 5SWQB 4PJIF 1EGZA 4XNUH 1U8NA 1G7JA 1HYSD 4NQDA 3P11L 3U7AA 1FVCB 1RIVH 2PTTB 3DGGB 3QI9D 3S88H 4G6AC 1DANU 1OGAB 3UPAA 1F3RB 1QOXA 1TQCB 1OM3H 4CADA 4POZD 1NC2A 3MODH 1A0QH 1MCKA 5T1KD 5D5MF 3GH4A 1SFSA 3PTQA 3W0WA 4UOW1 3RKDC 1AIFB 3HLAB 5D2NB 2RFXB 3QIWB 3O2VL 3MRKB 1B4RA 1A14L 1G6RL 3IU3A 1E6OL 4OBSA 3WS6C 2NY0C 4KMTL 5MENA 3VFSA 2CKNA 4KK8C 2R2HA 3FJTA 2IQAB 2DGAA 4R4FH 2B1AH 3MRBA 2ED7A 3RMEA 4MA3B 3S35X 2HFFA 5ISZE 1QBLL 4PJ7B 4UIMB 5D7JA 2R29L 3PGFH 5CGTA 1AGDA 2EXYC 2HP4A 3QNXB 3FB8B 1R5IB 3G6AA 1AJ7H 2F5BL 4AENA 1WC7B 1R7OA 4UQDA 2X4PB 4AT6A 2BOBA 1C5CH 2VLLA 4TVDA 5TDPA 1AGFA 3CDGA 1LILA 3MS8A 4I5BA 3FT4A 1DR9A 4OZFA 5F7KC 3GI8H 2OLHA 5GS1B 1KTRL 5IW6A 4MCYA 4RDQG 4U1MB 3H6JA 1CDGA 4EI5B 1A2YA 3QO1B 3LEYH 3D50A 1UHVA 4MHHI 3ZDYF 1DWFM 4U1KA 3HKFA 3SO5A 3NSMA 1BF8A 4C56B 4H2CA 5F7DA 3FHQA 1BIHA 2HT4C 1BAFH 5FAAA 3ULUC 4L4PA 4CVZB 1I3GH 2ESVA 3RDTA 3O4LD 3ALFA 1UB5A 4YBLB 2JFEX 4PJXB 1CL7L 3V8OA 3KVQA 3BDXA 3RWDA 5L7XH 4EANA 1HQ4B 2AI0H 3D51A 1F58L 4GAGL 4K7PX 1KELL 3VJ6A 2HYMA 2WC3A 2E7MA 1QFUH 4PMXA 3AZRA 5A43C 1ZWIA 2ZWZA 1WSST 2GK0B 4GH7B 4M7ZC 5C08B 4UNUA 5JUVA 2YA0A 5KSVB 5HDOA 4NO0D 4PD4J 4DK6A 1AXSA 2FLBT 5IHZA 3PABA 4JFFD 3VXTA 3P0YL 4DFHA 1F3JB 2PO6C 1UKSA 4EXPX 4XCCH 3RIFF 5FEBA 3MRQA 5IKCA 4HJJH 4HT1H 2F5AH 4P2QD 1P4LA 1PIFA 1VIWA 1IILE 2G75A 4JZOA 1KB5B 1UGNA 4LKCB 2WW8A 1D5XA 4NUGH 5DT1L 2WBJC 3BVNB 3EGSB 4N1HB 1OBAA 4P57B 4X6EA 2LE9A 3IFNL 4ZUSA 3ARGC 2B5IC 2F74B 4NC0B 3NIFE 4W70A 1BG9A 1T7WA 1QO3B 4OCWL 4BQ9A 43CAA 2AK4D 1ZOXA 2PR4L 2BNRD 2D31B 3BGAA 2AK1H 4QHNA 4X7DC 3RPIB 4PYSA 4DZBB 3SDDB 2Q8BL 4P46A 1BQSA 4QO1A 5HHXH 2F7PA 3ZOAA 3KLDA 1W3LA 1YNLH 1W0WB 1SJXA 4K3JL 1LO0H 4ODTH 2VB5A 1YC8A 4Y19E 3IAQA 3RJQB 4PRIA 1EJOH 4KTDL 4GRMA 5BV7C 1P4IL 2A73B 4LVNC 3SDAC 4L4JA 3QQ3B 1N59A 3Q6FA 2PUQT 3FQUA 3MFFB 1PG7X 3AHVA 2NPLX 4M6MH 4WW1B 5A16A 2FWOB 4MJ6B 1CLCA 4XPGL 5IB1A 4FQIL 3BPNB 5D4YA 1O7SA 4CN6A 4N5UA 2F1AA 5D70H 4KI5E 1G6VK 5HYQA 3SDYH 4K2UH 2AKRA 2FZ3B 1E27B 2NW2A 4O58H 1V8HA 2XKNA 1HIZA 2IBBA 5IFTA 4AD4A 1BECA 2DKSA 1AKJA 2DQEL 2YXFA 4DN3H 2I25N 4M43H 3U7YH 1N2RB 3RX5A 5EUOA 2VLKD 5KTEL 3UPRB 4WV1A 3TZVA 3HNTH 4KK6C 1DUYA 3EYFB 3QCUL 1IV8A 3ULUH 1IAOA 5F7MC 5GJTL 3LKQB 2CKSA 4P5KB 1IM3A 4QHLB 2JCCF 4JN1L 3BP7A 4QOKD 4NXSA 2D24A 1QR1A 5EC2A 5CD3A 3FB6A 3WBAA 1PQZA 4Q2ZB 3ARVA 4OV5B 5MERB 3BD5A 3NTCH 4MJIB 1MVYA 1OQXA 1S5IL 1MAML 1YUHB 1E70M 4UQ2A 4HDIA 4LK4A 5TPWH 2XWJA 2OK0L 4IRSA 3LY6A 4U1IA 1GOMA 3O2WH 3HNSH 3HR5A 3BUQA 4Y5YC 2NY2D 5GRUL 5A6JA 3DVIA 4M6NH 4Q6IB 4L29A 2IGTA 3BC9A 2FJFB 1UWEL 4HPYH 3U46A 1JRHL 4HUUB 3X3FH 1JGEA 5I1HL 2H9GB 3VG0L 1CBGA 1GQIA 3CZSA 5FYKU 4JQIL 3QXDA 4E5XA 2IAMA 1U6AL 3LKPB 4HS3B 4F8TA 1JZ2A 3EFDL 1XH0A 1JDDA 4X99B 4UQ3A 4B50A 1QSED 5MP6L 3JSSA 3MROB 2R69L 1QLEH 1S7RB 2C7UB 1YPZF 1HINL 3K1KC 3QNYB 5F88B 4Z95L 4RISH 1DANT 5F1NA 4QHKJ 4JO4L 1A6ZA 1C7SA 5J1AA 2XM1A 3FRUA 2NX5E 4UMGA 3MRGA 3SUWA 1KJ2L 3QFJA 4MLIA 1WB0A 4RGMC 5SWZE 1I9RH 1F4XH 4XB8A 4N1CA 4N5ED 2CDFB 3QYCA 2DH3A 4RMRA 2G5BA 3CVHH 5D7IA 4YAQB 2VDPL 1JCKA 2HVJA 3IDYB 4QY8A 4XNZB 1H5BC 3E6FA 3RNQB 4L4VD 2YD8A 4MAYB 3DX3A 5D1QC 1K6AA 2MFNA 4I0KA 3MRJB 1CG9A 2NNAB 3VFRB 4MAVA 1NH6A 3O2DH 2Z35A 4FQ1H 2MKWA 4RDQF 5BV7H 1UA7A 2C3XA 2EZ0C 3L1OH 3MOAL 3I2CH 4XAKD 3GNPA 2WIMA 1KN2L 3U9PH 4GBXC 3CVIH 3WHXB 4AD2A 1GQKA 3TT3H 1IGYB 4B0MM 3KPOB 1FAIL 3KPQA 4LQFL 2JF1A 2HLAB 3O3DA 5EBAA 5C0DB 2MQ3A 5EZLA 4WDIB 2LFGA 3AIUA 4FK9A 4NRXB 4JPIA 4D6CA 4PSPA 1IGTB 3O8XC 4PJHB 3CZ8A 1BGXH 4OLVH 5KSBB 4ISVA 3GBDA 3UR8A 5CKAA 3O6FC 2J8GA 1LQ0A 5IQ7H 4GKOA 1C8QA 2SEBA 5FYKD 4LLVA 5KZ6A 1FZKA 3JUYA 5ANMB 5KANG 3FFCB 2FO4A 3X11B 5JDSB 1RUQL 4F7EA 3RGVA 5GRVK 3QEUB 3BN9D 2C3VB 1U3ZA 5DJCB 3GSNB 3MRHA 4APQA 3WO4C 4GZJA 2BFVH 4OAWB 4EN3D 3VG9B 5K9JH 2FHCA 4H8VA 2AABH 5IFPA 1BPLB 1CXKA 3SKJH 1IQWH 5FO9A 1ZHLA 3BCDA 1Q6EA 1NCNA 1IBGH 1T1WB 3OJMB 3LD8C 3OG6B 1D5ZA 1HEZA 4B9ZA 5E8OA 1NSNL 5DI8A 1IM9B 2KL6A 2ZUQB 2FX7L 2C3HA 3DUSA 3K1DA 1E6QM 3FAWA 1QSFD 4ZTOH 4LGXA 3UAJC 5I0DA 3MA9L 2DD8H 2ZPKL 4IRJC 4U1LA 3WKML 3P2TA 1RU9H 1MIMH 4DQOL 1ESWA 5C92A 3WSUA 1J8HB 1OF2A 1UQSA 5F7EL 1INDL 3HE6D 2XN9B 4JRYB 3RPMA 4GAFB 4OB5L 5FKAA 2FGWL 5TQ0L 4XRCA 2YFOA 4FNLL 1KIQB 1M03A 1DQLH 2XFRA 4NNXB 3BUYA 4MA7L 4PJDF 1DQML 4TOYH 3SEPA 3WELA 2XA8H 1G7PB 4BA8A 4UOW0 1MFDH 2ATKB 3P77B 4RRPA 4TVSa 4K3DH 4C83B 2EEBA 4KV5F 2N7BA 3ARBA 3IDJA 2W9LA 1AD9B 1N0XL 4LCWE 3B9DA 2GYSA 3V52L 4AZCB 2AXFB 1PJ9A 4QHMA 4FTVB 4GZIA 3R06B 1HOCB 3AAZB 2PTUA 3H0TA 3HG1B 1T0MA 1V7NL 4PRPA 3PHQA 1ZGLP 3GXDA 1M04A 2OSLB 5FOOA 4X0KA 3OLDA 1JN6B 4LPYA 5ABFA 1EBAA 3VWJC 1UR4A 1KCVH 1IC1A 2YC1B 5DHVB 2Z4QA 1QI5A 4AMWA 3V0FA 3B3IB 3BGFC 3STLA 1JTTA 2PW2B 3RUGB 4HGWA 4QXUL 3G6JF 5C6TH 3HRPA 4D94A 3MJ7B 4EDXB 5EN2B 5EBLA 4JCMA 2J7LA 2W07A 4ML4A 3L6FA 4M8VA 3RY6A 1UR8A 2FATH 4PRHB 4OCRH 4E8DA 3OKOB 2RGMA 4OLWL 1AGCB 3L3KA 4I0PC 4J3VA 4CL7A 5TQ2H 4KHXL 5IP4A 4TPRL 2WUBL 3UJJL 4EVNA 3QIUC 5FD0A 5F44A 3U30B 5FECB 3BW9B 2I60L 3IAGC 3I75B 1CIUA 4GQ9H 1GZQB 3F7YB 5I1GL 1CGUA 1V3JA 1QFOA 1TR1A 4HD9A 2NZ9C 4BKLA 1XIWA 2R0LH 1KG0A 1H9VA 5CILL 4LCUA 4EI5D 1U92B 5C0CA 4JKWA 3FO9B 4HGKC 1KBKA 1UENA 4KI5C 5E1QA 3EOAB 4EQ3A 3GEWB 1YQ2A 5JIHA 1WDQA 2D0FA 4AISA 1FIGL 4XCEB 4PJCF 1LO5B 1XCWA 1CFTB 2WINB 1HE7A 5D8JH 4UIKH 2P5EE 1F4WL 2Y06L 4F7CA 1DWHM 1H0DB 4ZNEA 1N3NB 1K2DB 2XWTB 1VAHA 4RFOL 5TFSH 4PFEA 1FL3B 5C08D 5I2IB 4OZIE 4NZUH 3NIDE 4UU9A 4IPNB 3DV6A 4JREC 2CPCA 1FG9C 1NAMA 3FO0L 2GJ6B 2DIBA 4MSWB 1MW0A 4M81A 5I30L 2WZPD 4P59H 3GMNA 5CGYC 1VJSA 4JHWL 4ODSH 2P42B 3SKMA 5IHBA 5FV2A 1KJVA 3O2VH 2ESVE 1CN4A 5HPOA 1G6RH 3VFTB 4DVBB 5JOPD 4KMTH 1NMBH 2BVOA 1PKOA 3SKOA 5EO1B 1DL7H 5F96H 5E94A 1MFBL 4PGZA 1N8ZB 4M5ZL 4AL8L 2KQNA 3ZT5A 1I1RA 5D1ZC 2BSRA 1TVNA 4Z7UB 5BXRA 3DMMD 4S1QL 2DYPB 3DETC 2XI9A 5I1IL 3AS1A 1K8DB 2CBJA 5L9DL 1K85A 2BVPB 4XC1L 3UYRH 5DUPL 4N8CL 3F58H 4H26A 4NZTL 4NN7B 4YNYA 3VXRB 2HJKA 4DCQB 4Z7QF 5E9AA 3SDDD 4QRRD 3RHWF 2WQ8A 5BCAA 2Y9RT 3LAFA 5KZCB 4YXHL 4D0BB 1LQSR 5B8CB 1PZ3A 4OZGF 1FHDA 4ZAKA 2DMCA 4XHJD 2A0LC 5D2LA 3WLWD 4NQDD 5F7HA 4NQCA 4XB3A 2VTFA 5JIIA 2P8PB 3QRGL 1QPPA 1DBKL 4KVNL 1A3QA 2J1KA 3LS5H 1MFEL 1R34A 1QBML 4MD4A 2EKJA 4PY8I 3OGSA 3EFFA 1YEIL 3D0VA 3RL2B 3JUGA 5HHNB 4JKMA 5FGRA 3EMQA 3V6FA 3UJIH 4HFWB 4CN1A 4Y5XC 3BAYA 3F7VB 4Y5VA 1QI2A 1IMHC 1MQKH 5HHME 1M7DA 3SUTA 3CZFA 2UV3A 3GNOA 3GDBA 4Y4KD 4P5TC 2DQXA 2JJWA 1UACH 1FN4A 1EPFA 3VH8B 3O2LA 5DC4B 1DBAL 5A69A 1CL7H 6FABL 1LVEA 2IF7A 4G8GA 3ILPB 5B38A 5E99H 1QP1A 4IHOA 1JD7A 4PJ5A 3HI6H 1FNLA 5C0AD 3SDXB 4TTGA 2CLVB 1C12B 3DX1A 2NY0B 5FGCB 3L95A 3BKJH 4BZYA 3G5YB 4F15C 3SCMA 4MJID 5DVLA 5IG7B 3I6KA 5KSAD 3GGWA 2D3NA 4TUFA 4I3RL 3H54A 4P4KA 2V3EA 5T5FH 4OZ4B 2PWGA 5AYIA 3D3AA 1RJZB 3PDOB 2I5YL 4FMFA 5EUOE 3EYQC 4XVSH 1L7IL 4EDWL 1LE5B 2V2TB 4M1GH 3ZTNL 3EDFA 2ZXQA 1INEL 2EXWD 4IMLA 3EO0A 4U6HA 4E42B 4WKAA 4MS8C 3SJVA 4G9DB 1WBZB 1A4JA 5T1DL 1TCMA 1CU4L 3L5XL 3VFOA 5DK2A 5C86A 3BPLC 1MQQA 4BELD 4U1GC 3B8YA 4NQXA 1B3XA 1BVKB 4P7RA 1NFDF 2KUTA 3DRQA 3MV7B 2ZSWB 3TTOA 4PYHA 3PP4H 5I1JL 3ULSB 5HGHA 1I8MA 3O3AB 5EMYA 2VLRE 5GGVH 3RWCA 5HXMA 5CCKL 4G43B 1IGCH 5L0QC 4AEFA 3BXNB 2QSCL 1R7AA 2XN2A 1ZS2A 4HCRA 4NC2B 4O2EA 4DK3A 1NMAH 3NACH 2DKMA 4PGDB 1GCYA 4M9OA 1W1VA 5IMLB 3D4ZA 4UBDD 3TN0D 2L4OA 5IFJB 5I17B 2WHLA 1EVTC 3K8MA 4JR9L 1JNJA 3FQNB 4HG4J 3UBXG 4XPGH 5J57B 4Z8FL 3RNKB 5GRJL 2A3AA 1FNEA 5DMJB 5TH2B 5CMAB 3S3PA 3SE3C 4JO2L 2LU4A 4E41B 3MRNB 4YDJA 3TT1H 4EI6B 5D6CB 2X4TB 4M62L 2HJFB 1VEMA 3IJYA 4ELMF 3UEQA 1CZ8H 1S7SA 4Z7WF 3CSBA 4HQQH 2Z93A 4M7ZB 4Q97A 1PW3A 5DMKA 5KTEH 5D7IE 1US2A 2Z91A 1AQDA 4AK1A 1UQYA 1MWAA 1N6QL 2GIYA 1MLBA 4KJYB 1IT9L 4JFEB 2PO6B 4XZWA 1A3LH 3CK0H 3D0LA 1M7IA 1QFWL 4KC3B 1P2CB 2GFTA 1IGML 8FABA 2VKWA 2ZCKL 3LKSB 5D1XA 4X83A 5IJVB 1TFHA 5I5RA 1KTBA 5BRQA 3AXXA 1G9MC 2IBZX 2WNGA 4J7RA 5IFAL 2CUIA 1ZVSA 1MFCH 4M7LH 1MAMH 1S7QB 2VO5A 3SCWA 5E8PA 2ADIA 3ARGB 2VISB 2OK0H 5BRZA 3KJ6H 1J1XL 5A2KH 5FO7A 1RFDL 2VJXA 2HFTA 4X8JB 3DX9B 3MGOB 3TPUB 2UYLB 3JWOL 1EH9A 4BSVB 4NZRL 2ICWI 2IH1B 4X6CB 5FUZL 3TVMB 1H5VA 1T3FB 3WD3A 3CVHB 1FCGA 2I07A 1MCBA 3X12B 4PJFB 4LDLB 4QEGA 3WNLA 2FX9H 1ZKAA 4DKFL 2DH2A 2CIIB 1QRKA 2J7CA 3H9SB 3OKMB 1LEGB 3QISA 3V2AR 1UZ8B 3T3PF 5BV7B 2EACA 3SDAB 5A2BA 4LVNB 5IIEB 1A6AB 1AKJD 3QIBD 3G5ZB 5J1TC 2YDSA 1J8HD 1KJ2H 2W38A 1MRDL 4NNYB 4L9LC 2ZIDA 4WI7A 1ND0A 2XN9D 2BY2A 3BP5A 4JRYD 1PSKL 3QZWB 1GZJA 1IKFH 3PDGA 2VDPH 3HS0A 4MXQD 1ACYH 5C09A 1H4PA 4WIWA 4HUVB 1EQCA 4YXKH 1VSCA 3CSYA 3OXSA 1FH5H 5DVNA 3OF6A 2F7QA 3BAJA 2PI6A 2FECL 4P9HL 1C8YA 4LNVA 4UTBL 1T5WA 3AJ7A 4DVRH 1WFNA 5I6XC 2YOCA 3ARDA 4OF0A 5FIEA 4EOWH 1UXSA 4WFEE 1W2KT 4FTVD 5D7LA 1AXIB 3HG1D 5M7QA 1X5KA 4WJ5B 4LQFH 4ZS7L 1QNSA 1C8XA 4MDJB 1JDCA 5DVOA 5AWNH 2ED9A 1SBSL 3VXSB 1JMXA 4MQXC 3UX9B 5DMYA 5K9KA 3MA7B 4PJEB 5FL0A 1H0IA 4F2MA 1UWRA 2VE6B 2H6PB 5C0IB 3TH2T 4BUHA 1E5JA 4YHIB 4R26H 3BRFA 1DDHB 5FXCH 1NCTA 5IR1A 1T04B 4XVJL 4HIIA 1EFQA 3K4ZA 4P5MA 3SE4A 1I1AB 1YMME 4KK9C 1HH6A 2C0HA 1HNGA 1RUQH 2D03L 4W7UA 4S1DC 4NDMA 3VILA 4OD2B 2ZX5A 1NANI 4ONFH 1NAML 5DGRA 3WF2A 1G7MA 1YC7A 1ZJBA 5BVJA 3WIFA 3OKLB 1EO8L 3CH1B 3H7BB 5HTSA 2O5ZL 3PL6C 3V4UH 4AIOA 5A95A 2PKDA 1WDPA 4GAYB 1XGQB 3RX7A 2LU3A 4PMQA 2VRAA 3O6LH 5CZKA 4MAUL 1NDGB 3UTSA 1RHHB 4G6JL 2J8UF 3QJFB 1NWTA 3DXAE 3MLYH 5HYEA 1V5JA 3QHMA 2VIRA 5ABDE 1XSJA 3WD0A 43C9A 3VGAC 1ISYA 5DK3A 2ZPKH 2V2XA 4Z7VF 2QQLL 3LQAL 2A6DB 4LL9A 5D1QB 1D5BA 3UTQA 1YYMH 4XWGH 4DQOH 3KDMB 4H88H 2ZOXA 5BO1L 3IJ9A 1MVUB 3HMWH 2BSTA 3NABH 3OZ9H 4DO4A 5INDB 1TQTA 2L0DA 1RZ7L 4ZYKA 5FUOL 1KPUA 4OB5H 3ME0A 4MQTB 4IMKC 4ATWA 1SYSA 1TMQA 5TQ0H 4IDLA 3LRHA 4ZENA 4WUKL 2VXSH 3S34H 1S8DB 3WV0A 2WHJA 4P2OD 2R2BB 4PJ7F 4OKVB 1KCRH 3B4NA 2ICWA 3PWJA 5ILTL 5C0CE 1ISVA 2WVVA 4OZFH 5MEPB 4NM4H 5IV2B 1N4XH 2XVPA 4LNRA 1ZS8A 3QUYA 5H35B 1W9DM 1GOWA 3O8XB 4M24A 4QXTB 1B31A 4LYPA 5CEYA 2CKBH 4W6XB 1CVSC 1Z3GH 4TNVK 4Z77A 3AM8A 3D25B 4H7VA 3P4NA 4UT7L 5DD5L 2G60L 2GK2A 5ISZB 5HI5D 4ZO8A 1T5XB 1FPTH 3HB3C 4AH2A 4X98B 3L3OB 1NL0L 4RMTA 4L8SA 1R3IH 2XWBB 2MCG1 1NBYA 4XC3H 3F7QA 1FFQA 4PLJD 3QB7C 3BEWA 3DUUB 2DYPD 4XX1E 3HI1A 4M02A 4QXUH 3WO4B 5TF1H 4FXKA 4X5XB 3ZLQC 2EPNA 3INUL 2AJ3A 4ZOEA 1WFUA 3HMXH 3BHBB 3CHFA 3SCNA 2KBGA 4TQEH 3SGDH 5A8NA 1ZA3B 1BJ1J 3LD8B 2WKLA 4G7YH 1XH3A 5EFDA 5TE7L 1ORSB 2J8OA 4JZNB 1G1CA 4RMWA 4GQPH 4OF8A 3QFDB 3L9RA 2WUBH 3WH7A 4IRJB 1HH9A 5IB2A 1HQRB 3TBYB 2BY0A 3MOBH 3QUMH 4UDUB 5HYFA 2GSGB 4X6BA 3IXAA 4H1LH 5HBBA 3VD7A 3OXRA 3PIQA 2YUWA 1YEHL 1FO0A 2JTDA 1EBPA 4NCDA 1JNLL 2DL2A 3GSOB 1EAJA 3CFCL 5DS8B 1U3HC 3RA7L 4FFZH 3MSPA 5FUCE 2YD5A 4G6AD 4QT5B 5EIIB 5ETUA 1BYDA 1B0GB 4PUEA 1SYVA 3I6GB 3LRSA 2X5PA 4NQCE 3V0WL 3GJEB 3GMLB 5TDNB 1JL8A 4U3HA 1VACB 2AGJL 1E56A 3RWJA 3OAYK 2WNWA 1G6RB 3RKDD 3BXWA 1UG6A 4O51A 3RVUC 4AG4L 1E0XA 4GPNA 1TZGL 3Q5OA 1ZLSH 5E08L 1HWWA 1M05B 2VL4A 3CHEA 4WFGE 4HCRL 1JZ3A 2UY2A 4RFOH 2JB5L 5BW7C 2NY0D 4UOJA 5LKNA 2X0YA 4GO8A 2JK5B 3OWEA 4KK8D 4OM0H 4ORGA 2RJMA 4CD5A 5B3JE 2P46B 4OF7A 1CGSL 2ZOLB 1MREH 1P1ZA 1RK1B 5F3HB 1ZLUK 4YHMH 4F37F 1XGRA 3VRJB 4YHLL 2EXYD 3FCTA 3MTRA 3ABZA 2ZUSA 1GVYA 3UO1L 3VRLF 1XR9A 4M5ZH 3BZDA 3E8UL 1XF2B 4HHAA 4N0FB 1NGXB 2Q76B 3KGRA 5EU6A 5CSYA 4PJ5E 4IJ3C 4XNMB 3DJ9A 4JQXA 4I0PB 4YGVB 1B30A 1UA6L 5KS9E 1MWAL 2XY2A 3RTQC 4HX1B 1A3HA 3MV7D 4UB0H 3OV6A 5L9DH 1A9BA 4ELKB 5C8JB 1U8JA 4Y19B 3BPCB 4N8CH 5CBAA 1E6ZA 5C71A 3MJ9A 3O45A 3LN5B 4L4TE 2IPKB 3OG4B 4ZUUA 3BT2L 1FZMB 4Z7NF 5DD1H 4YXHH 3IVKB 1UADC 4LAQL 2L7JA 2ZJSH 4W93A 1DBKH 3BIKB 1JUFA 1VERA 2ATPA 3T77A 4UNVA 4HA1A 3QNZB 4PLKC 2HT4D 3ULUD 4HIEA 5LCVL 3DBXA 4YDVA 3FB7A 1YEIH 3MC0A 4IOSD 2VZOA 3ZL4L 2F2HA 3GXNA 1CDUA 2OP4H 4FQXA 3EHBC 1P7QB 4E41D 1GH7A 4XP5L 4J3UA 1WIPA 3F12A 2VH5L 1ES0A 1JPST 2E9LA 5J6GB 2WAHA 4NZFA 3GIVB 1O0VA 1BFSA 1JYVA 2MJWA 1X5YA 4JREB 1I3RA 5JMRA 3R8QA 1ZGLA 2YMXL 4JFED 2PO6D 3WUBA 3CD4A 1I1YA 1RZ8A 3E3QE 2R8SH 2GTWB 1ROWA 3QP3A 5A1AA 1QKZH 4X9BA 1EA9C 5DEGB 3U6RA 1WZ1H 4NNPL 4WW2A 4F33A 1YMHA 2WBJD 3JWDL 5FYJL 2E9MA 4QDMA 2YS4A 2GDVA 1H3WM 2Q86A 1FVEB 3T2NL 3S35L 3ARGD 5D1ZB 3W2DL 5BS0A 5C3LD 1BGAA 1W9VA 1T66D 3A4WA 3TESA 3QPXH 1HKKA 3H3BC 2V5SA 4XPTL 2I5YH 2IWGA 2DJUA 3ROLB 2ESCA 4F9DA 5E4IA 5I1CL 2VL5A 2GK1A 4KPHH 1MHPL 1ETZB 5DQ9B 3QHFH 3G6LA 3B6SB 3P0VH 5BVPL 4MX7B 1FFPA 1YEFL 2NX5B 2LQRA 4NGHL 1CU4H 4FLSA 4NKIH 3K8KA 5GRWA 4HH9B 3H9SD 5SWZB 4HS8H 1LEKA 3ULVL 5D96C 2YLAA 3KPPA 5HHOD 3ESVF 5EPMB 5I1DA 3T0DA 3SDAD 1GOHA 1NC4A 4YO0B 3LPWA 4W87A 2AJUL 4DUVA 3V0DA 5CP7A 1J18A 2WMHA 3GNML 1XGTA 5SWSA 3V79C 3GM8A 5DJ0B 5ENWA 2AJZA 3I02B 3IT8D 4HGMA 3GSXA 4Y5XB 3NN8B 3UBXB 1BBJB 2CLRB 4PJHF 3PTMA 4PGCB 4GKZB 5T1LD 3NZ8B 2VC2L 5KSBF 4PV8B 4KROC 1UWUA 2YA2A 1Q94A 3L5IA 4JR9H 3WFDL 1VKXB 4P5TB 2W0LA 5GGRA 4Z8FH 1G7QB 5GRJH 4W5ZA 4K7PL 2Z1SA 4LLWA 3X3GH 4KK6D 3SE9H 3MCG1 2OYPA 2VXTH 3VFMB 5J9PB 5E5MA 3Q1SH 1KJ3H 3BUTA 2OJEA 4W4OC 1TTGA 4BZ1L 1UQZA 5DJDA 1UWGL 4LQ1A 3CFEB 3MXVH 4BQ6A 5CP3H 4F15B 4DUWA 3IJ7A 3VXSD 1B9ZA 3IKCA 4MDIA 2VAAA 4F7PA 2H32B 1N6QH 2NYYC 4RRPG 4TUOB 4DM1A 5FFLA 3AHTA 5FYJE 4CDHA 4FQQB 3DIFA 4NKDB 4Y1AE 3BP4B 2F8XC 3EJJX 2ZCKH 3QUKA 4GO6B 4KY1H 3ZYJA 4JE4B 3S5LB 4D9LH 1U8MA 1A64A 3QUXC 5I19H 3WUZA 1R75A 1O7VA 3WNOA 4NQEA 5JW4Q 3SCUA 3BPLB 1KTLB 4U1GB 1MPAL 1H8SA 1KJ2B 5I66A 1RZFH 5H2BB 3DX0A 1WPCA 1NLBL 2NLJA 5BXSA 2WWCA 4Q9QH 5JQHC 2DLFL 2H8PA 3ULVE 4ALAH 4BFIB 4HS6A 4XCFH 32C2B 5GGRY 5IT2H 1A6UL 4LKXA 1DVFA 3WQ4A 4PMVA 2WM0A 1DQJA 3GSVB 1PG7L 5D1QD 1DSFL 1T1XB 4MADA 3C08L 1M6OA 5FM5M 5ESAA 5LA1A 4RFNB 2IANE 1MRDH 3NH7L 3OKDA 4PTWA 2EZ0D 3GO1H 1BZ9A 4GBXD 3KPMA 1ZV5A 4LCWB 1DUZA 5BZXA 3B9KA 1NGYB 3RUGF 4AZ8A 3VD4A 3THCA 3H7LA 4OV6F 5EC1B 3DX6A 2CBVA 4H8WC 1S7UA 4P9HH 1LL4A 4FQCH 4UTBH 4YEFA 5DJZA 4QCIB 1CNVA 3VXMA 4ONOA 2WCAA 3OA5A 1U8NB 3ZE1F 3O8XD 4KFZC 3MRPA 1MXGA 3O6FD 2J8FA 2XSBA 1FO0L 5BWFA 3JV0A 1AR1D 4QRPA 5ISZD 2DB8A 1MAKA 4Z78A 3KPTA 2NY5C 3VI3F 5C0EB 3KLKA 5C07A 4MMZC 5DEFB 1NC2B 3NFPB 4XX1G 4LX4A 2NY1C 3MV01 2X4NA 3KPRE 2YRPA 4AMKL 2E4TA 5DURB 4OM1H 3VI4F 3T0EA 2HLFC 3QAZC 1NPUA 2DAVA 4D0DA 4A6YH 5J0BA 1A6PA 2VLJA 3AROA 3BCFA 3O11A 1MJ7L 2BNQD 4OIIL 2D03H 2C7FA 2APXA 2R2HB 1YJDL 2O5XL 3BUPA 4I77H 2PWFA 2RAMA 3DWTA 3ZTJG 2OCFD 2QSVA 5D7JB 2GSJA 3U5UA 1MJ8L 3BSHA 4X6DB 3UAJD 1Z9SA 1BLIA 4CJ0A 4IRJD 5C09D 3L7EA 2E27L 4YWGH 2OYKA 4JL1A 3BH9A 1E4NA 5HI4C 3TJEH 3V7AE 2OZ4A 1SMOA 3FONA 4PJGE 5I24A 5IBUG 3EOTL 1LK3H 2BOBB 4G6JH 5BZDA 1GGCL 4N1EA 4PREA 2XFFA 3V9FA 1WKYA 3CDGB 4UCFA 5HI3C 3QHTC 4PJ9C 3FT4B 2P5EB 4Z0XA 3KLLA 4OZFB 1Z9OA 2OR9H 4HKZA 5B39B 4XPBL 1QPKA 4NOBA 5A8PA 3Q0HA 1T2QL 5IW6B 4UFKA 1CDHA 4MCYB 4DO5A 2BSSB 3TH4T 3GBEA 2HN7A 4KDTA 4OZIB 4OUUA 2CKBB 2EDHA 3K74B 5DJAA 2HKHL 2E8YA 1RZ7H 1A2YB 3MJ9L 5I6XB 3QG6A 5H94A 1CFSA 2IFGA 3MKKA 1H0GA 5F8RC 3GSRA 3MR9A 4Z7UF 5L88L 4OFYD 4TULL 3AY4C 4L3EE 4HWUA 3R0NA 4HIHA 5DYOB 5ADPL 4JY4A 4UTAH 2ESVB 4F8QA 5I75B 2BZDA 1LGVA 4CU6A 3VWJD 1LEIA 1UB5B 1MW3A 1BFOA 2UY6A 1PY4A 4NOFA 4H8WH 4XMPH 2Y5TB 5FHAL 4XZUA 3W53A 3W29A 1D2KA 3M6DA 2X6MA 5D6DA 1KF9B 4WWKD 5B38G 1OAKL 2DM4A 1AXSB 1NL0H 3PABB 4YBQC 5ACZA 2AOSA 2GFBA 4JFPB 3VINA 1I8IB 2WLZA 2VQ1B 1MCWW 1UWIA 4I0PD 2NY5H 5IKCB 2ZXBA 1AC6A 1DQDL 2P8LA 4BSWA 3PL6B 5TD4A 4TX6A 1OAYL 4H1LB 2G75B 5CSUA 3QIUD 2W65A 5DLMH 4MNQB 4X6EB 1TZ7A 5ESQA 4ZUSB 1NCBH 2NZ9D 4KRUA 3CX5K 3VWKC 4D0CB 3CH9A 4DWSC 2FIKB 4KI5D 1TE1A 4RBPH 1VEOA 3D3VD 3VGAB 4UOZA 4HJ0C 2DJSA 3HNVH 2EH8L 4QHNB 3EO1B 4ONHB 2V6HA 3TCLB 2UZIH 4TVPL 5HHMB 5TE4L 4WGWB 3SDXF 1ZANH 3QWQB 3W39A 2WLYA 1I7TB 2UVEA 1LO3L 4QCFA 1XFPA 3WFHB 3ZMRA 1YDPA 1AO7D 4OCLC 4JL2A 4OTXL 1H49A 3RKPA 4GRMB 1INQA 4HFUH 1XYZA 2WANA 4GMTH 3RY4A 3LX9A 3FQUB 4TUKH 5MEOB 4NFBA 5A16B 1EFXA 2H41A 4ZSOA 3GH7A 5E56A 3RILA 5JXAL 1F3DH 1AHWC 5IB1B 3D52A 4PP2B 3VE0A 5JW4N 3BPOC 4QTIL 1HXJA 2WC7A 1MCNA 2WMFA 5CGYD 3QOKA 2XKNB 4JO1L 3WIJA 1AI1L 5BZWA 4AG4H 3RWHB 4N0RA 4R7DA 1NEZB 1ZE3C 4M61A 5EUOB 1QLRA 1JMZA 1UEMA 2JB5H 3FT2A 5IFHH 4JFHE 4NUJA 3HAEH 4WV1B 5CEZL 3KEHA 3TZVB 1CXHA 1DUYB 4FMKA 4L9DA 5D1ZD 1IAOB 3EYSL 4Y4HC 5KVDH 4JN2A 3DETD 3BP7B 2WB5A 3RM9A 2ITDB 3IRZA 1BQCA 1QR1B 5EC2B 2EABA 4EBQL 3KYMA 1BLNA 1QEWB 4CUCA 4PRDA 3NCJH 1RV6X 4JFYA 4BQBA 4WFFE 3QEQA 1UKOA 4ODWB 2YK1L 4PG2A 3QXUA 3TA3A 4NQSA 2IBZY 2VLRB 3VRIA 3ULUF 1AR2A 4NHUA 2H26A 3LRKA 5FA3A 5SWZD 3LKOA 5IB4A 4RWHA 2A0LD 4J1UA 1PG7W 5GS2H 3SE4C 3U46B 4OSUH 1E28A 2IXVA 2MOVA 1CGXA 4LP4A 3FXYA 5C8BB 4O02H 2GKIA 3QHZL 2XPGA 4QYOA 1MH5A 4XZBA 1HKLL 1UJ3A 4BS0A 3RJYA 3ZJKA 2X1XR 3CMOH 1VPOL 4K3HA 4NHCL 2IAMB 4XP6H 3UYPA 3BT2H 1E0OB 3S4SB 3WN5A 4ZTPH 2FHFA 4YDLC 1MUJA 2DLHA 3A67H 5F1NB 1X7QB 5J1AB 4PCTA 1BG4A 1U3HB 3FRUB 3W5NA 4YQXL 3MRGB 1UZ4A 3CX2A 3F6IA 4IRZL 1ZT7A 5E9DA 4P9MH 4P5TD 2YBRA 1Z5LA 5T1MA 3L4ZA 1ZJAA 2B0SL 3F6LA 4ZO6A 3AHYA 3RRQA 2G5BB 4N9OB 5D7IB 3D4YA 2X70A 2HVJB 2R0WH 1D9KC 2ZZUT 4JPKH 5B4MC 1JFQL 2DQCL 5EBGA 4NWTH 1U2YA 2HT3C 5SWSE 4XTRC 4WHCA 5CLTA 2PW1A 4UT6L 4F9LA 1XGUB 4HIXH 3T0AA 4X6CF 5F6HI 1H2JA 1BVLA 4JVPA 5JNYA 4CMHB 3BQUD 3AZTA 4AYFA 3DROB 3V4VL 1U3JA 2YL8A 1TVHB 1JVKA 1OB0A 4PJFF 2P49B 4FFYL 1OP3K 1UVQA 3KPQB 5LG1A 4NJ9H 3EYQD 1HCVA 4LCCA 3WF4A 1QYGL 1ZT4A 2XXCB 3L5WB 5EZLB 2YEZA 3WHE1 4MS8D 4MGXA 4JDTH 2CRZA 1NCDH 1QX1A 2P45B 1CFNB 1F3DJ 1SM3H 3CUPA 4I18C 2JIXA 2X41A 4K23H 5E5UB 4LSRH 1KGCD 4ISVB 4UDTA 4IJ3B 2AERT 2F53A 4JVUA 1BVNP 2DIEA 2ZUXA 1TQBC 1KENL 2ARJA 4XPTH 5F9WB 1UH2A 3RTQB 1DLFH 1K6QH 3LHPH 2FO4B 5JXEA 3VA6A 4UFHA 2C5DC 1FYTE