2FHDA

Crystal structure of crb2 tandem tudor domains
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
150
structure length
150
Chain Sequence
HMSRRSFKNRVLAFFKGYPSFYYPATLVAPVHSAVTSSIMYKVQFDDATMSTVNSNQIKRFFLKKGDVVQSTRLGKIKHTVVKTFRSTNEQLSLIAVDALNNDMVILAHGEIEVTVPISTIYVAPVNIRRFQGRDLSFSTLKDMKFEETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the methylation state-specific recognition of histone H4-K20 by 53BP1 and Crb2 in DNA repair.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
molecule keywords DNA repair protein rhp9/CRB2
total genus 29
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18115 Tudor_3 DNA repair protein Crb2 Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fhdA01
2.30.30.810 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fhdA02
3OY9A 2GFAA 2RHIA 3OYKA 4E7LA 2K3XA 5D6YA 3P8DA 3QKJA 2RHYA 5D6XA 3LLRA 3OYGA 2MWPA 2HQXA 2JTFA 3GOXA 3H6ZA 3NTKA 2D9TA 3FC3A 3MEAA 4E7HA 3MP6A 4E7KA 4A4HA 2RI3A 4FU6A 2RO0A 4N4IA 2M16A 3OQ5A 4IUQA 2F5KA 2QQRA 2R57A 3OYBA 2RJFA 2BKDN 5KE2A 2E6NA 2RJDA 2EFIA 2K3YA 4PLIA 3S3MA 5C6SA 5KE3A 1XNIA 3UT1A 2O4XB 4IUTA 4B9WA 3QIIA 2E5QA 3OA6A 3L2WA 3OYHA 3E9FA 3O8VA 5M9OA 2L3RA 2RHXA 3OS2A 3OYNA 3UWNA 3F70A 4QQDA 1OI1A 4FL6A 5FRMA 2X4XA 4Z02A 2LTOA 2LVMA 3S6WA 2LRQA 2P0KA 1WJSA 3BDLA 3E9GA 2QQSA 4N4HA 4PL6A 2B8AA 2XK0A 3LX7A 3PNWC 4A4FA 3OYLA 3PFSA 2HQEA 3H8ZA 3OYAA 4IUPA 4N4GA 2GFUA 3LYIA 4QVZA 4BACA 4ZTFA 2JZ2A 2LCCA 3META 4E7JA 3PMTA 4B9XA 3EAEA 1OZ3A 5IAYA 4EDUA 5IN1A 3OYDA 2GF7A 2WACA 4BE0A 4IKFA 3P8HA 5FROA 3SD4A 2X4WA 3MEUA 4A4GA 3OYFA 3MEWA 3CEYA 2RHZA 4L59A 1SSFA 3L42A 2LDMA 4NS5A 4UC4A 2EQJA 2L8DA 2BUDA 3Q1JA 3MP8A 3OYEA 1H3ZA 2O4XA 2RI2A 2BIVA 3QBYA 3FDRA 4CRIA 3LH0A 3L2UA 5C0MA 3OYMA 4ZTJA 4QW2A 3OB9A 3PMIA 5KCHA 2EKOA 1MHNA 4RG2A 2EQKA 5D6WA 2R58A 3MO8A 1RI0A 4C5HA 3DB3A 3QJ6A 3M9QA 2IG0A 3OMGA 3OYCA 2X35A 3KUFA 3LGLA 4C5IA 4IUVA 2EQMA 2L89A 3OYJA 2PQWA 4BD3A 4Q5WA 3L2QA 3OS0A 1N27A 5KCOA 3OYIA 2MWOA 5KH6A 3L2VA 4OVAA 2M0OA 4BE1A 3FLGA 3S3OA 4HCZA 5J39A 3MP1A 4E7IA 2DIGA 3DB4A 4BE2A 3S3NA 4GY5A 2RJEA 2G3RA 5CIUA 4IURA 2YRVA 2VYTA 3ASKA 1WJQA 2X4YA 3LGFA 2RHUA 4X34A 3L2RA 4PLLA 5FRNA 3DLMA 3FEOA 2RI5A 2FHDA 1WJRA 3C4SA 4BDYA 3ME9A 4BDZA 2NLUA 1KHCA 2R5AA 2XDPA 1WGSA 3NTIA 4A4EA 2RJCA 5J26A 2DAQA 4QQGA 3OMCA 1OZ2A 2DIQA 3ZEHA 4C5EA 1OYXA 1G5VA 2M1HA 4QQ6A 4C5GA 3NTHA 2CKKA 3OS1A 4II1A 4LD6A 4IUUA 3MEVA 2R5MA 2EQUA
chains in the Genus database with same CATH superfamily
1RAAB 3EH2A 5FU7B 4F7UB 3JCMQ 2NUTB 3CCJQ 3A5ZB 3HKSA 3CCEA 1B34B 3RNJA 1M3CA 1IHWA 1E6HA 1K73C 1K9MC 1SRMA 1OPKA 2RK2A 1VUBA 2PU9B 3MHXA 2QGGA 4ZN3A 1EX4A 4PLIA 1VQNQ 3O8VA 2HD0A 3I9QA 4CC4B 4ME7A 5DY9A 4TVRA 2AKLA 1VQ6A 3RR6A 5FLXE 3E9GA 2Y90A 2MK5A 3PFSA 1YJWA 1YI2T 2YUQA 4M78D 1KD1C 4BACA 3OBYA 5KYXA 4F17A 4HCCA 4KT0E 3G4SQ 4JDSA 5L8RE 4M78F 2DNUA 4XU2A 2VC8A 4C0DC 1EFNA 5IXFA 2K5FA 1YWPA 2CUDA 5GAOp 1G83A 5CKEA 1VQ9A 3CMAQ 2PUOB 2K2VA 3LH5A 2RH2A 3CCET 1TS9A 1S72T 1LCKA 4KGXB 4M78E 1WXUA 1VQMT 4M7AE 3MKDA 1VQMQ 3LW5E 4EMHA 3L2QA 2DE0X 1IGQA 4LXCA 2FZKB 2DIGA 3DB4A 5DM7R 3S3NA 2HAXA 2E6ZA 2D8HA 3JB9H 3C95A 4JUVA 3QDFA 4KGVB 4X1VA 3H0FA 1WNLA 1M9SA 2NLUA 4DEXA 2L3QA 3RKYA 4ANJA 4HCBA 1OZ2A 1Y57A 4M7DB 1TXQA 2Y4YA 4F7UE 3OYMA 5CKBA 2OTLT 4M4ZA 3GIBA 3EG9A 3P8DA 4JRKA 1YJ9Q 2HQXA 2D9TA 1WQ7A 4C8QE 5IHNA 4CC2A 2XDDA 5I11A 4J9EA 1UGVA 2RO0A 4NOYA 4OMNA 4XAXB 2E6NA 2RJDA 3L2ZA 4M78A 1YITT 2D6FA 3CCLT 1W2BA 4O6JA 2ROTA 3ER0A 3EGDB 3CCQA 2E5QA 3OSVA 2L3RA 3G1JA 3OYNA 3F70A 3CPWS 1I07A 1UGQB 2RQUA 3JCMd 3PNWC 3CCVA 2EVRA 2A28A 3LYIA 4JJNK 5HY6A 1U3OA 3PMTA 1C0MA 2GF7A 2VKNA 1Q81U 1WXTA 3CD6A 2EPDA 1KJWA 1NLOC 3CCUA 5GAN5 2OTJA 1D1BA 2H8HA 1UGRB 1QCFA 2ATCB 2DTIA 2EQKA 2OTJT 2JS2A 2DL3A 1KD1R 2EQMA 3RMQA 1JU5C 4JRPA 1CSKA 2QASA 1OQKA 3C0CA 2HEQA 2G3RA 4M77B 4C92D 2BTTA 1PKTA 2K3BA 1SPKA 3AT1B 2LZ6B 3M0UA 2R5AA 4DOWA 4PFOA 3OMCA 3OW2P 2M1HA 4QQ6A 1T3LA 2BZXA 2M02A 3I56T 1X6BA 2P0PA 2ZAEA 2EBPA 3M0RA 3QYGB 1OULA 2K3XA 5D6YA 2QEXA 5D6XA 4OB3B 4E7HA 4XU0A 3WXMB 1UGSB 2XD0A 4C92A 1Y96B 2RJFA 2VGMA 2K3YA 4M77A 1VQ4A 1QVGS 3OA6A 2M51A 3E9FA 2RQRA 2WSCE 5M9OA 1VQKA 3A8HB 1VQOA 4DBHA 2QYZA 3GNFB 3VS6A 2O01E 4RTXA 4PL6A 1Q86U 2LC4A 3JV3A 3OYAA 2JUFA 4B9XA 4PJOG 2YUNA 1BI2A 1YJNA 2LCLA 4J9HA 3VS2A 3P8HA 1M27C 5FROA 3PIPA 2MAMA 2ESWA 3EFRA 4HT9A 1VQ4T 1RADB 2E10A 4F7UG 1GBQA 3PVLA 3HRUA 4QW2A 1QVFA 4RG2A 1E7OA 4M75E 2FG0A 2DZCA 1U1SA 2YUOA 2L89A 2QQBA 2VGNA 2XMFA 1Y07A 2C06A 2DKGA 2EKHA 4M77E 1WHJA 2JVVA 3S3OA 4C92E 4QVDA 2X9HA 2LJ3A 5CK9A 2Y4XA 2YRVA 4BY6B 3EFOB 1WJQA 2COWA 4L6V5 1Q86R 3MPUB 3G6ET 3DLMA 2I2LA 4LDYA 1Q86C 4RTUA 3NTIA 1BU1A 2DAQA 2MIOA 3CCLQ 3M4YA 1OU9A 4FT4A 2QK0A 1QKWA 1K76A 2GFAA 2RHIA 3CC7T 4HVVA 5GJWB 5GANd 3M53A 4M7AB 2DERA 4A4HA 4FU6A 2JOYA 4IUQA 4OF1A 4PJMA 1NPRA 4RKUE 2BKDN 2DRMA 1AHJB 3CC2A 2NUZA 3S3MA 3CBOA 1XNIA 2DJQA 2YT6A 2L5QA 2LMJA 5A2QE 4FL6A 1JEGA 1X27A 2RQVA 4WTOB 4CC7A 3CMEA 1NJIR 3URGA 1GCPA 3A98A 3ZFJA 1OU8A 2AZVA 4M7DF 2DMOA 2JMAA 1N8RR 5KYUB 3JRZA 3CCVT 3EGUA 4XTXA 2V1RA 1YIJA 2AHJB 3PVQA 3VS0A 4F7UF 1NE8A 4L59A 4KBMB 2LT4A 2FZCB 4BI4A 5LJ3h 1I4K1 1M2OA 1JRIA 4DEYA 3H9NA 4ZTJA 3AHUA 4XU3A 1FX7A 3CCQT 2VB6A 4C5HA 1D09B 1YITA 1ZUUA 3L1AA 1D1AA 2HSPA 3OW2S 2A08A 3JAME 3EG9B 3CC4T 5EC7A 2RN8A 5GAMf 4Q5WA 1V76A 3FJPA 2EGAA 4M75C 3L2VA 3M54A 4OVAA 1QVPA 1U5SA 4DBFA 1PC0A 1T3SA 1QVFS 4BE2A 1NYFA 1WHGA 1IHVA 2V1QA 4PFPA 5GAN8 4J6YA 2CZ1B 3CCRQ 3BY7A 2P84A 3LWHA 1QW1A 1K8AC 4M77G 2H3JA 4BDYA 1XTDA 2MF2A 2QAZA 3TVTA 4A54A 2RJCA 1PNJA 2P0QA 4QQGA 5LJ5e 5CAIA 3SHWA 4M77D 1N8RC 2QGFB 1YHQQ 2DK3A 2HL5C 4RTYA 1VIFA 3GBQA 2CDTA 1QWEA 4LE9A 2LQNA 2RK1A 5I22A 5CO7A 2EGEA 3QKJA 1YJ9T 1KC8R 4FYVB 1HXDA 1M8VA 2KRSA 1SHGA 3OQ5A 5I21A 3OYBA 4PFZA 2FRWA 3KBGA 2JTMA 3A8OB 3TU4K 3CQTA 3UWNA 2KGTA 2LVMA 1ABQA 3G6EA 1NJIU 3BDLA 2QQSA 2CSIA 3G71T 4JS5A 2O9VA 1GCQA 1S72Q 1ZQ1A 5HK3A 2LX9A 1VQLQ 3HRSA 2KYMA 1W2BP 3L42A 5LJ3e 2LX7A 2FL7A 1EZZB 1JJ2P 2RI2A 3REBB 3NFCA 2CP7A 1Y0MA 1KSWA 3OB9A 2JM8A 1VQ5Q 4OMLA 2FVUA 1YI2Q 4JLGA 5GAMe 5AT1B 2IG0A 4QT7A 2E5KA 5IT9E 4J9IA 2AZSA 1EIFA 3QPHA 2GQIA 2L3PA 2PQWA 3SWNA 4FYWB 1VYTA 1BBZA 1NYGA 4M7AC 4J9CA 3OS0A 1N27A 4BE1A 1JBMA 2F2WA 1CKBA 3CCJA 2K5LA 4Y92A 1UFFA 4M7DD 4RTZA 3JB9J 4RCBA 4DA4A 1K4US 2X51A 1C6VX 1QP2A 4XTZA 1NJIC 4BUGA 3FIFA 3E19A 1YP5A 1HD3A 1UTIA 1ZA1B 4OB0B 2DEUA 2DLPA 2J6FA 4JPBW 2GQVA 3VKIA 4MZMA 3NPFA 1S72A 3CXCP 3MEVA 1Q81C 4PK4A 5L23A 1K9AA 5GAOm 3G4SA 2V8IA 1PD0A 1SEMA 3G71A 2J6OA 5GAMg 2F2VA 2QI2A 3CC4Q 1F1BB 4FW1A 1I5OB 4DOVA 5KE2A 3VRZA 3HFNA 2DTOA 3QYHB 5KE3A 4MZTA 2PVGB 1VQNT 5GAMd 3PTAA 3L2WA 3FRNA 3CCRT 4AG2C 1PM3A 3JCMh 2P0KA 3BFMA 2XK0A 2RMOA 4N4GA 3CCMA 1BI3A 2KEAA 3QDRB 1JQQA 1NM7A 2LCCA 2DXCA 3CCSA 4C0ZA 1LPLA 1D1CA 2V8JA 3VUZA 5GMKi 1T0JA 3DLLA 1X75C 2EGCA 2EQJA 2YLCA 4R0KA 1TTHB 1YJNQ 1NLPC 1WLPB 1M90C 1WQWA 1VQ6Q 1M1FA 4ZGEB 4D6WA 1M90R 3OYCA 1MNEA 4C92C 3UF4A 1WX6A 2RM4A 4M78C 1J3TA 2HBWA 5KH6A 1FWZA 1P92A 2A36A 2AKKA 1YN8A 4OMFB 2DILA 4E7IA 2VV5A 3CC4A 3C12A 5A0LA 1TG0A 4FYXB 4C8QC 2CUBA 1S1NA 2EYQA 4LDVA 5FWCA 2A7YA 3UDCA 2AIRB 1N5ZA 1A0NB 4PJOB 4C5GA 4BI3A 5GAN4 3REAB 3A8LB 3OS1A 3THKA 2MI6A 4MDWA 1M2VA 3CC7Q 2GBQA 1X6GA 1M1GA 4C0FA 2CH4W 2JT4A 1R0BG 1ACMB 2DPPB 4LD9K 3CBMA 3J81E 5J3BA 3EGXA 2L2PA 4E47A 2COZA 1YIJT 3CPFA 1I5LA 2EYWA 1ZHIA 2M9UA 2EJ9A 1X2KA 5LJ3f 3JB9I 2X4XA 5CQYA 1GXIE 3OYLA 2O88A 1AZGB 3H8ZA 2GFUA 1K73U 4M78G 1PWTA 1ZLMA 2MMPA 4E7JA 1XJWB 2DJZA 2E65A 1W70A 3QXEB 1JXMA 3BE3A 3TSWA 3CMEQ 5GAN7 4IKFA 4RMOA 3TQ7P 3M56A 3MEWA 4HVWA 3HL8A 4NS5A 2DBKA 3X26B 2KVQG 1VQKQ 3FDRA 4CRIA 1ZUKA 3PGGA 3R6NA 1G3TA 4M7DA 3MO8A 2JNGA 2EYXA 2JN0A 1KHIA 1BB9A 1RI0A 1GL5A 3CBPA 5LJ5f 1TH7A 5KYUA 1PKSA 5GANj 1VQ7Q 4CI0C 4HVUA 4M77C 3CCMT 1IGUA 8ATCB 4VUBA 3I55A 3QSUA 2CGHA 2HL3A 4XTWA 2HKNA 1VQPT 3SFMA 1RAEB 1VYVA 2FHDA 1WJRA 2LQ8A 3ME9A 1WHLA 2YRDA 4J9DA 4KUIA 4RUGA 4BI8B 5IHIA 1OOTA 2ABLA 1KQ1A 2OJ2A 4QVCA 2M0YA 2KNBB 4WCIA 2A37A 1M30A 1QVGP 4GBQA 2CH4A 4IUUA 2IIMA 2DXUA 3OY9A 3OYKA 3QO3A 5HKCA 4GLKA 3MEAA 2F2XA 3LWIA 4E7KA 5FU6B 4J8OA 4OMOA 2GCXA 4WF2A 4BY6C 4M75A 5C6SA 3N5BB 1D0XA 5GMKh 2HDAA 2DXTA 3CMAT 3RIRA 5GANg 4M7DE 2CT3A 2ED0A 2C0TA 2MOXA 4OB2B 1YWOA 4AT1B 2DD4A 1B7TA 2JZ2A 5D7UA 4OB1B 1IO6A 5IN1A 3OYDA 1X43A 2KSSA 2WACA 2E3IA 4ZN1A 2FPEA 2LP5A 1U06A 2ENMA 3A1PA 1WHHA 4A4GA 4UC4A 3UATA 3M4GA 1O9SA 5HCKA 3I56A 1W4SA 2LNHB 1U8RA 5I2MA 1V1CA 1WFWA 4R55A 3RKWA 1UGPB 3VYHB 2PVDB 5DLQE 3GLXA 4F16A 2BZYA 5KCOA 2YUPA 2HQHA 4FT2A 2OTLQ 2QDLA 4K11A 1NPPA 3V7RA 2KYBA 5CIUA 2ZPGB 2JW4A 3V7SA 2BZ8A 3RDVA 2KBTA 2RHUA 4YTLA 4OMMA 3FEOA 3TREA 2RI5A 1I8FA 3EG0A 1UECA 1M8MA 1D3BA 1H3HA 3JB9G 3EFOA 2FPDA 1G5VA 2XU8A 2CP5A 2JTEA 1PD1A 1NEGA 1OX8A 5LL6S 1BIBA 3BW1A 2A3LA 2HSEB 4JRQA 3LLRA 2CP3A 3RKXA 1SG5A 1QLYA 3R6OA 1WHMA 2X3WD 1KQSP 2QQRA 3SWNC 1GBRA 3I35A 3UPUA 3M0SA 3CCLA 2DTHA 1IREB 4EPCA 1ZA2B 3QUIA 1KFZA 3CXCA 2LTOA 4PJOD 4XK8E 2FB7A 1W6XA 4OP0A 1QVGA 1PSEA 2DXBA 2A0FB 4ZGJB 1N8RU 1D3BB 1RABB 1FXXA 1I0CA 1OX9A 1YHQT 3FJ5A 3OYFA 3VS3A 4PJOF 4ORZA 2QG9B 1SSFA 2CP0A 4C92F 5KYWB 3BDUA 2FYKA 1AD5A 2CP2A 1Y96A 4EMKB 4LNPA 1TOVA 3G6EQ 2K6DA 4L5GA 5D6WA 1NZ9A 5ECAA 1O75A 1Y7XA 4A63B 2O9SA 1D0YA 2JMCA 2DL7A 1KC8U 2NWMA 4CC3A 1K9MU 2DF6A 4M78B 1ZSZA 4AFZC 2AT1B 1UJ0A 2E1HA 1QVFP 1UUEA 1M3BA 5GMKl 1PRLC 4C8QB 1B3QA 4MDXA 2ED1A 1X69A 2FEIA 4EMKA 2RA2A 3M55A 2QDYB 5LJ5j 5KYYB 3CCVQ 3A8MB 1VQPA 2KK4A 2EWNA 1AOJA 1N9RA 2XICA 2LCSA 5GMKm 3OYGA 2MWPA 2DYBA 4FIBA 3H6ZA 3NHNA 1YJWT 1PG5B 1GFDA 3I55T 1PSFA 2C0IA 4OGCA 2LJ0A 4JJBA 5KYXB 2QA4T 1YBYA 3GPLA 2L0AA 2OAUA 4HXJA 2ZPIB 4KH0B 1IB8A 3JCMJ 3X28B 5KYYA 3OYHA 2RHXA 2FRYA 1YI2A 4RG8A 2F1LA 1X6OA 1MV0B 4Z02A 3HTRA 2B8AA 4PKCC 4C8QA 4QVZA 5CVIA 3A8GB 4AFUC 3TEEA 4EDUA 1GRIA 2X4WA 3MEUA 2NUPA 3CEYA 3RBBB 1M1KC 2XDBA 2PVOB 2BUDA 3Q1JA 3UA7A 1H3ZA 2VWFA 4M75F 3RMSA 3LH0A 3M57A 1WA7A 3JCMV 1MHNA 1JJ2S 2CZ7B 4E7ZA 4N0AA 1QWFA 1N9SA 1G8XA 2YDLA 2YRCA 4MMLA 1VQOT 1TWBA 4ATOA 5GMKe 1VQ7T 4MZPA 2P4RA 4DBQA 3M0PA 3MP1A 5CKDA 4PJNA 4GY5A 3OW2A 3WVDB 3CCUQ 1QCOA 1VQKT 2OTJQ 3OS5A 4PLLA 2DVEA 1UE9A 4RCCA 4J83A 2W0ZA 2Z0WA 2NUTA 3JB9D 2K57A 3JCMe 3VS1A 1WPYA 3CC2Q 1VQ4Q 1WHKA 2XKOC 4A53A 4Z88A 8AT1B 4C5EA 3JB9F 4NL3A 2DZ9A 4KULA 2QA4A 4XQ3A 1R0CB 1I1JA 4Z89A 5LJ5h 5KYNA 5A0DA 2ZPBB 2JXBA 2QTVA 2KR3A 1QP3A 3FC3A 3CCQQ 4PJLA 3X20B 3CMET 4X9CA 1YIJQ 4N4IA 4J6WA 2DFUA 1MMAA 2W10A 1MMNA 2LQKA 3QZ5B 2YXYA 5KYWA 1WDXA 1NBEB 4XTUA 4QQDA 1UG1A 2RNAA 1FMVA 1MNDA 1PRMC 2DBMA 1SHFA 4PJJA 2LRQA 4M75D 2J05A 3VS7A 2K4YA 1DJ7B 1BI0A 1ARKA 1Q82U 1VIEA 2PUKB 1FMWA 3M59A 4J7FA 1V29B 1UB4A 1R8OB 2RB6A 1AVZC 1HYOA 2KT1A 5LJ3g 2QTXA 1I81A 4LN2A 2LJ1A 4Y91A 3MP8A 3X24B 2JM9A 2BIVA 3PT9A 5GAN3 5GMKj 2EYZA 3PMIA 4C92B 2KT8A 4IIOA 5KCHA 1JO8A 1UDLA 3NMZC 3KFVA 3QWXX 4J9BA 2HKQB 1SF9A 2J06A 2V8KA 2X35A 4C5IA 2B86A 4F7UA 2KXDA 3I56Q 1ZSZB 3FLGA 2RJEA 5GJVB 5LJ5g 1VQ8A 3L2RA 1RL2A 1KQ2A 3C4SA 7AT1B 5FW9A 4FSSA 2FZGB 5J26A 1Q81R 1H641 2CZ6B 2ZCFB 3E2UA 2GGRA 4C8QG 4II1A 1MUZA 1YJNT 4HCKA 1YJWQ 4M7DC 1AWOA 1KIKA 1HJDA 2KAFA 2ECZA 1VA7A 3EG1A 1B07A 2M16A 2DL5A 1KD1U 1K1ZA 1CKAA 4F04B 6AT1B 4ZNXA 2EAYA 3QIIA 1UEBA 2COYA 1IXDA 3OS2A 1M1KR 5FRMA 4AMCA 3S6WA 3CC7A 4A4FA 1G3SA 2E12A 2D0NA 3LX7A 3OBWA 1VYUA 1B34A 1VQ9T 5FWBA 4D8KA 3VV0A 1VQMA 1WIEA 4BE0A 1N6AA 2OI3A 2XI9A 2CP6A 3E1SA 1X2QA 2L8DA 3GF5A 4M7AG 2GNCA 2V26A 2O2OA 2C0OA 3RERA 3QWYA 5CKHA 3DB3A 2DM1A 3QJ6A 3C94A 3SEMA 4IUVA 3OYJA 1UJYA 5IHKA 2RD1A 5GANe 2I0NA 1GFCA 3PE0A 1WZOA 2RQWA 2NUPB 1VQ6T 1VQ5T 4J9GA 1ABOA 2K5IA 2KQWA 3HP9A 2E4HA 3SDZA 1YJ9A 4LDWA 3P8BB 5DLOA 3OSSC 2KRMA 3CCEQ 1M3AA 4QKUA 5GAOr 3RESA 1K8AR 2KXCA 2X4JA 1H92A 1VQ7A 2WSEE 4JS4A 2MPXC 3NTHA 4J5YA 1YCSB 2YWWA 3CPWP 4LD6A 4JZ3A 2R5MA 2VUBA 3DKMA 3JSCA 1UHCA 4ESRA 3NTKA 3MP6A 4JLIA 3CCSQ 1WYXA 4KGZB 1M90U 2R57A 3V8KA 2SEMA 2RPNA 1Q7YC 1M2VB 1NG2A 3JCMb 2EJFA 4BB7A 1OI1A 4HT8A 4PJOE 1KG1A 1VQ5A 1ZSZC 2PNIA 1Q7YR 1WJSA 1IRXA 4ELZC 2DETA 2HNIA 3EG3A 2QQAA 2OTLA 1QKXA 5IAYA 2EW3A 3M5AA 3ULRB 1K8AU 1AT1B 3SD4A 2K79A 3T9NA 4E2FB 2BE9B 5IH2A 1YITQ 4M77F 2ZGWA 2KI7A 1RACB 5LJ5d 2DL4A 1BYMA 4JJDA 1QMCA 2ZPHB 2F5TX 1BI1A 4X9DA 5GANf 3M9QA 4JZ4A 2YLBA 3KUFA 3LGLA 1M1KU 3HSBA 4KH1B 1SKUB 1YCYA 1ZSGA 5CKFA 3V8JA 1Q95G 4Y28E 1YFNA 2LNVA 5J39A 2EYYA 4C8QD 3QZ9B 2QEXQ 3H0HA 1Q7YU 1RAFB 1XQHA 1BK2A 5FRNA 2H3EB 4J7IA 1MV3A 2XIDA 4J6XA 4FM4B 1SSHA 2XHCA 4RTVA 4D8DA 2XDPA 1VQLT 4RTWA 9ATCB 4B6MA 3TCJA 3CCST 2DIQA 5FU7C 1PHTA 1M5Q1 3GP8A 2CKKA 2RQTA 2DO3A 3QG1A 4C92G 4M7DG 4C0DB 1WI7A 1X01A 3UA6A 3SB2A 1ZBJA 2JTFA 5LJ3d 4N0AC 2K2MA 3I5RA 2MCNA 1K9MR 3EFSA 4EIKA 2XG8D 5CCAA 1RAIB 4JRIA 4M7AA 4DBRA 2KRNA 4J9FA 1BIAA 3UT1A 1LJOA 3U23A 4B9WA 1YNZA 5GAMh 1VQ8T 4PJOA 2ZZDA 2QQ9A 1NEBA 1RUWA 2P4TA 1G3YA 1BCOA 4N4HA 5I2SA 1VQPQ 1AEYA 3EGXB 1OZ3A 2E70A 5GAOn 1VQ9Q 3TSZA 1KQSS 3CMAA 4KRTA 3WVEB 1BKBA 4XTVA 5GAOq 1HSQA 4M75G 4EMKC 2LDMA 3RUXA 3OYEA 4E6RA 2O4XA 4M75B 1JXOA 1VOMA 4JJCA 2D0QB 5GAN6 2R58A 2F69A 3CCJT 3VS4A 2K9GA 1FMKA 3HRTA 4KUDK 3CPWA 3ZBDA 2HCKA 1H8KA 3OYIA 1ZX6A 2YSQA 5GAMj 2DD5A 2M0OA 3INZA 1QQJA 4PJOC 2MYSA 2CYZB 3HFOA 4IURA 2QXFA 3ASKA 1W1FA 2DL8A 3LGFA 4GLMA 1M4ZA 1TU0B 2DX1A 4NL2A 5HK0A 1ZUYA 2HMAA 3MCAB 3OYYA 1OPLA 1KC8C 2CT4A 4AFSC 1RLPC 2IPOB 1JJ2A 4LDUA 3VUBA 3ZEHA 2EQUA 4A4KA 4ZGDB 4OMQA 3SWNB 4E7LA 4PNOA 1MGQA 2LT1A 3J7AF 4V2SA 2E64A 3J80E 4C8QF 4Z8AA 2KE9A 2F5KA 2SRCA 4DQ2A 5AYFA 5CR2A 4M7AD 1UHFA 1TUGB 4HKEA 3JCMP 1D0ZA 1SRLA 4XU1A 3D7SB 4IUTA 2AK5A 3CCMQ 3QHSA 3VRYA 2DVJA 2DYIA 3HPWA 2IVWA 1RI9A 2EJGA 1AZEA 2K7AA 4BDZA 1K73R 2HQEA 4IUPA 1MMGA 3M0QA 3IQLA 1FYNA 1AWJA 4ZTFA 3CD6Q 1Z9ZA 3META 2E41A 3JCMX 1BCMA 1LOJA 2RHZA 2X3XD 2G6FX 3H0IA 1U1TA 4AFQC 4LDXA 3ZL7C 3L2UA 3VU3C 5C0MA 3JCMc 2HZYA 4O5VA 1IZ6A 2ZPEB 2HBPA 2D1XA 2LQWA 1RLQC 2OAWA 2JJ9A 3VJPA 2QEXT 1W2BS 3OMGA 2NYSA 2QA4Q 1Z9QA 2D8JA 2GTJA 2RF0A 5LJ3j 2WSFE 3GNGA 1YHQA 2MWOA 2KMTA 2KDSA 1T0HA 1HK9A 1TUCA 1Q82C 2VVKA 3MJXA 2X4YA 3JCMf 4XTYA 4M7AF 1OEBA 5IXBA 3CXCS 1KHCA 2ZPFB 1PCXA 1WGSA 3JCMW 1E6GA 2BE7D 1AWXA 3QJYA 3H41A 2KY9A 1AWWA 2CS7A 1MMDA 2E3HA 2PZ1A 5A0GA 2J7IA 4P5NA 1G3WA 4LUEA 3EG2A 2CSQA 3EHQA 3X25B 2L3SA 3VYGA 2RHYA 3GOXA 4HA8A 4IIMA 2ROLA 1RAHB 5FU6C 3V8LA 2RI3A 1VQOQ 4R56A 3CC2T 1VQLA 1R77A 2PTKA 2EFIA 2CREA 2O4XB 2YHTA 1QCNA 3CCUT 1Y71A 3G7ZA 3CD6T 1WXBA 3O5ZA 5CQXA 1TSFA 3EH1A 4ELYC 4FW2A 5GANh 2DRKA 3EAEA 1Q82R 4EMGA 2DA9A 1K0SA 1VQ8Q 2JS0A 1ZBXA 4FSXA 4C0GA 2GTOA 3PIOA 2KROA 1K0XA 3KXTA 3EGDA 3CCRA 3QBYA 2EIFA 1C1AA 2EKOA 4E7SA 1VQNA 3M58A 4FCYA 3VS5A 2FPFA 2DEQA 3FB9A 3V7CA 1JB0E 3G4ST 3HHTB 3EHRA 3I55Q 5GAOl 4BD3A 4OGEA 5GAN2 1KK7A 4LUDA 1LNXA 2J6KA 4HCZA 2VXEA 2VASA 1RAGB 2FO0A 2VYTA 4X34A 2OX7A 1G2BA 4FYYB 3G71Q 1GCQC 3JCMg 3M0TA 2CZ0B 1TUDA 4OMPA 4MMKA 1LVKA 3NGPA 4A4EA 2EQIA 1XOVA 2O31A 5EG2A 4F14A 4AG1C 1OYXA 3I5SA 2VXFA 1KQSA 1OV3A 4RTTA
chains in the Genus database with same CATH topology
1BIBA 2VUBA 5FU7B 3DKMA 2RK1A 3JSCA 3BW1A 2A3LA 5CO7A 4JRQA 4F7UB 3QKJA 1YJ9T 3LLRA 3JCMQ 3NTKA 3MP6A 3A5ZB 3HKSA 3RKXA 3CCEA 1HXDA 4JLIA 3R6OA 1B34B 1M90U 1M8VA 3OQ5A 1K73C 1K9MC 2QQRA 2R57A 3SWNC 2RK2A 3MHXA 1VUBA 2PU9B 5I21A 3OYBA 4ZN3A 3KBGA 4PLIA 3V8KA 3UPUA 2JTMA 3A8OB 3CCLA 3O8VA 2HD0A 1Q7YC 3TU4K 3JCMb 3UWNA 2DTHA 1IREB 2EJFA 4BB7A 3QUIA 4ME7A 1OI1A 5DY9A 4EPCA 4TVRA 3CXCA 4HT8A 2LTOA 4PJOE 2LVMA 4XK8E 1VQ5A 3G6EA 1NJIU 1VQ6A 4PJOD 2FB7A 5FLXE 1WJSA 3BDLA 3E9GA 2QQSA 2Y90A 3PFSA 1YJWA 1YI2T 4ELZC 3G71T 2HNIA 4M78D 4JS5A 4OP0A 1QVGA 1PSEA 2DXBA 2QQAA 1KD1C 4ZGJB 4BACA 1ZQ1A 3OBYA 1N8RU 5HK3A 2LX9A 1D3BB 2OTLA 1FXXA 4KT0E 5IAYA 4JDSA 4HCCA 5L8RE 4M78F 3M5AA 4XU2A 1K8AU 2VC8A 4C0DC 3SD4A 3HRSA 1YHQT 3OYFA 4PJOF 2K5FA 1SSFA 3L42A 3T9NA 5LJ3e 4C92F 2FL7A 5GAOp 4M77F 2RI2A 5CKEA 1VQ9A 2ZGWA 2FYKA 3BDUA 3NFCA 2PUOB 5LJ5d 2K2VA 1BYMA 4EMKB 1Y96A 3OB9A 2RH2A 3CCET 4L5GA 5D6WA 2FVUA 1S72T 2ZPHB 2F5TX 1BI1A 1NZ9A 4X9DA 4JLGA 4M78E 5GAMe 5GANf 1O75A 2IG0A 3M9QA 2YLBA 1Y7XA 5IT9E 1VQMT 3KUFA 3LGLA 1EIFA 3QPHA 1M1KU 3HSBA 4M7AE 2PQWA 1YCYA 3SWNA 5CKFA 4M7AC 3LW5E 4EMHA 3L2QA 3OS0A 1N27A 3V8JA 1KC8U 4BE1A 1JBMA 4Y28E 2LNVA 1K9MU 5J39A 3CCJA 2K5LA 2DIGA 3DB4A 5DM7R 3S3NA 2HAXA 4M7DD 3JB9J 2E6ZA 4RCBA 4M78B 4C8QD 3QZ9B 4DA4A 2E1HA 1Q7YU 3JB9H 1XQHA 3C95A 5FRNA 4J7IA 1QP2A 4JUVA 4J6XA 2XIDA 4XTZA 4FM4B 1NJIC 1WNLA 2XHCA 1M9SA 2NLUA 2XDPA 3FIFA 4BUGA 1VQLT 3E19A 3RKYA 5GMKl 4HCBA 4C8QB 4OB0B 1OZ2A 3TCJA 3CCST 2DIQA 5FU7C 4MDXA 4M7DB 1M5Q1 3GP8A 4EMKA 2CKKA 2RA2A 3VKIA 2GQVA 4MZMA 2DO3A 3QG1A 2Y4YA 4C92G 4F7UE 1S72A 1Q81C 3MEVA 4M7DG 4C0DB 3M55A 3OYMA 2QDYB 5CKBA 5LJ5j 5GAOm 2OTLT 1X01A 3G4SA 3A8MB 1VQPA 2KK4A 2EWNA 3GIBA 2XICA 1N9RA 2V8IA 3P8DA 4JRKA 3SB2A 5GMKm 3OYGA 2MWPA 2HQXA 2JTFA 5LJ3d 4FIBA 3H6ZA 4N0AC 2D9TA 1WQ7A 3G71A 1YJWT 5GAMg 4C8QE 2QI2A 2XDDA 3I55T 1PSFA 4OGCA 3EFSA 2RO0A 2QA4T 4NOYA 1YBYA 3GPLA 2XG8D 4XAXB 2OAUA 4JRIA 4DOVA 2ZPIB 2E6NA 2RJDA 3L2ZA 4M78A 5CCAA 5KE2A 1YITT 3HFNA 3CCLT 2D6FA 1BIAA 2DTOA 3QYHB 4O6JA 5KE3A 3UT1A 1W2BA 4MZTA 1LJOA 2PVGB 3ER0A 4B9WA 5GAMd 5GAMh 2E5QA 3X28B 3PTAA 3OYHA 3L2WA 2ZZDA 3OSVA 2L3RA 2RHXA 2QQ9A 3OYNA 1VQ8T 4PJOA 1YI2A 3F70A 2P4TA 1G3YA 3FRNA 3CPWS 4RG8A 3CCRT 1UGQB 1X6OA 4Z02A 3JCMd 3JCMh 2P0KA 4N4HA 3BFMA 5I2SA 2B8AA 2XK0A 3PNWC 4PKCC 3CCVA 4N4GA 4C8QA 3LYIA 1BI3A 3QDRB 4QVZA 3A8GB 5CVIA 3CCMA 4JJNK 2LCCA 5HY6A 3TEEA 3PMTA 1OZ3A 2E70A 2DXCA 3CCSA 4EDUA 5GAOn 4C0ZA 2GF7A 1KQSS 3CMAA 3WVEB 1Q81U 2X4WA 2V8JA 3VUZA 1BKBA 4XTVA 5GAOq 3MEUA 5GMKi 4M75G 3CEYA 3DLLA 1M1KC 1X75C 4EMKC 3CD6A 2XDBA 2LDMA 2EQJA 3RUXA 2YLCA 2PVOB 2BUDA 3Q1JA 3OYEA 1H3ZA 2O4XA 3CCUA 3CCQA 4M75F 4M75B 3RMSA 5GAN5 3LH0A 3M57A 2OTJA 3JCMV 1M90C 1UGRB 1WQWA 1MHNA 2D0QB 2DTIA 2EQKA 5GAN6 1M1FA 2CZ7B 2F69A 2R58A 1JJ2S 4ZGEB 2OTJT 4N0AA 3CCJT 4D6WA 1N9SA 3HRTA 3OYCA 4MMLA 1VQOT 4KUDK 4ATOA 2EQMA 3CPWA 3RMQA 5GMKe 1VQ7T 3ZBDA 4C92C 4MZPA 2RM4A 4M7AA 4M78C 4JRPA 3OYIA 5KH6A 1FWZA 5GAMj 1P92A 2DD5A 2M0OA 3INZA 4PJOC 3MP1A 5CKDA 4OMFB 4E7IA 2CYZB 4GY5A 2VV5A 3OW2A 3CC4A 2G3RA 4M77B 3HFOA 4C92D 3WVDB 4IURA 3C12A 1VQKT 5A0LA 2QXFA 3ASKA 3LGFA 3OS5A 4PLLA 4C8QC 1M4ZA 2DVEA 4RCCA 4NL2A 5HK0A 2EYQA 3MCAB 4J83A 3OYYA 4LDVA 2R5AA 3JB9D 2K57A 4DOWA 3JCMe 1KC8C 1WPYA 2A7YA 3UDCA 2XKOC 3OMCA 4A53A 4C5EA 1JJ2A 3JB9F 2M1HA 4QQ6A 4NL3A 4C5GA 4LDUA 3VUBA 4BI3A 4PJOB 5GAN4 2DZ9A 4KULA 2QA4A 3A8LB 3OS1A 3I56T 2MI6A 2P0PA 3QYGB 2EQUA 4MDWA 4XQ3A 3ZEHA 5LJ5h 4A4KA 4ZGDB 5A0DA 2ZPBB 3SWNB 4E7LA 2K3XA 5D6YA 2QEXA 1M1GA 4PNOA 5D6XA 4C0FA 1MGQA 2LT1A 4OB3B 1QP3A 3J7AF 4E7HA 3FC3A 4V2SA 2E64A 4XU0A 2DPPB 4C8QF 3J80E 3X20B 3CBMA 3J81E 4LD9K 5J3BA 3CMET 4X9CA 3WXMB 1VQNT 4N4IA 4J6WA 1UGSB 4E47A 2XD0A 5CR2A 2F5KA 4DQ2A 4C92A 5AYFA 4M7AD 1Y96B 2RJFA 2VGMA 1YIJT 4HKEA 2LQKA 2K3YA 3JCMP 4M77A 1KG1A 4XU1A 3QZ5B 1VQ4A 1QVGS 4IUTA 3CPFA 1I5LA 3OA6A 1ZHIA 2WSCE 3E9FA 2M9UA 2EJ9A 3QHSA 3A8HB 4XTUA 5M9OA 5LJ3f 1VQOA 4QQDA 1VQKA 3HPWA 2IVWA 3GNFB 3JB9I 2X4XA 2EJGA 2O01E 2LRQA 5CQYA 4PL6A 4BDZA 1GXIE 1Q86U 3OYLA 4M75D 2LC4A 2HQEA 2K4YA 3H8ZA 3OYAA 4IUPA 2GFUA 1K73U 4M78G 1DJ7B 4ZTFA 1BI0A 3META 2MMPA 4E7JA 1Q82U 2DJZA 1VIEA 2E65A 2JUFA 2PUKB 3QXEB 2E41A 4B9XA 3M59A 4J7FA 1V29B 4PJOG 1UB4A 3JCMX 1BI2A 1R8OB 2RB6A 2LCLA 5GAN7 4RMOA 1YJNA 3P8HA 4IKFA 5FROA 1LOJA 5LJ3g 3PIPA 2MAMA 2QTXA 3M56A 1I81A 3EFRA 4HT9A 3MEWA 4Y91A 2RHZA 3HL8A 1VQ4T 4NS5A 2E10A 3MP8A 3X24B 1U1TA 3X26B 4F7UG 4LDXA 2KVQG 2BIVA 3PT9A 3FDRA 4CRIA 3L2UA 3VU3C 5C0MA 3HRUA 3JCMc 4QW2A 5GAN3 3PGGA 3PMIA 5GMKj 4C92B 5KCHA 1QVFA 4O5VA 1G3TA 1IZ6A 4RG2A 4M7DA 3MO8A 2ZPEB 2JNGA 2HBPA 4M75E 2JN0A 1KHIA 1RI0A 3CBPA 5LJ5f 3VJPA 2QEXT 1W2BS 1TH7A 3OMGA 2V8KA 2DZCA 2X35A 1U1SA 4C5IA 5GANj 2L89A 2QQBA 2VGNA 1Y07A 5LJ3j 4F7UA 2WSFE 2C06A 3GNGA 2DKGA 1YHQA 4CI0C 4M77C 3CCMT 2MWOA 4M77E 3FLGA 2JVVA 2KMTA 3S3OA 4C92E 2KDSA 4QVDA 4VUBA 3I55A 2RJEA 1HK9A 5CK9A 2Y4XA 5LJ5g 1Q82C 3QSUA 2CGHA 2YRVA 4BY6B 1VQ8A 4XTWA 1WJQA 2X4YA 3JCMf 4L6V5 3L2RA 4XTYA 1RL2A 3SFMA 1VQPT 3G6ET 3DLMA 1KQ2A 2FHDA 1WJRA 2I2LA 3C4SA 4M7AF 2LQ8A 3ME9A 3CXCS 1KHCA 2ZPFB 4KUIA 4LDYA 1Q86C 1WGSA 3NTIA 3JCMW 4BI8B 5J26A 1H641 1KQ1A 2CZ6B 2DAQA 2ZCFB 4QVCA 3M4YA 3QJYA 4FT4A 2KY9A 4C8QG 4II1A 2CS7A 4IUUA 1YJNT 5A0GA 4P5NA 2DXUA 3OY9A 2GFAA 1G3WA 2RHIA 3CC7T 3X25B 3OYKA 5GANd 3VYGA 4M7DC 3M53A 3QO3A 2RHYA 5HKCA 3GOXA 4GLKA 4M7AB 2KAFA 4HA8A 3MEAA 3V8LA 5FU6C 3LWIA 4E7KA 5FU6B 4A4HA 2RI3A 4FU6A 2JOYA 4J8OA 2M16A 4R56A 3CC2T 2GCXA 4IUQA 4OF1A 1KD1U 1VQLA 1NPRA 4RKUE 2BKDN 4WF2A 3CC2A 1AHJB 2EFIA 4BY6C 3S3MA 4M75A 2EAYA 3CBOA 5C6SA 1XNIA 3N5BB 2O4XB 3QIIA 2YHTA 1UEBA 2L5QA 5GMKh 3OS2A 5A2QE 2DXTA 3CMAT 3RIRA 4FL6A 5GANg 5FRMA 4M7DE 3CCUT 3S6WA 3CMEA 3CC7A 4A4FA 1Y71A 1G3SA 3G7ZA 3URGA 2E12A 3LX7A 3CD6T 3ZFJA 4OB2B 5CQXA 4M7DF 2DD4A 3OBWA 4ELYC 3JRZA 3CCVT 1B34A 2JZ2A 1VQ9T 4OB1B 5GANh 3EAEA 4XTXA 3VV0A 4EMGA 5IN1A 3OYDA 1YIJA 1VQMA 2KSSA 2WACA 4BE0A 1N6AA 2AHJB 4ZN1A 4F7UF 1NE8A 4A4GA 2XI9A 4L59A 1ZBXA 4KBMB 2LT4A 4FSXA 4C0GA 3E1SA 4UC4A 4BI4A 5LJ3h 1I4K1 2L8DA 3M4GA 3PIOA 3GF5A 3KXTA 3CCRA 3QBYA 1JRIA 4M7AG 1O9SA 2EIFA 4ZTJA 3AHUA 4XU3A 2EKOA 1FX7A 3CCQT 1VQNA 3M58A 1W4SA 3I56A 3RERA 1U8RA 5CKHA 4C5HA 1YITA 3DB3A 3QJ6A 5I2MA 2DEQA 3C94A 3FB9A 1JB0E 3V7CA 3L1AA 3RKWA 4R55A 3G4ST 3HHTB 4IUVA 3OW2S 3JAME 3OYJA 3CC4T 1UGPB 5GAOl 3VYHB 2RD1A 4BD3A 5GANe 5GAMf 2PVDB 3GLXA 4Q5WA 3FJPA 5DLQE 5KCOA 4M75C 3L2VA 3M54A 4OVAA 4OGEA 1QVPA 4FT2A 5GAN2 1LNXA 4HCZA 1VQ6T 1NPPA 1VQ5T 1QVFS 2VXEA 3JCMJ 4BE2A 3V7RA 2K5IA 5CIUA 2ZPGB 2KQWA 3HP9A 3V7SA 2VYTA 3SDZA 5GAN8 1YJ9A 4J6YA 2CZ1B 4LDWA 3BY7A 3P8BB 2RHUA 4X34A 3OSSC 1QW1A 4YTLA 4M77G 5DLOA 3LWHA 1K8AC 3FEOA 2H3JA 2RI5A 3JCMg 3TREA 1XTDA 1I8FA 4BDYA 2CZ0B 4MMKA 5GAOr 1D3BA 3RESA 3JB9G 2MF2A 2X4JA 4A4EA 1XOVA 4A54A 2RJCA 5EG2A 2P0QA 5LJ5e 4QQGA 1VQ7A 5CAIA 2WSEE 4M77D 1N8RC 4JS4A 1OYXA 2DK3A 2XU8A 1G5VA 3NTHA 1VIFA 4J5YA 2VXFA 1KQSA 4LD6A 5LL6S 2R5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OY9 A;  2GFA A;  2RHI A;  3OYK A;  4E7L A;  2K3X A;  5D6Y A;  3P8D A;  3QKJ A;  2RHY A;  5D6X A;  3LLR A;  3OYG A;  2MWP A;  2HQX A;  2JTF A;  3GOX A;  3H6Z A;  3NTK A;  2D9T A;  3FC3 A;  3MEA A;  4E7H A;  3MP6 A;  4E7K A;  4A4H A;  2RI3 A;  4FU6 A;  2RO0 A;  4N4I A;  2M16 A;  3OQ5 A;  4IUQ A;  2F5K A;  2QQR A;  2R57 A;  3OYB A;  2RJF A;  2BKD N;  5KE2 A;  2E6N A;  2RJD A;  2EFI A;  2K3Y A;  4PLI A;  3S3M A;  5C6S A;  5KE3 A;  1XNI A;  3UT1 A;  2O4X B;  4IUT A;  4B9W A;  3QII A;  2E5Q A;  3OA6 A;  3L2W A;  3OYH A;  3E9F A;  3O8V A;  5M9O A;  2L3R A;  2RHX A;  3OS2 A;  3OYN A;  3UWN A;  3F70 A;  4QQD A;  1OI1 A;  4FL6 A;  5FRM A;  2X4X A;  4Z02 A;  2LTO A;  2LVM A;  3S6W A;  2LRQ A;  2P0K A;  1WJS A;  3BDL A;  3E9G A;  2QQS A;  4N4H A;  4PL6 A;  2B8A A;  2XK0 A;  3LX7 A;  3PNW C;  4A4F A;  3OYL A;  3PFS A;  2HQE A;  3H8Z A;  3OYA A;  4IUP A;  4N4G A;  2GFU A;  3LYI A;  4QVZ A;  4BAC A;  4ZTF A;  2JZ2 A;  2LCC A;  3MET A;  4E7J A;  3PMT A;  4B9X A;  3EAE A;  1OZ3 A;  5IAY A;  4EDU A;  5IN1 A;  3OYD A;  2GF7 A;  2WAC A;  4BE0 A;  4IKF A;  3P8H A;  5FRO A;  3SD4 A;  2X4W A;  3MEU A;  4A4G A;  3OYF A;  3MEW A;  3CEY A;  2RHZ A;  4L59 A;  1SSF A;  3L42 A;  2LDM A;  4NS5 A;  4UC4 A;  2EQJ A;  2L8D A;  2BUD A;  3Q1J A;  3MP8 A;  3OYE A;  1H3Z A;  2O4X A;  2RI2 A;  2BIV A;  3QBY A;  3FDR A;  4CRI A;  3LH0 A;  3L2U A;  5C0M A;  3OYM A;  4ZTJ A;  4QW2 A;  3OB9 A;  3PMI A;  5KCH A;  2EKO A;  1MHN A;  4RG2 A;  2EQK A;  5D6W A;  2R58 A;  3MO8 A;  1RI0 A;  4C5H A;  3DB3 A;  3QJ6 A;  3M9Q A;  2IG0 A;  3OMG A;  3OYC A;  2X35 A;  3KUF A;  3LGL A;  4C5I A;  4IUV A;  2EQM A;  2L89 A;  3OYJ A;  2PQW A;  4BD3 A;  4Q5W A;  3L2Q A;  3OS0 A;  1N27 A;  5KCO A;  3OYI A;  2MWO A;  5KH6 A;  3L2V A;  4OVA A;  2M0O A;  4BE1 A;  3FLG A;  3S3O A;  4HCZ A;  5J39 A;  3MP1 A;  4E7I A;  2DIG A;  3DB4 A;  4BE2 A;  3S3N A;  4GY5 A;  2RJE A;  2G3R A;  5CIU A;  4IUR A;  2YRV A;  2VYT A;  3ASK A;  1WJQ A;  2X4Y A;  3LGF A;  2RHU A;  4X34 A;  3L2R A;  4PLL A;  5FRN A;  3DLM A;  3FEO A;  2RI5 A;  2FHD A;  1WJR A;  3C4S A;  4BDY A;  3ME9 A;  4BDZ A;  2NLU A;  1KHC A;  2R5A A;  2XDP A;  1WGS A;  3NTI A;  4A4E A;  2RJC A;  5J26 A;  2DAQ A;  4QQG A;  3OMC A;  1OZ2 A;  2DIQ A;  3ZEH A;  4C5E A;  1OYX A;  1G5V A;  2M1H A;  4QQ6 A;  4C5G A;  3NTH A;  2CKK A;  3OS1 A;  4II1 A;  4LD6 A;  4IUU A;  3MEV A;  2R5M A;  2EQU A; 
#chains in the Genus database with same CATH topology
 1RAA B;  3EH2 A;  5FU7 B;  4F7U B;  3JCM Q;  2NUT B;  3CCJ Q;  3A5Z B;  3HKS A;  3CCE A;  1B34 B;  3RNJ A;  1M3C A;  1IHW A;  1E6H A;  1K73 C;  1K9M C;  1SRM A;  1OPK A;  2RK2 A;  1VUB A;  2PU9 B;  3MHX A;  2QGG A;  4ZN3 A;  1EX4 A;  4PLI A;  1VQN Q;  3O8V A;  2HD0 A;  3I9Q A;  4CC4 B;  4ME7 A;  5DY9 A;  4TVR A;  2AKL A;  1VQ6 A;  3RR6 A;  5FLX E;  3E9G A;  2Y90 A;  2MK5 A;  3PFS A;  1YJW A;  1YI2 T;  2YUQ A;  4M78 D;  1KD1 C;  4BAC A;  3OBY A;  5KYX A;  4F17 A;  4HCC A;  4KT0 E;  3G4S Q;  4JDS A;  5L8R E;  4M78 F;  2DNU A;  4XU2 A;  2VC8 A;  4C0D C;  1EFN A;  5IXF A;  2K5F A;  1YWP A;  2CUD A;  5GAO p;  1G83 A;  5CKE A;  1VQ9 A;  3CMA Q;  2PUO B;  2K2V A;  3LH5 A;  2RH2 A;  3CCE T;  1TS9 A;  1S72 T;  1LCK A;  4KGX B;  4M78 E;  1WXU A;  1VQM T;  4M7A E;  3MKD A;  1VQM Q;  3LW5 E;  4EMH A;  3L2Q A;  2DE0 X;  1IGQ A;  4LXC A;  2FZK B;  2DIG A;  3DB4 A;  5DM7 R;  3S3N A;  2HAX A;  2E6Z A;  2D8H A;  3JB9 H;  3C95 A;  4JUV A;  3QDF A;  4KGV B;  4X1V A;  3H0F A;  1WNL A;  1M9S A;  2NLU A;  4DEX A;  2L3Q A;  3RKY A;  4ANJ A;  4HCB A;  1OZ2 A;  1Y57 A;  4M7D B;  1TXQ A;  2Y4Y A;  4F7U E;  3OYM A;  5CKB A;  2OTL T;  4M4Z A;  3GIB A;  3EG9 A;  3P8D A;  4JRK A;  1YJ9 Q;  2HQX A;  2D9T A;  1WQ7 A;  4C8Q E;  5IHN A;  4CC2 A;  2XDD A;  5I11 A;  4J9E A;  1UGV A;  2RO0 A;  4NOY A;  4OMN A;  4XAX B;  2E6N A;  2RJD A;  3L2Z A;  4M78 A;  1YIT T;  2D6F A;  3CCL T;  1W2B A;  4O6J A;  2ROT A;  3ER0 A;  3EGD B;  3CCQ A;  2E5Q A;  3OSV A;  2L3R A;  3G1J A;  3OYN A;  3F70 A;  3CPW S;  1I07 A;  1UGQ B;  2RQU A;  3JCM d;  3PNW C;  3CCV A;  2EVR A;  2A28 A;  3LYI A;  4JJN K;  5HY6 A;  1U3O A;  3PMT A;  1C0M A;  2GF7 A;  2VKN A;  1Q81 U;  1WXT A;  3CD6 A;  2EPD A;  1KJW A;  1NLO C;  3CCU A;  5GAN 5;  2OTJ A;  1D1B A;  2H8H A;  1UGR B;  1QCF A;  2ATC B;  2DTI A;  2EQK A;  2OTJ T;  2JS2 A;  2DL3 A;  1KD1 R;  2EQM A;  3RMQ A;  1JU5 C;  4JRP A;  1CSK A;  2QAS A;  1OQK A;  3C0C A;  2HEQ A;  2G3R A;  4M77 B;  4C92 D;  2BTT A;  1PKT A;  2K3B A;  1SPK A;  3AT1 B;  2LZ6 B;  3M0U A;  2R5A A;  4DOW A;  4PFO A;  3OMC A;  3OW2 P;  2M1H A;  4QQ6 A;  1T3L A;  2BZX A;  2M02 A;  3I56 T;  1X6B A;  2P0P A;  2ZAE A;  2EBP A;  3M0R A;  3QYG B;  1OUL A;  2K3X A;  5D6Y A;  2QEX A;  5D6X A;  4OB3 B;  4E7H A;  4XU0 A;  3WXM B;  1UGS B;  2XD0 A;  4C92 A;  1Y96 B;  2RJF A;  2VGM A;  2K3Y A;  4M77 A;  1VQ4 A;  1QVG S;  3OA6 A;  2M51 A;  3E9F A;  2RQR A;  2WSC E;  5M9O A;  1VQK A;  3A8H B;  1VQO A;  4DBH A;  2QYZ A;  3GNF B;  3VS6 A;  2O01 E;  4RTX A;  4PL6 A;  1Q86 U;  2LC4 A;  3JV3 A;  3OYA A;  2JUF A;  4B9X A;  4PJO G;  2YUN A;  1BI2 A;  1YJN A;  2LCL A;  4J9H A;  3VS2 A;  3P8H A;  1M27 C;  5FRO A;  3PIP A;  2MAM A;  2ESW A;  3EFR A;  4HT9 A;  1VQ4 T;  1RAD B;  2E10 A;  4F7U G;  1GBQ A;  3PVL A;  3HRU A;  4QW2 A;  1QVF A;  4RG2 A;  1E7O A;  4M75 E;  2FG0 A;  2DZC A;  1U1S A;  2YUO A;  2L89 A;  2QQB A;  2VGN A;  2XMF A;  1Y07 A;  2C06 A;  2DKG A;  2EKH A;  4M77 E;  1WHJ A;  2JVV A;  3S3O A;  4C92 E;  4QVD A;  2X9H A;  2LJ3 A;  5CK9 A;  2Y4X A;  2YRV A;  4BY6 B;  3EFO B;  1WJQ A;  2COW A;  4L6V 5;  1Q86 R;  3MPU B;  3G6E T;  3DLM A;  2I2L A;  4LDY A;  1Q86 C;  4RTU A;  3NTI A;  1BU1 A;  2DAQ A;  2MIO A;  3CCL Q;  3M4Y A;  1OU9 A;  4FT4 A;  2QK0 A;  1QKW A;  1K76 A;  2GFA A;  2RHI A;  3CC7 T;  4HVV A;  5GJW B;  5GAN d;  3M53 A;  4M7A B;  2DER A;  4A4H A;  4FU6 A;  2JOY A;  4IUQ A;  4OF1 A;  4PJM A;  1NPR A;  4RKU E;  2BKD N;  2DRM A;  1AHJ B;  3CC2 A;  2NUZ A;  3S3M A;  3CBO A;  1XNI A;  2DJQ A;  2YT6 A;  2L5Q A;  2LMJ A;  5A2Q E;  4FL6 A;  1JEG A;  1X27 A;  2RQV A;  4WTO B;  4CC7 A;  3CME A;  1NJI R;  3URG A;  1GCP A;  3A98 A;  3ZFJ A;  1OU8 A;  2AZV A;  4M7D F;  2DMO A;  2JMA A;  1N8R R;  5KYU B;  3JRZ A;  3CCV T;  3EGU A;  4XTX A;  2V1R A;  1YIJ A;  2AHJ B;  3PVQ A;  3VS0 A;  4F7U F;  1NE8 A;  4L59 A;  4KBM B;  2LT4 A;  2FZC B;  4BI4 A;  5LJ3 h;  1I4K 1;  1M2O A;  1JRI A;  4DEY A;  3H9N A;  4ZTJ A;  3AHU A;  4XU3 A;  1FX7 A;  3CCQ T;  2VB6 A;  4C5H A;  1D09 B;  1YIT A;  1ZUU A;  3L1A A;  1D1A A;  2HSP A;  3OW2 S;  2A08 A;  3JAM E;  3EG9 B;  3CC4 T;  5EC7 A;  2RN8 A;  5GAM f;  4Q5W A;  1V76 A;  3FJP A;  2EGA A;  4M75 C;  3L2V A;  3M54 A;  4OVA A;  1QVP A;  1U5S A;  4DBF A;  1PC0 A;  1T3S A;  1QVF S;  4BE2 A;  1NYF A;  1WHG A;  1IHV A;  2V1Q A;  4PFP A;  5GAN 8;  4J6Y A;  2CZ1 B;  3CCR Q;  3BY7 A;  2P84 A;  3LWH A;  1QW1 A;  1K8A C;  4M77 G;  2H3J A;  4BDY A;  1XTD A;  2MF2 A;  2QAZ A;  3TVT A;  4A54 A;  2RJC A;  1PNJ A;  2P0Q A;  4QQG A;  5LJ5 e;  5CAI A;  3SHW A;  4M77 D;  1N8R C;  2QGF B;  1YHQ Q;  2DK3 A;  2HL5 C;  4RTY A;  1VIF A;  3GBQ A;  2CDT A;  1QWE A;  4LE9 A;  2LQN A;  2RK1 A;  5I22 A;  5CO7 A;  2EGE A;  3QKJ A;  1YJ9 T;  1KC8 R;  4FYV B;  1HXD A;  1M8V A;  2KRS A;  1SHG A;  3OQ5 A;  5I21 A;  3OYB A;  4PFZ A;  2FRW A;  3KBG A;  2JTM A;  3A8O B;  3TU4 K;  3CQT A;  3UWN A;  2KGT A;  2LVM A;  1ABQ A;  3G6E A;  1NJI U;  3BDL A;  2QQS A;  2CSI A;  3G71 T;  4JS5 A;  2O9V A;  1GCQ A;  1S72 Q;  1ZQ1 A;  5HK3 A;  2LX9 A;  1VQL Q;  3HRS A;  2KYM A;  1W2B P;  3L42 A;  5LJ3 e;  2LX7 A;  2FL7 A;  1EZZ B;  1JJ2 P;  2RI2 A;  3REB B;  3NFC A;  2CP7 A;  1Y0M A;  1KSW A;  3OB9 A;  2JM8 A;  1VQ5 Q;  4OML A;  2FVU A;  1YI2 Q;  4JLG A;  5GAM e;  5AT1 B;  2IG0 A;  4QT7 A;  2E5K A;  5IT9 E;  4J9I A;  2AZS A;  1EIF A;  3QPH A;  2GQI A;  2L3P A;  2PQW A;  3SWN A;  4FYW B;  1VYT A;  1BBZ A;  1NYG A;  4M7A C;  4J9C A;  3OS0 A;  1N27 A;  4BE1 A;  1JBM A;  2F2W A;  1CKB A;  3CCJ A;  2K5L A;  4Y92 A;  1UFF A;  4M7D D;  4RTZ A;  3JB9 J;  4RCB A;  4DA4 A;  1K4U S;  2X51 A;  1C6V X;  1QP2 A;  4XTZ A;  1NJI C;  4BUG A;  3FIF A;  3E19 A;  1YP5 A;  1HD3 A;  1UTI A;  1ZA1 B;  4OB0 B;  2DEU A;  2DLP A;  2J6F A;  4JPB W;  2GQV A;  3VKI A;  4MZM A;  3NPF A;  1S72 A;  3CXC P;  3MEV A;  1Q81 C;  4PK4 A;  5L23 A;  1K9A A;  5GAO m;  3G4S A;  2V8I A;  1PD0 A;  1SEM A;  3G71 A;  2J6O A;  5GAM g;  2F2V A;  2QI2 A;  3CC4 Q;  1F1B B;  4FW1 A;  1I5O B;  4DOV A;  5KE2 A;  3VRZ A;  3HFN A;  2DTO A;  3QYH B;  5KE3 A;  4MZT A;  2PVG B;  1VQN T;  5GAM d;  3PTA A;  3L2W A;  3FRN A;  3CCR T;  4AG2 C;  1PM3 A;  3JCM h;  2P0K A;  3BFM A;  2XK0 A;  2RMO A;  4N4G A;  3CCM A;  1BI3 A;  2KEA A;  3QDR B;  1JQQ A;  1NM7 A;  2LCC A;  2DXC A;  3CCS A;  4C0Z A;  1LPL A;  1D1C A;  2V8J A;  3VUZ A;  5GMK i;  1T0J A;  3DLL A;  1X75 C;  2EGC A;  2EQJ A;  2YLC A;  4R0K A;  1TTH B;  1YJN Q;  1NLP C;  1WLP B;  1M90 C;  1WQW A;  1VQ6 Q;  1M1F A;  4ZGE B;  4D6W A;  1M90 R;  3OYC A;  1MNE A;  4C92 C;  3UF4 A;  1WX6 A;  2RM4 A;  4M78 C;  1J3T A;  2HBW A;  5KH6 A;  1FWZ A;  1P92 A;  2A36 A;  2AKK A;  1YN8 A;  4OMF B;  2DIL A;  4E7I A;  2VV5 A;  3CC4 A;  3C12 A;  5A0L A;  1TG0 A;  4FYX B;  4C8Q C;  2CUB A;  1S1N A;  2EYQ A;  4LDV A;  5FWC A;  2A7Y A;  3UDC A;  2AIR B;  1N5Z A;  1A0N B;  4PJO B;  4C5G A;  4BI3 A;  5GAN 4;  3REA B;  3A8L B;  3OS1 A;  3THK A;  2MI6 A;  4MDW A;  1M2V A;  3CC7 Q;  2GBQ A;  1X6G A;  1M1G A;  4C0F A;  2CH4 W;  2JT4 A;  1R0B G;  1ACM B;  2DPP B;  4LD9 K;  3CBM A;  3J81 E;  5J3B A;  3EGX A;  2L2P A;  4E47 A;  2COZ A;  1YIJ T;  3CPF A;  1I5L A;  2EYW A;  1ZHI A;  2M9U A;  2EJ9 A;  1X2K A;  5LJ3 f;  3JB9 I;  2X4X A;  5CQY A;  1GXI E;  3OYL A;  2O88 A;  1AZG B;  3H8Z A;  2GFU A;  1K73 U;  4M78 G;  1PWT A;  1ZLM A;  2MMP A;  4E7J A;  1XJW B;  2DJZ A;  2E65 A;  1W70 A;  3QXE B;  1JXM A;  3BE3 A;  3TSW A;  3CME Q;  5GAN 7;  4IKF A;  4RMO A;  3TQ7 P;  3M56 A;  3MEW A;  4HVW A;  3HL8 A;  4NS5 A;  2DBK A;  3X26 B;  2KVQ G;  1VQK Q;  3FDR A;  4CRI A;  1ZUK A;  3PGG A;  3R6N A;  1G3T A;  4M7D A;  3MO8 A;  2JNG A;  2EYX A;  2JN0 A;  1KHI A;  1BB9 A;  1RI0 A;  1GL5 A;  3CBP A;  5LJ5 f;  1TH7 A;  5KYU A;  1PKS A;  5GAN j;  1VQ7 Q;  4CI0 C;  4HVU A;  4M77 C;  3CCM T;  1IGU A;  8ATC B;  4VUB A;  3I55 A;  3QSU A;  2CGH A;  2HL3 A;  4XTW A;  2HKN A;  1VQP T;  3SFM A;  1RAE B;  1VYV A;  2FHD A;  1WJR A;  2LQ8 A;  3ME9 A;  1WHL A;  2YRD A;  4J9D A;  4KUI A;  4RUG A;  4BI8 B;  5IHI A;  1OOT A;  2ABL A;  1KQ1 A;  2OJ2 A;  4QVC A;  2M0Y A;  2KNB B;  4WCI A;  2A37 A;  1M30 A;  1QVG P;  4GBQ A;  2CH4 A;  4IUU A;  2IIM A;  2DXU A;  3OY9 A;  3OYK A;  3QO3 A;  5HKC A;  4GLK A;  3MEA A;  2F2X A;  3LWI A;  4E7K A;  5FU6 B;  4J8O A;  4OMO A;  2GCX A;  4WF2 A;  4BY6 C;  4M75 A;  5C6S A;  3N5B B;  1D0X A;  5GMK h;  2HDA A;  2DXT A;  3CMA T;  3RIR A;  5GAN g;  4M7D E;  2CT3 A;  2ED0 A;  2C0T A;  2MOX A;  4OB2 B;  1YWO A;  4AT1 B;  2DD4 A;  1B7T A;  2JZ2 A;  5D7U A;  4OB1 B;  1IO6 A;  5IN1 A;  3OYD A;  1X43 A;  2KSS A;  2WAC A;  2E3I A;  4ZN1 A;  2FPE A;  2LP5 A;  1U06 A;  2ENM A;  3A1P A;  1WHH A;  4A4G A;  4UC4 A;  3UAT A;  3M4G A;  1O9S A;  5HCK A;  3I56 A;  1W4S A;  2LNH B;  1U8R A;  5I2M A;  1V1C A;  1WFW A;  4R55 A;  3RKW A;  1UGP B;  3VYH B;  2PVD B;  5DLQ E;  3GLX A;  4F16 A;  2BZY A;  5KCO A;  2YUP A;  2HQH A;  4FT2 A;  2OTL Q;  2QDL A;  4K11 A;  1NPP A;  3V7R A;  2KYB A;  5CIU A;  2ZPG B;  2JW4 A;  3V7S A;  2BZ8 A;  3RDV A;  2KBT A;  2RHU A;  4YTL A;  4OMM A;  3FEO A;  3TRE A;  2RI5 A;  1I8F A;  3EG0 A;  1UEC A;  1M8M A;  1D3B A;  1H3H A;  3JB9 G;  3EFO A;  2FPD A;  1G5V A;  2XU8 A;  2CP5 A;  2JTE A;  1PD1 A;  1NEG A;  1OX8 A;  5LL6 S;  1BIB A;  3BW1 A;  2A3L A;  2HSE B;  4JRQ A;  3LLR A;  2CP3 A;  3RKX A;  1SG5 A;  1QLY A;  3R6O A;  1WHM A;  2X3W D;  1KQS P;  2QQR A;  3SWN C;  1GBR A;  3I35 A;  3UPU A;  3M0S A;  3CCL A;  2DTH A;  1IRE B;  4EPC A;  1ZA2 B;  3QUI A;  1KFZ A;  3CXC A;  2LTO A;  4PJO D;  4XK8 E;  2FB7 A;  1W6X A;  4OP0 A;  1QVG A;  1PSE A;  2DXB A;  2A0F B;  4ZGJ B;  1N8R U;  1D3B B;  1RAB B;  1FXX A;  1I0C A;  1OX9 A;  1YHQ T;  3FJ5 A;  3OYF A;  3VS3 A;  4PJO F;  4ORZ A;  2QG9 B;  1SSF A;  2CP0 A;  4C92 F;  5KYW B;  3BDU A;  2FYK A;  1AD5 A;  2CP2 A;  1Y96 A;  4EMK B;  4LNP A;  1TOV A;  3G6E Q;  2K6D A;  4L5G A;  5D6W A;  1NZ9 A;  5ECA A;  1O75 A;  1Y7X A;  4A63 B;  2O9S A;  1D0Y A;  2JMC A;  2DL7 A;  1KC8 U;  2NWM A;  4CC3 A;  1K9M U;  2DF6 A;  4M78 B;  1ZSZ A;  4AFZ C;  2AT1 B;  1UJ0 A;  2E1H A;  1QVF P;  1UUE A;  1M3B A;  5GMK l;  1PRL C;  4C8Q B;  1B3Q A;  4MDX A;  2ED1 A;  1X69 A;  2FEI A;  4EMK A;  2RA2 A;  3M55 A;  2QDY B;  5LJ5 j;  5KYY B;  3CCV Q;  3A8M B;  1VQP A;  2KK4 A;  2EWN A;  1AOJ A;  1N9R A;  2XIC A;  2LCS A;  5GMK m;  3OYG A;  2MWP A;  2DYB A;  4FIB A;  3H6Z A;  3NHN A;  1YJW T;  1PG5 B;  1GFD A;  3I55 T;  1PSF A;  2C0I A;  4OGC A;  2LJ0 A;  4JJB A;  5KYX B;  2QA4 T;  1YBY A;  3GPL A;  2L0A A;  2OAU A;  4HXJ A;  2ZPI B;  4KH0 B;  1IB8 A;  3JCM J;  3X28 B;  5KYY A;  3OYH A;  2RHX A;  2FRY A;  1YI2 A;  4RG8 A;  2F1L A;  1X6O A;  1MV0 B;  4Z02 A;  3HTR A;  2B8A A;  4PKC C;  4C8Q A;  4QVZ A;  5CVI A;  3A8G B;  4AFU C;  3TEE A;  4EDU A;  1GRI A;  2X4W A;  3MEU A;  2NUP A;  3CEY A;  3RBB B;  1M1K C;  2XDB A;  2PVO B;  2BUD A;  3Q1J A;  3UA7 A;  1H3Z A;  2VWF A;  4M75 F;  3RMS A;  3LH0 A;  3M57 A;  1WA7 A;  3JCM V;  1MHN A;  1JJ2 S;  2CZ7 B;  4E7Z A;  4N0A A;  1QWF A;  1N9S A;  1G8X A;  2YDL A;  2YRC A;  4MML A;  1VQO T;  1TWB A;  4ATO A;  5GMK e;  1VQ7 T;  4MZP A;  2P4R A;  4DBQ A;  3M0P A;  3MP1 A;  5CKD A;  4PJN A;  4GY5 A;  3OW2 A;  3WVD B;  3CCU Q;  1QCO A;  1VQK T;  2OTJ Q;  3OS5 A;  4PLL A;  2DVE A;  1UE9 A;  4RCC A;  4J83 A;  2W0Z A;  2Z0W A;  2NUT A;  3JB9 D;  2K57 A;  3JCM e;  3VS1 A;  1WPY A;  3CC2 Q;  1VQ4 Q;  1WHK A;  2XKO C;  4A53 A;  4Z88 A;  8AT1 B;  4C5E A;  3JB9 F;  4NL3 A;  2DZ9 A;  4KUL A;  2QA4 A;  4XQ3 A;  1R0C B;  1I1J A;  4Z89 A;  5LJ5 h;  5KYN A;  5A0D A;  2ZPB B;  2JXB A;  2QTV A;  2KR3 A;  1QP3 A;  3FC3 A;  3CCQ Q;  4PJL A;  3X20 B;  3CME T;  4X9C A;  1YIJ Q;  4N4I A;  4J6W A;  2DFU A;  1MMA A;  2W10 A;  1MMN A;  2LQK A;  3QZ5 B;  2YXY A;  5KYW A;  1WDX A;  1NBE B;  4XTU A;  4QQD A;  1UG1 A;  2RNA A;  1FMV A;  1MND A;  1PRM C;  2DBM A;  1SHF A;  4PJJ A;  2LRQ A;  4M75 D;  2J05 A;  3VS7 A;  2K4Y A;  1DJ7 B;  1BI0 A;  1ARK A;  1Q82 U;  1VIE A;  2PUK B;  1FMW A;  3M59 A;  4J7F A;  1V29 B;  1UB4 A;  1R8O B;  2RB6 A;  1AVZ C;  1HYO A;  2KT1 A;  5LJ3 g;  2QTX A;  1I81 A;  4LN2 A;  2LJ1 A;  4Y91 A;  3MP8 A;  3X24 B;  2JM9 A;  2BIV A;  3PT9 A;  5GAN 3;  5GMK j;  2EYZ A;  3PMI A;  4C92 B;  2KT8 A;  4IIO A;  5KCH A;  1JO8 A;  1UDL A;  3NMZ C;  3KFV A;  3QWX X;  4J9B A;  2HKQ B;  1SF9 A;  2J06 A;  2V8K A;  2X35 A;  4C5I A;  2B86 A;  4F7U A;  2KXD A;  3I56 Q;  1ZSZ B;  3FLG A;  2RJE A;  5GJV B;  5LJ5 g;  1VQ8 A;  3L2R A;  1RL2 A;  1KQ2 A;  3C4S A;  7AT1 B;  5FW9 A;  4FSS A;  2FZG B;  5J26 A;  1Q81 R;  1H64 1;  2CZ6 B;  2ZCF B;  3E2U A;  2GGR A;  4C8Q G;  4II1 A;  1MUZ A;  1YJN T;  4HCK A;  1YJW Q;  4M7D C;  1AWO A;  1KIK A;  1HJD A;  2KAF A;  2ECZ A;  1VA7 A;  3EG1 A;  1B07 A;  2M16 A;  2DL5 A;  1KD1 U;  1K1Z A;  1CKA A;  4F04 B;  6AT1 B;  4ZNX A;  2EAY A;  3QII A;  1UEB A;  2COY A;  1IXD A;  3OS2 A;  1M1K R;  5FRM A;  4AMC A;  3S6W A;  3CC7 A;  4A4F A;  1G3S A;  2E12 A;  2D0N A;  3LX7 A;  3OBW A;  1VYU A;  1B34 A;  1VQ9 T;  5FWB A;  4D8K A;  3VV0 A;  1VQM A;  1WIE A;  4BE0 A;  1N6A A;  2OI3 A;  2XI9 A;  2CP6 A;  3E1S A;  1X2Q A;  2L8D A;  3GF5 A;  4M7A G;  2GNC A;  2V26 A;  2O2O A;  2C0O A;  3RER A;  3QWY A;  5CKH A;  3DB3 A;  2DM1 A;  3QJ6 A;  3C94 A;  3SEM A;  4IUV A;  3OYJ A;  1UJY A;  5IHK A;  2RD1 A;  5GAN e;  2I0N A;  1GFC A;  3PE0 A;  1WZO A;  2RQW A;  2NUP B;  1VQ6 T;  1VQ5 T;  4J9G A;  1ABO A;  2K5I A;  2KQW A;  3HP9 A;  2E4H A;  3SDZ A;  1YJ9 A;  4LDW A;  3P8B B;  5DLO A;  3OSS C;  2KRM A;  3CCE Q;  1M3A A;  4QKU A;  5GAO r;  3RES A;  1K8A R;  2KXC A;  2X4J A;  1H92 A;  1VQ7 A;  2WSE E;  4JS4 A;  2MPX C;  3NTH A;  4J5Y A;  1YCS B;  2YWW A;  3CPW P;  4LD6 A;  4JZ3 A;  2R5M A;  2VUB A;  3DKM A;  3JSC A;  1UHC A;  4ESR A;  3NTK A;  3MP6 A;  4JLI A;  3CCS Q;  1WYX A;  4KGZ B;  1M90 U;  2R57 A;  3V8K A;  2SEM A;  2RPN A;  1Q7Y C;  1M2V B;  1NG2 A;  3JCM b;  2EJF A;  4BB7 A;  1OI1 A;  4HT8 A;  4PJO E;  1KG1 A;  1VQ5 A;  1ZSZ C;  2PNI A;  1Q7Y R;  1WJS A;  1IRX A;  4ELZ C;  2DET A;  2HNI A;  3EG3 A;  2QQA A;  2OTL A;  1QKX A;  5IAY A;  2EW3 A;  3M5A A;  3ULR B;  1K8A U;  1AT1 B;  3SD4 A;  2K79 A;  3T9N A;  4E2F B;  2BE9 B;  5IH2 A;  1YIT Q;  4M77 F;  2ZGW A;  2KI7 A;  1RAC B;  5LJ5 d;  2DL4 A;  1BYM A;  4JJD A;  1QMC A;  2ZPH B;  2F5T X;  1BI1 A;  4X9D A;  5GAN f;  3M9Q A;  4JZ4 A;  2YLB A;  3KUF A;  3LGL A;  1M1K U;  3HSB A;  4KH1 B;  1SKU B;  1YCY A;  1ZSG A;  5CKF A;  3V8J A;  1Q95 G;  4Y28 E;  1YFN A;  2LNV A;  5J39 A;  2EYY A;  4C8Q D;  3QZ9 B;  2QEX Q;  3H0H A;  1Q7Y U;  1RAF B;  1XQH A;  1BK2 A;  5FRN A;  2H3E B;  4J7I A;  1MV3 A;  2XID A;  4J6X A;  4FM4 B;  1SSH A;  2XHC A;  4RTV A;  4D8D A;  2XDP A;  1VQL T;  4RTW A;  9ATC B;  4B6M A;  3TCJ A;  3CCS T;  2DIQ A;  5FU7 C;  1PHT A;  1M5Q 1;  3GP8 A;  2CKK A;  2RQT A;  2DO3 A;  3QG1 A;  4C92 G;  4M7D G;  4C0D B;  1WI7 A;  1X01 A;  3UA6 A;  3SB2 A;  1ZBJ A;  2JTF A;  5LJ3 d;  4N0A C;  2K2M A;  3I5R A;  2MCN A;  1K9M R;  3EFS A;  4EIK A;  2XG8 D;  5CCA A;  1RAI B;  4JRI A;  4M7A A;  4DBR A;  2KRN A;  4J9F A;  1BIA A;  3UT1 A;  1LJO A;  3U23 A;  4B9W A;  1YNZ A;  5GAM h;  1VQ8 T;  4PJO A;  2ZZD A;  2QQ9 A;  1NEB A;  1RUW A;  2P4T A;  1G3Y A;  1BCO A;  4N4H A;  5I2S A;  1VQP Q;  1AEY A;  3EGX B;  1OZ3 A;  2E70 A;  5GAO n;  1VQ9 Q;  3TSZ A;  1KQS S;  3CMA A;  4KRT A;  3WVE B;  1BKB A;  4XTV A;  5GAO q;  1HSQ A;  4M75 G;  4EMK C;  2LDM A;  3RUX A;  3OYE A;  4E6R A;  2O4X A;  4M75 B;  1JXO A;  1VOM A;  4JJC A;  2D0Q B;  5GAN 6;  2R58 A;  2F69 A;  3CCJ T;  3VS4 A;  2K9G A;  1FMK A;  3HRT A;  4KUD K;  3CPW A;  3ZBD A;  2HCK A;  1H8K A;  3OYI A;  1ZX6 A;  2YSQ A;  5GAM j;  2DD5 A;  2M0O A;  3INZ A;  1QQJ A;  4PJO C;  2MYS A;  2CYZ B;  3HFO A;  4IUR A;  2QXF A;  3ASK A;  1W1F A;  2DL8 A;  3LGF A;  4GLM A;  1M4Z A;  1TU0 B;  2DX1 A;  4NL2 A;  5HK0 A;  1ZUY A;  2HMA A;  3MCA B;  3OYY A;  1OPL A;  1KC8 C;  2CT4 A;  4AFS C;  1RLP C;  2IPO B;  1JJ2 A;  4LDU A;  3VUB A;  3ZEH A;  2EQU A;  4A4K A;  4ZGD B;  4OMQ A;  3SWN B;  4E7L A;  4PNO A;  1MGQ A;  2LT1 A;  3J7A F;  4V2S A;  2E64 A;  3J80 E;  4C8Q F;  4Z8A A;  2KE9 A;  2F5K A;  2SRC A;  4DQ2 A;  5AYF A;  5CR2 A;  4M7A D;  1UHF A;  1TUG B;  4HKE A;  3JCM P;  1D0Z A;  1SRL A;  4XU1 A;  3D7S B;  4IUT A;  2AK5 A;  3CCM Q;  3QHS A;  3VRY A;  2DVJ A;  2DYI A;  3HPW A;  2IVW A;  1RI9 A;  2EJG A;  1AZE A;  2K7A A;  4BDZ A;  1K73 R;  2HQE A;  4IUP A;  1MMG A;  3M0Q A;  3IQL A;  1FYN A;  1AWJ A;  4ZTF A;  3CD6 Q;  1Z9Z A;  3MET A;  2E41 A;  3JCM X;  1BCM A;  1LOJ A;  2RHZ A;  2X3X D;  2G6F X;  3H0I A;  1U1T A;  4AFQ C;  4LDX A;  3ZL7 C;  3L2U A;  3VU3 C;  5C0M A;  3JCM c;  2HZY A;  4O5V A;  1IZ6 A;  2ZPE B;  2HBP A;  2D1X A;  2LQW A;  1RLQ C;  2OAW A;  2JJ9 A;  3VJP A;  2QEX T;  1W2B S;  3OMG A;  2NYS A;  2QA4 Q;  1Z9Q A;  2D8J A;  2GTJ A;  2RF0 A;  5LJ3 j;  2WSF E;  3GNG A;  1YHQ A;  2MWO A;  2KMT A;  2KDS A;  1T0H A;  1HK9 A;  1TUC A;  1Q82 C;  2VVK A;  3MJX A;  2X4Y A;  3JCM f;  4XTY A;  4M7A F;  1OEB A;  5IXB A;  3CXC S;  1KHC A;  2ZPF B;  1PCX A;  1WGS A;  3JCM W;  1E6G A;  2BE7 D;  1AWX A;  3QJY A;  3H41 A;  2KY9 A;  1AWW A;  2CS7 A;  1MMD A;  2E3H A;  2PZ1 A;  5A0G A;  2J7I A;  4P5N A;  1G3W A;  4LUE A;  3EG2 A;  2CSQ A;  3EHQ A;  3X25 B;  2L3S A;  3VYG A;  2RHY A;  3GOX A;  4HA8 A;  4IIM A;  2ROL A;  1RAH B;  5FU6 C;  3V8L A;  2RI3 A;  1VQO Q;  4R56 A;  3CC2 T;  1VQL A;  1R77 A;  2PTK A;  2EFI A;  2CRE A;  2O4X B;  2YHT A;  1QCN A;  3CCU T;  1Y71 A;  3G7Z A;  3CD6 T;  1WXB A;  3O5Z A;  5CQX A;  1TSF A;  3EH1 A;  4ELY C;  4FW2 A;  5GAN h;  2DRK A;  3EAE A;  1Q82 R;  4EMG A;  2DA9 A;  1K0S A;  1VQ8 Q;  2JS0 A;  1ZBX A;  4FSX A;  4C0G A;  2GTO A;  3PIO A;  2KRO A;  1K0X A;  3KXT A;  3EGD A;  3CCR A;  3QBY A;  2EIF A;  1C1A A;  2EKO A;  4E7S A;  1VQN A;  3M58 A;  4FCY A;  3VS5 A;  2FPF A;  2DEQ A;  3FB9 A;  3V7C A;  1JB0 E;  3G4S T;  3HHT B;  3EHR A;  3I55 Q;  5GAO l;  4BD3 A;  4OGE A;  5GAN 2;  1KK7 A;  4LUD A;  1LNX A;  2J6K A;  4HCZ A;  2VXE A;  2VAS A;  1RAG B;  2FO0 A;  2VYT A;  4X34 A;  2OX7 A;  1G2B A;  4FYY B;  3G71 Q;  1GCQ C;  3JCM g;  3M0T A;  2CZ0 B;  1TUD A;  4OMP A;  4MMK A;  1LVK A;  3NGP A;  4A4E A;  2EQI A;  1XOV A;  2O31 A;  5EG2 A;  4F14 A;  4AG1 C;  1OYX A;  3I5S A;  2VXF A;  1KQS A;  1OV3 A;  4RTT A; 
#chains in the Genus database with same CATH homology
 1BIB A;  2VUB A;  5FU7 B;  3DKM A;  2RK1 A;  3JSC A;  3BW1 A;  2A3L A;  5CO7 A;  4JRQ A;  4F7U B;  3QKJ A;  1YJ9 T;  3LLR A;  3JCM Q;  3NTK A;  3MP6 A;  3A5Z B;  3HKS A;  3RKX A;  3CCE A;  1HXD A;  4JLI A;  3R6O A;  1B34 B;  1M90 U;  1M8V A;  3OQ5 A;  1K73 C;  1K9M C;  2QQR A;  2R57 A;  3SWN C;  2RK2 A;  3MHX A;  1VUB A;  2PU9 B;  5I21 A;  3OYB A;  4ZN3 A;  3KBG A;  4PLI A;  3V8K A;  3UPU A;  2JTM A;  3A8O B;  3CCL A;  3O8V A;  2HD0 A;  1Q7Y C;  3TU4 K;  3JCM b;  3UWN A;  2DTH A;  1IRE B;  2EJF A;  4BB7 A;  3QUI A;  4ME7 A;  1OI1 A;  5DY9 A;  4EPC A;  4TVR A;  3CXC A;  4HT8 A;  2LTO A;  4PJO E;  2LVM A;  4XK8 E;  1VQ5 A;  3G6E A;  1NJI U;  1VQ6 A;  4PJO D;  2FB7 A;  5FLX E;  1WJS A;  3BDL A;  3E9G A;  2QQS A;  2Y90 A;  3PFS A;  1YJW A;  1YI2 T;  4ELZ C;  3G71 T;  2HNI A;  4M78 D;  4JS5 A;  4OP0 A;  1QVG A;  1PSE A;  2DXB A;  2QQA A;  1KD1 C;  4ZGJ B;  4BAC A;  1ZQ1 A;  3OBY A;  1N8R U;  5HK3 A;  2LX9 A;  1D3B B;  2OTL A;  1FXX A;  4KT0 E;  5IAY A;  4JDS A;  4HCC A;  5L8R E;  4M78 F;  3M5A A;  4XU2 A;  1K8A U;  2VC8 A;  4C0D C;  3SD4 A;  3HRS A;  1YHQ T;  3OYF A;  4PJO F;  2K5F A;  1SSF A;  3L42 A;  3T9N A;  5LJ3 e;  4C92 F;  2FL7 A;  5GAO p;  4M77 F;  2RI2 A;  5CKE A;  1VQ9 A;  2ZGW A;  2FYK A;  3BDU A;  3NFC A;  2PUO B;  5LJ5 d;  2K2V A;  1BYM A;  4EMK B;  1Y96 A;  3OB9 A;  2RH2 A;  3CCE T;  4L5G A;  5D6W A;  2FVU A;  1S72 T;  2ZPH B;  2F5T X;  1BI1 A;  1NZ9 A;  4X9D A;  4JLG A;  4M78 E;  5GAM e;  5GAN f;  1O75 A;  2IG0 A;  3M9Q A;  2YLB A;  1Y7X A;  5IT9 E;  1VQM T;  3KUF A;  3LGL A;  1EIF A;  3QPH A;  1M1K U;  3HSB A;  4M7A E;  2PQW A;  1YCY A;  3SWN A;  5CKF A;  4M7A C;  3LW5 E;  4EMH A;  3L2Q A;  3OS0 A;  1N27 A;  3V8J A;  1KC8 U;  4BE1 A;  1JBM A;  4Y28 E;  2LNV A;  1K9M U;  5J39 A;  3CCJ A;  2K5L A;  2DIG A;  3DB4 A;  5DM7 R;  3S3N A;  2HAX A;  4M7D D;  3JB9 J;  2E6Z A;  4RCB A;  4M78 B;  4C8Q D;  3QZ9 B;  4DA4 A;  2E1H A;  1Q7Y U;  3JB9 H;  1XQH A;  3C95 A;  5FRN A;  4J7I A;  1QP2 A;  4JUV A;  4J6X A;  2XID A;  4XTZ A;  4FM4 B;  1NJI C;  1WNL A;  2XHC A;  1M9S A;  2NLU A;  2XDP A;  3FIF A;  4BUG A;  1VQL T;  3E19 A;  3RKY A;  5GMK l;  4HCB A;  4C8Q B;  4OB0 B;  1OZ2 A;  3TCJ A;  3CCS T;  2DIQ A;  5FU7 C;  4MDX A;  4M7D B;  1M5Q 1;  3GP8 A;  4EMK A;  2CKK A;  2RA2 A;  3VKI A;  2GQV A;  4MZM A;  2DO3 A;  3QG1 A;  2Y4Y A;  4C92 G;  4F7U E;  1S72 A;  1Q81 C;  3MEV A;  4M7D G;  4C0D B;  3M55 A;  3OYM A;  2QDY B;  5CKB A;  5LJ5 j;  5GAO m;  2OTL T;  1X01 A;  3G4S A;  3A8M B;  1VQP A;  2KK4 A;  2EWN A;  3GIB A;  2XIC A;  1N9R A;  2V8I A;  3P8D A;  4JRK A;  3SB2 A;  5GMK m;  3OYG A;  2MWP A;  2HQX A;  2JTF A;  5LJ3 d;  4FIB A;  3H6Z A;  4N0A C;  2D9T A;  1WQ7 A;  3G71 A;  1YJW T;  5GAM g;  4C8Q E;  2QI2 A;  2XDD A;  3I55 T;  1PSF A;  4OGC A;  3EFS A;  2RO0 A;  2QA4 T;  4NOY A;  1YBY A;  3GPL A;  2XG8 D;  4XAX B;  2OAU A;  4JRI A;  4DOV A;  2ZPI B;  2E6N A;  2RJD A;  3L2Z A;  4M78 A;  5CCA A;  5KE2 A;  1YIT T;  3HFN A;  3CCL T;  2D6F A;  1BIA A;  2DTO A;  3QYH B;  4O6J A;  5KE3 A;  3UT1 A;  1W2B A;  4MZT A;  1LJO A;  2PVG B;  3ER0 A;  4B9W A;  5GAM d;  5GAM h;  2E5Q A;  3X28 B;  3PTA A;  3OYH A;  3L2W A;  2ZZD A;  3OSV A;  2L3R A;  2RHX A;  2QQ9 A;  3OYN A;  1VQ8 T;  4PJO A;  1YI2 A;  3F70 A;  2P4T A;  1G3Y A;  3FRN A;  3CPW S;  4RG8 A;  3CCR T;  1UGQ B;  1X6O A;  4Z02 A;  3JCM d;  3JCM h;  2P0K A;  4N4H A;  3BFM A;  5I2S A;  2B8A A;  2XK0 A;  3PNW C;  4PKC C;  3CCV A;  4N4G A;  4C8Q A;  3LYI A;  1BI3 A;  3QDR B;  4QVZ A;  3A8G B;  5CVI A;  3CCM A;  4JJN K;  2LCC A;  5HY6 A;  3TEE A;  3PMT A;  1OZ3 A;  2E70 A;  2DXC A;  3CCS A;  4EDU A;  5GAO n;  4C0Z A;  2GF7 A;  1KQS S;  3CMA A;  3WVE B;  1Q81 U;  2X4W A;  2V8J A;  3VUZ A;  1BKB A;  4XTV A;  5GAO q;  3MEU A;  5GMK i;  4M75 G;  3CEY A;  3DLL A;  1M1K C;  1X75 C;  4EMK C;  3CD6 A;  2XDB A;  2LDM A;  2EQJ A;  3RUX A;  2YLC A;  2PVO B;  2BUD A;  3Q1J A;  3OYE A;  1H3Z A;  2O4X A;  3CCU A;  3CCQ A;  4M75 F;  4M75 B;  3RMS A;  5GAN 5;  3LH0 A;  3M57 A;  2OTJ A;  3JCM V;  1M90 C;  1UGR B;  1WQW A;  1MHN A;  2D0Q B;  2DTI A;  2EQK A;  5GAN 6;  1M1F A;  2CZ7 B;  2F69 A;  2R58 A;  1JJ2 S;  4ZGE B;  2OTJ T;  4N0A A;  3CCJ T;  4D6W A;  1N9S A;  3HRT A;  3OYC A;  4MML A;  1VQO T;  4KUD K;  4ATO A;  2EQM A;  3CPW A;  3RMQ A;  5GMK e;  1VQ7 T;  3ZBD A;  4C92 C;  4MZP A;  2RM4 A;  4M7A A;  4M78 C;  4JRP A;  3OYI A;  5KH6 A;  1FWZ A;  5GAM j;  1P92 A;  2DD5 A;  2M0O A;  3INZ A;  4PJO C;  3MP1 A;  5CKD A;  4OMF B;  4E7I A;  2CYZ B;  4GY5 A;  2VV5 A;  3OW2 A;  3CC4 A;  2G3R A;  4M77 B;  3HFO A;  4C92 D;  3WVD B;  4IUR A;  3C12 A;  1VQK T;  5A0L A;  2QXF A;  3ASK A;  3LGF A;  3OS5 A;  4PLL A;  4C8Q C;  1M4Z A;  2DVE A;  4RCC A;  4NL2 A;  5HK0 A;  2EYQ A;  3MCA B;  4J83 A;  3OYY A;  4LDV A;  2R5A A;  3JB9 D;  2K57 A;  4DOW A;  3JCM e;  1KC8 C;  1WPY A;  2A7Y A;  3UDC A;  2XKO C;  3OMC A;  4A53 A;  4C5E A;  1JJ2 A;  3JB9 F;  2M1H A;  4QQ6 A;  4NL3 A;  4C5G A;  4LDU A;  3VUB A;  4BI3 A;  4PJO B;  5GAN 4;  2DZ9 A;  4KUL A;  2QA4 A;  3A8L B;  3OS1 A;  3I56 T;  2MI6 A;  2P0P A;  3QYG B;  2EQU A;  4MDW A;  4XQ3 A;  3ZEH A;  5LJ5 h;  4A4K A;  4ZGD B;  5A0D A;  2ZPB B;  3SWN B;  4E7L A;  2K3X A;  5D6Y A;  2QEX A;  1M1G A;  4PNO A;  5D6X A;  4C0F A;  1MGQ A;  2LT1 A;  4OB3 B;  1QP3 A;  3J7A F;  4E7H A;  3FC3 A;  4V2S A;  2E64 A;  4XU0 A;  2DPP B;  4C8Q F;  3J80 E;  3X20 B;  3CBM A;  3J81 E;  4LD9 K;  5J3B A;  3CME T;  4X9C A;  3WXM B;  1VQN T;  4N4I A;  4J6W A;  1UGS B;  4E47 A;  2XD0 A;  5CR2 A;  2F5K A;  4DQ2 A;  4C92 A;  5AYF A;  4M7A D;  1Y96 B;  2RJF A;  2VGM A;  1YIJ T;  4HKE A;  2LQK A;  2K3Y A;  3JCM P;  4M77 A;  1KG1 A;  4XU1 A;  3QZ5 B;  1VQ4 A;  1QVG S;  4IUT A;  3CPF A;  1I5L A;  3OA6 A;  1ZHI A;  2WSC E;  3E9F A;  2M9U A;  2EJ9 A;  3QHS A;  3A8H B;  4XTU A;  5M9O A;  5LJ3 f;  1VQO A;  4QQD A;  1VQK A;  3HPW A;  2IVW A;  3GNF B;  3JB9 I;  2X4X A;  2EJG A;  2O01 E;  2LRQ A;  5CQY A;  4PL6 A;  4BDZ A;  1GXI E;  1Q86 U;  3OYL A;  4M75 D;  2LC4 A;  2HQE A;  2K4Y A;  3H8Z A;  3OYA A;  4IUP A;  2GFU A;  1K73 U;  4M78 G;  1DJ7 B;  4ZTF A;  1BI0 A;  3MET A;  2MMP A;  4E7J A;  1Q82 U;  2DJZ A;  1VIE A;  2E65 A;  2JUF A;  2PUK B;  3QXE B;  2E41 A;  4B9X A;  3M59 A;  4J7F A;  1V29 B;  4PJO G;  1UB4 A;  3JCM X;  1BI2 A;  1R8O B;  2RB6 A;  2LCL A;  5GAN 7;  4RMO A;  1YJN A;  3P8H A;  4IKF A;  5FRO A;  1LOJ A;  5LJ3 g;  3PIP A;  2MAM A;  2QTX A;  3M56 A;  1I81 A;  3EFR A;  4HT9 A;  3MEW A;  4Y91 A;  2RHZ A;  3HL8 A;  1VQ4 T;  4NS5 A;  2E10 A;  3MP8 A;  3X24 B;  1U1T A;  3X26 B;  4F7U G;  4LDX A;  2KVQ G;  2BIV A;  3PT9 A;  3FDR A;  4CRI A;  3L2U A;  3VU3 C;  5C0M A;  3HRU A;  3JCM c;  4QW2 A;  5GAN 3;  3PGG A;  3PMI A;  5GMK j;  4C92 B;  5KCH A;  1QVF A;  4O5V A;  1G3T A;  1IZ6 A;  4RG2 A;  4M7D A;  3MO8 A;  2ZPE B;  2JNG A;  2HBP A;  4M75 E;  2JN0 A;  1KHI A;  1RI0 A;  3CBP A;  5LJ5 f;  3VJP A;  2QEX T;  1W2B S;  1TH7 A;  3OMG A;  2V8K A;  2DZC A;  2X35 A;  1U1S A;  4C5I A;  5GAN j;  2L89 A;  2QQB A;  2VGN A;  1Y07 A;  5LJ3 j;  4F7U A;  2WSF E;  2C06 A;  3GNG A;  2DKG A;  1YHQ A;  4CI0 C;  4M77 C;  3CCM T;  2MWO A;  4M77 E;  3FLG A;  2JVV A;  2KMT A;  3S3O A;  4C92 E;  2KDS A;  4QVD A;  4VUB A;  3I55 A;  2RJE A;  1HK9 A;  5CK9 A;  2Y4X A;  5LJ5 g;  1Q82 C;  3QSU A;  2CGH A;  2YRV A;  4BY6 B;  1VQ8 A;  4XTW A;  1WJQ A;  2X4Y A;  3JCM f;  4L6V 5;  3L2R A;  4XTY A;  1RL2 A;  3SFM A;  1VQP T;  3G6E T;  3DLM A;  1KQ2 A;  2FHD A;  1WJR A;  2I2L A;  3C4S A;  4M7A F;  2LQ8 A;  3ME9 A;  3CXC S;  1KHC A;  2ZPF B;  4KUI A;  4LDY A;  1Q86 C;  1WGS A;  3NTI A;  3JCM W;  4BI8 B;  5J26 A;  1H64 1;  1KQ1 A;  2CZ6 B;  2DAQ A;  2ZCF B;  4QVC A;  3M4Y A;  3QJY A;  4FT4 A;  2KY9 A;  4C8Q G;  4II1 A;  2CS7 A;  4IUU A;  1YJN T;  5A0G A;  4P5N A;  2DXU A;  3OY9 A;  2GFA A;  1G3W A;  2RHI A;  3CC7 T;  3X25 B;  3OYK A;  5GAN d;  3VYG A;  4M7D C;  3M53 A;  3QO3 A;  2RHY A;  5HKC A;  3GOX A;  4GLK A;  4M7A B;  2KAF A;  4HA8 A;  3MEA A;  3V8L A;  5FU6 C;  3LWI A;  4E7K A;  5FU6 B;  4A4H A;  2RI3 A;  4FU6 A;  2JOY A;  4J8O A;  2M16 A;  4R56 A;  3CC2 T;  2GCX A;  4IUQ A;  4OF1 A;  1KD1 U;  1VQL A;  1NPR A;  4RKU E;  2BKD N;  4WF2 A;  3CC2 A;  1AHJ B;  2EFI A;  4BY6 C;  3S3M A;  4M75 A;  2EAY A;  3CBO A;  5C6S A;  1XNI A;  3N5B B;  2O4X B;  3QII A;  2YHT A;  1UEB A;  2L5Q A;  5GMK h;  3OS2 A;  5A2Q E;  2DXT A;  3CMA T;  3RIR A;  4FL6 A;  5GAN g;  5FRM A;  4M7D E;  3CCU T;  3S6W A;  3CME A;  3CC7 A;  4A4F A;  1Y71 A;  1G3S A;  3G7Z A;  3URG A;  2E12 A;  3LX7 A;  3CD6 T;  3ZFJ A;  4OB2 B;  5CQX A;  4M7D F;  2DD4 A;  3OBW A;  4ELY C;  3JRZ A;  3CCV T;  1B34 A;  2JZ2 A;  1VQ9 T;  4OB1 B;  5GAN h;  3EAE A;  4XTX A;  3VV0 A;  4EMG A;  5IN1 A;  3OYD A;  1YIJ A;  1VQM A;  2KSS A;  2WAC A;  4BE0 A;  1N6A A;  2AHJ B;  4ZN1 A;  4F7U F;  1NE8 A;  4A4G A;  2XI9 A;  4L59 A;  1ZBX A;  4KBM B;  2LT4 A;  4FSX A;  4C0G A;  3E1S A;  4UC4 A;  4BI4 A;  5LJ3 h;  1I4K 1;  2L8D A;  3M4G A;  3PIO A;  3GF5 A;  3KXT A;  3CCR A;  3QBY A;  1JRI A;  4M7A G;  1O9S A;  2EIF A;  4ZTJ A;  3AHU A;  4XU3 A;  2EKO A;  1FX7 A;  3CCQ T;  1VQN A;  3M58 A;  1W4S A;  3I56 A;  3RER A;  1U8R A;  5CKH A;  4C5H A;  1YIT A;  3DB3 A;  3QJ6 A;  5I2M A;  2DEQ A;  3C94 A;  3FB9 A;  1JB0 E;  3V7C A;  3L1A A;  3RKW A;  4R55 A;  3G4S T;  3HHT B;  4IUV A;  3OW2 S;  3JAM E;  3OYJ A;  3CC4 T;  1UGP B;  5GAO l;  3VYH B;  2RD1 A;  4BD3 A;  5GAN e;  5GAM f;  2PVD B;  3GLX A;  4Q5W A;  3FJP A;  5DLQ E;  5KCO A;  4M75 C;  3L2V A;  3M54 A;  4OVA A;  4OGE A;  1QVP A;  4FT2 A;  5GAN 2;  1LNX A;  4HCZ A;  1VQ6 T;  1NPP A;  1VQ5 T;  1QVF S;  2VXE A;  3JCM J;  4BE2 A;  3V7R A;  2K5I A;  5CIU A;  2ZPG B;  2KQW A;  3HP9 A;  3V7S A;  2VYT A;  3SDZ A;  5GAN 8;  1YJ9 A;  4J6Y A;  2CZ1 B;  4LDW A;  3BY7 A;  3P8B B;  2RHU A;  4X34 A;  3OSS C;  1QW1 A;  4YTL A;  4M77 G;  5DLO A;  3LWH A;  1K8A C;  3FEO A;  2H3J A;  2RI5 A;  3JCM g;  3TRE A;  1XTD A;  1I8F A;  4BDY A;  2CZ0 B;  4MMK A;  5GAO r;  1D3B A;  3RES A;  3JB9 G;  2MF2 A;  2X4J A;  4A4E A;  1XOV A;  4A54 A;  2RJC A;  5EG2 A;  2P0Q A;  5LJ5 e;  4QQG A;  1VQ7 A;  5CAI A;  2WSE E;  4M77 D;  1N8R C;  4JS4 A;  1OYX A;  2DK3 A;  2XU8 A;  1G5V A;  3NTH A;  1VIF A;  4J5Y A;  2VXF A;  1KQS A;  4LD6 A;  5LL6 S;  2R5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...