2FHDA

Crystal structure of crb2 tandem tudor domains
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
150
structure length
150
Chain Sequence
b'HMSRRSFKNRVLAFFKGYPSFYYPATLVAPVHSAVTSSIMYKVQFDDATMSTVNSNQIKRFFLKKGDVVQSTRLGKIKHTVVKTFRSTNEQLSLIAVDALNNDMVILAHGEIEVTVPISTIYVAPVNIRRFQGRDLSFSTLKDMKFEETS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein rhp9/CRB2
molecule tags Cell cycle
source organism Schizosaccharomyces pombe
publication title Structural basis for the methylation state-specific recognition of histone H4-K20 by 53BP1 and Crb2 in DNA repair.
pubmed doi rcsb
total genus 29
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18115 Tudor_3 DNA repair protein Crb2 Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fhdA01
2.30.30.810 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fhdA02
2LCCA 2EQKA 1RI0A 2E5QA 3OS0A 4OVAA 4PLIA 4UC4A 3S6WA 2RHYA 2X35A 2YRVA 5IAYA 3L2WA 2EFIA 2GFUA 1OI1A 2MWPA 3EAEA 3FLGA 3P8DA 3UWNA 5KE3A 4RG2A 2X4XA 3MP6A 1OZ2A 3PMTA 4PLLA 2WACA 4A4HA 4E7IA 3PFSA 3OYDA 3OYMA 5C6SA 4BDZA 3GOXA 4BE1A 2RJCA 3M9QA 4BACA 2F5KA 2GF7A 2PQWA 2K3XA 4C5EA 2RJEA 4Z02A 1XNIA 3L2QA 4X34A 2EQJA 5D6YA 4II1A 2XK0A 1WJQA 4IUVA 4Q5WA 5FRNA 3MEAA 3OMGA 2EQUA 3ME9A 5C0MA 2RO0A 3MEWA 2IG0A 3MEVA 2HQXA 2P0KA 3PMIA 5KE2A 5M9OA 2L3RA 4QVZA 2RHZA 3OYCA 2LVMA 2BIVA 2NLUA 2BUDA 2GFAA 3DLMA 3NTKA 4C5IA 1OYXA 3OYIA 2DAQA 5J39A 3OYLA 2MWOA 2VYTA 2QQRA 4IUTA 3L2VA 4ZTFA 4C5HA 2DIQA 2M0OA 2O4XB 3QBYA 1SSFA 2B8AA 5J26A 2X4WA 3NTHA 3LH0A 1MHNA 3Q1JA 2RHUA 2JTFA 4IUUA 2DIGA 3QIIA 2R58A 2RI5A 2K3YA 3OMCA 4IUPA 4PL6A 4BE0A 3FDRA 2O4XA 2BKDN 1KHCA 3MP8A 3O8VA 3OYFA 3LX7A 3S3NA 3FC3A 4QQ6A 2LRQA 2LTOA 4IUQA 3KUFA 4IKFA 2R5AA 4N4GA 3L42A 3OY9A 3MP1A 2M1HA 3OYJA 3S3MA 3BDLA 4ZTJA 2L89A 2RHXA 3NTIA 2R57A 3H6ZA 4GY5A 3PNWC 4A4EA 2M16A 2R5MA 2JZ2A 4CRIA 2D9TA 3C4SA 1G5VA 4B9XA 3OYHA 5IN1A 3OYGA 3OYEA 4N4IA 3ASKA 1N27A 4HCZA 2G3RA 2RJFA 4N4HA 2L8DA 3E9FA 4FU6A 4C5GA 5KCHA 4BDYA 1H3ZA 3E9GA 4QW2A 3OS2A 3CEYA 3LGFA 3P8HA 2E6NA 4E7KA 4E7LA 4FL6A 4LD6A 4NS5A 3H8ZA 3OQ5A 4QQDA 3SD4A 3LGLA 3OS1A 3OYNA 2XDPA 3OA6A 3DB3A 3OYAA 2CKKA 3LLRA 2RHIA 4A4GA 1OZ3A 3MEUA 1WJSA 2EKOA 4QQGA 3OYBA 4E7JA 2LDMA 2X4YA 3F70A 3L2RA 3LYIA 1WJRA 2RJDA 5D6XA 5KCOA 4IURA 3META 2HQEA 5FRMA 4E7HA 3UT1A 4B9WA 4BE2A 3OB9A 3ZEHA 3S3OA 3MO8A 2QQSA 3FEOA 3DB4A 3QJ6A 4A4FA 4L59A 2RI2A 1WGSA 5FROA 2EQMA 3OYKA 4EDUA 3L2UA 5D6WA 3QKJA 4BD3A 5CIUA 2FHDA 5KH6A 2RI3A
chains in the Genus database with same CATH superfamily
2E5QA 2GBQA 4AFZC 1UFFA 4ZN3A 4RG2A 2JM9A 2L3SA 5LJ3g 3X24B 2IPOB 1VQMQ 3JAME 1V76A 3TSZA 3VS1A 4M7DA 3P8BB 2HBWA 1PKSA 2LCLA 2K3BA 2QG9B 5GAN5 4X34A 1OU9A 2KYBA 5HK0A 1UG1A 1K9MC 1EX4A 2DD4A 2NWMA 3UPUA 5DLQE 1PSFA 2DL4A 4J9CA 4OMFB 2P4TA 1XOVA 4LUDA 3PT9A 2GFAA 2F2XA 1OYXA 1YITT 4AFUC 4IUTA 2BZXA 1VQMA 2F2WA 1NZ9A 1FMWA 2KQWA 2RN8A 1NG2A 2AK5A 1QQJA 2PUOB 4M7DB 5CR2A 3S3NA 3HP9A 3VS2A 3VUZA 4QQ6A 4N0AC 1HYOA 1PRLC 5HKCA 2YXYA 2EGEA 2I2LA 1YIJT 3VYHB 2QEXA 2P4RA 1G5VA 5FWBA 1IHWA 4FT2A 3RKWA 2QA4Q 3QUIA 2RJFA 4L6V5 1ABQA 3E9GA 3FRNA 3CPWP 4KH1B 3SWNA 3ULRB 3GP8A 2YUNA 2XDPA 2ZZDA 1HJDA 4PJOB 2QQBA 2EKOA 4R55A 4KH0B 2RJDA 1PCXA 2JN0A 1JRIA 2JS0A 1NE8A 3CCJQ 2LNVA 1NEBA 2RI2A 1WGSA 1WXTA 1U06A 4OB0B 2DD5A 1JXOA 4BD3A 3CMET 5AT1B 1S72A 4KT0E 2GQIA 3OSSC 2LC4A 4PLIA 3CCRT 1YI2A 1ZUKA 5KE3A 3HRSA 4GBQA 4AMCA 3MCAB 2YSQA 2XMFA 3OYDA 2DXTA 3QO3A 2HKNA 1PM3A 1BCOA 5KYUB 3I56A 1FYNA 2K3XA 1PSEA 4L5GA 4M77C 3JSCA 1ZBJA 4LDWA 2E70A 2LCSA 2EKHA 2G6FX 3CCVQ 3MEVA 3NFCA 4LDYA 3UA7A 2CT4A 5DLOA 3EG9B 4KRTA 1VQ5A 2X4JA 2E64A 2FZKB 1VQ9T 1M1KR 2ZPHB 4J6YA 5IHIA 3OYLA 2KY9A 3C12A 4M7AF 3CPWA 3CCQQ 5J26A 1KQ2A 2RHUA 2ROLA 4IUPA 2K3YA 1VQ4Q 1B34B 3RBBB 1H92A 2LZ6B 3EFSA 3CC7Q 4X9CA 5KYNA 4OB3B 1GCQC 1PD1A 4PKCC 3M57A 1PC0A 1JU5C 5L23A 4ZGJB 2YUPA 2QYZA 4Y92A 1Y7XA 1HD3A 1WHJA 2RMOA 2K2VA 1MGQA 4FU6A 1Q81C 4HVVA 3JB9G 1B7TA 2ZPBB 1SSHA 1KC8C 1NLPC 5I22A 3LLRA 4A4GA 3CC7A 5CKFA 5LL6S 1VQKA 1VQPT 1YITA 3M0RA 4XTYA 1WJRA 3JCMh 3EGXA 3G71Q 2LJ1A 3UT1A 3ZEHA 4M75F 1D1CA 1X27A 4OP0A 1YJ9T 4JZ4A 2DO3A 1BU1A 2QAZA 1EFNA 4PFPA 3OYKA 3CCVA 1Q81R 2JTMA 2AKLA 2H8HA 4M7DG 3SWNB 1GCQA 1OV3A 3CXCS 1UGQB 2X35A 1VQ7Q 5GAOr 3FLGA 1KC8R 4J6XA 1ZX6A 1VQKT 1BIBA 4ZNXA 5GAN7 4K11A 4HCCA 5AYFA 4HT9A 2AT1B 1WXBA 4MZTA 2DETA 5D6YA 1JO8A 4XU0A 5FU7B 4J5YA 1ABOA 1MMDA 5M9OA 2X3XD 1QKWA 2DKGA 2DL3A 5GMKl 2LMJA 1CKBA 3NTHA 2JVVA 3CC2T 1SPKA 3A8OB 1Q81U 2KXCA 3M0TA 1QLYA 2BE9B 1KQ1A 5ECAA 3EFOA 1QVFS 3JCMc 1YCYA 4J9EA 1TOVA 1TUCA 1VQ4A 3EHRA 4MZPA 3CCMT 2LQKA 3QYHB 4M4ZA 1YN8A 2O01E 1KFZA 3OS1A 2K6DA 1M5Q1 3GBQA 4C8QE 1N8RR 2CREA 3C94A 4JPBW 1BK2A 1WJSA 4QQGA 2DA9A 3LH5A 1VYTA 2KMTA 1E7OA 4C92E 1WX6A 4IURA 2HQEA 2QDLA 4ESRA 1I81A 2F2VA 1BB9A 4A4FA 1WLPB 2M02A 1HXDA 1SEMA 3M4YA 1KIKA 1D0XA 1RAAB 4UC4A 1KC8U 4KGVB 1OI1A 3J80E 1K9MR 2JW4A 2NUPA 3PFSA 4M7AE 4M78C 1TSFA 1M90C 1SF9A 4OF1A 2HBPA 1D09B 4X9DA 2RQUA 1JJ2P 2YHTA 3N5BB 3L2QA 2EYZA 2EQJA 1Y07A 4JUVA 4II1A 4LXCA 1YFNA 3SWNC 1M3AA 1PWTA 2WSFE 2PTKA 2ZPGB 1X43A 3NTKA 1QCFA 2KGTA 1RLQC 1WHGA 4M7DC 4JS4A 1Y96A 4ZTFA 1QWEA 2L5QA 4C0DC 4PFOA 4DBQA 1D0ZA 3EG1A 3OMCA 3URGA 2O2OA 3MP8A 3O8VA 2OTLT 1MMGA 2CUDA 2CZ6B 2NUZA 3M53A 1VQ5Q 2BZ8A 4N4GA 1YJWQ 3EG9A 5GMKe 2CP7A 3S3MA 5GANd 3RDVA 1TTHB 2ABLA 1ZSZA 5GAMj 3A8LB 4OB2B 5GAOp 3HSBA 3C4SA 2DVJA 2HKQB 1VQKQ 3TEEA 4O6JA 4N4HA 3GIBA 1NJIR 2K79A 1BCMA 3VYGA 1ZA1B 5LJ5f 2CP3A 4E7KA 1BIAA 2LT1A 1QVGA 4C92B 2DXBA 4VUBA 3FIFA 2ED0A 4OB1B 4E7JA 4PFZA 2DZ9A 4JJDA 1VQNA 1AWXA 4M77E 3HFOA 1JJ2A 1K0SA 2D8HA 1NPPA 5FRMA 4E7HA 3CC7T 1BYMA 2FPEA 1W70A 1I07A 4J9GA 3A8HB 1MMNA 2DK3A 3KFVA 4EMKC 4C92C 1TUGB 3H0IA 2FL7A 2ZPIB 4E7IA 5DM7R 2YT6A 4JS5A 3OYMA 5C6SA 4BACA 1OQKA 2O88A 1B34A 2PUKB 1ZQ1A 2YLBA 2FVUA 1W2BS 4R0KA 3TQ7P 1N9SA 2LJ3A 2DMOA 1GL5A 1YI2T 5HK3A 2JM8A 5LJ3f 2YRDA 4M78E 3QG1A 3G6EQ 1QP2A 3OYCA 5GAMg 2BIVA 1QW1A 2FPDA 1H8KA 2HCKA 2YUOA 1YHQQ 2COWA 2D8JA 2M0OA 2VUBA 2EJGA 5GMKi 1M8MA 1BI2A 4RTZA 3I5SA 2DL5A 3H41A 2R58A 1PRMC 1WHLA 1KHCA 1PHTA 4Y91A 2LJ0A 4CC3A 1SG5A 1ZLMA 2LT4A 2RHXA 4XTVA 2FG0A 4E47A 3MHXA 5A0DA 3G4ST 2J7IA 3CCJA 5GAN8 2JXBA 3CCSQ 1RABB 1X69A 3O5ZA 5FLXE 4N4IA 4RTYA 1UHFA 4ZGDB 2P0QA 2QGGA 2D1XA 1RAHB 2EAYA 1P92A 4C92G 2K2MA 3H8ZA 2P84A 2EYXA 4PJOD 2YUQA 4ELZC 2D0QB 2DNUA 4PJJA 2JJ9A 3TVTA 2ENMA 1OX9A 2ZGWA 1UJ0A 4LN2A 4FW2A 3I55T 1M30A 3EH2A 5CKDA 1M1KC 2K9GA 5CKEA 4OMNA 5CIUA 2KR3A 4E7ZA 2RPNA 1KQSS 1T0HA 1WNLA 3LWIA 2QTXA 2EJ9A 4C92A 4A4HA 1LOJA 2JMAA 1RACB 5IHKA 4OMMA 3CMAT 1PNJA 3G1JA 4JRKA 1YJWA 1Q82U 2OTJQ 5CKBA 2AHJB 1KQSA 4JLIA 1M90R 4AG2C 3OYYA 3NMZC 3WXMB 2LQWA 3MEAA 3OMGA 4OMOA 3ME9A 5GAN3 4J6WA 2CSIA 2DPPB 4JLGA 4IIMA 5CAIA 4J9HA 2A36A 5GAOl 5KYYB 5GJVB 4WF2A 2DIQA 2B8AA 4C8QC 3CCRQ 3LW5E 3TSWA 2DIGA 4BE0A 2EGAA 2CZ1B 4FW1A 1VQLT 1VA7A 3QYGB 4M78A 2LTOA 1WPYA 3QHSA 2DBKA 1TH7A 2KAFA 4J9DA 4M77F 3JB9F 1C1AA 4BB7A 1JQQA 3CCUQ 4OGCA 4M7AD 3C0CA 2LX7A 2JZ2A 3OYHA 1YI2Q 3OYGA 2E65A 4J8OA 4B6MA 4PJLA 1K73R 4PJOA 5GANf 1M90U 3SDZA 3CEYA 4Z88A 4JJNK 1K8AU 3CCEQ 2X51A 4J7IA 2RHIA 1OZ3A 4F7UG 2PVGB 3I9QA 5J3BA 1RL2A 2OJ2A 2QA4A 2PVDB 3J81E 2VV5A 4M78G 4KGZB 4XTWA 3META 1M3BA 3QWXX 3JCMg 6AT1B 2QQSA 3FEOA 2NUTB 5FROA 4M7AC 4JJBA 1UTIA 1KHIA 2EQMA 4M78F 4HXJA 4WTOB 2FHDA 2QI2A 1NM7A 2KDSA 4M7DE 2LQNA 2GFUA 3P8DA 2AZVA 2QA4T 4C0ZA 1R77A 1IREB 3MP6A 4M75D 1K9MU 3MPUB 2H3EB 5CCAA 2W0ZA 1T3SA 4EMKB 5I11A 1W1FA 3M9QA 2CP0A 2C0OA 1X6GA 1V1CA 4QVCA 1Q7YR 2VVKA 1OX8A 1Q86C 3JB9I 1SHGA 3CD6T 1VQPQ 2KROA 2DFUA 3PIPA 3CCJT 1O75A 1Y57A 1JJ2S 1JB0E 5J39A 2A08A 3OBYA 3CMAA 5HY6A 1QKXA 1NPRA 1QVGS 2AZSA 1ZUYA 9ATCB 3C95A 2XKOC 1M2VA 5GAN4 5D7UA 1R0CB 5GANe 2QXFA 3M55A 1M1GA 3WVEB 2HZYA 3BDLA 1X01A 4PJOC 2DILA 4LD9K 5LJ5d 1AZEA 4AFQC 1FMVA 2D9TA 3BFMA 4C8QD 5DY9A 4DOVA 2K4YA 4BDYA 4C8QB 2FO0A 3G7ZA 3PVQA 3EHQA 2DL8A 4E7LA 3SD4A 3OS5A 4M7DD 1VQ9Q 1U5SA 1KK7A 3DB3A 3OYAA 1K8AC 5CK9A 3V7CA 2FRWA 2LDMA 2X4YA 3M54A 1VQ6Q 2F5TX 3JCMd 3CBPA 2KT1A 1Q95G 3QJ6A 4M75A 1FMKA 2NYSA 1W2BA 4XQ3A 3VS4A 1ZHIA 5HCKA 4RTUA 3RUXA 1YNZA 4XTXA 2LP5A 3GF5A 1AEYA 4D8KA 1Z9ZA 4BE1A 1ZSZC 4J9BA 4RUGA 1VYVA 1ACMB 3X28B 5A2QE 2D0NA 2A7YA 3CCRA 1U3OA 2HSPA 5C0MA 4M75G 1BI0A 2ZPFB 3JB9J 4PJNA 4EIKA 1VQ8Q 3JCMe 1GFDA 2VXEA 2YWWA 3RMSA 3X25B 1UGVA 2COYA 3Q1JA 3QIIA 4HVUA 1NYFA 1M1FA 4LDUA 3PGGA 3CCLT 1UB4A 4FYXB 4OGEA 3CQTA 2YLCA 5I21A 3VU3C 3OYJA 4ZTJA 2GNCA 1QCNA 1WZOA 4DQ2A 1B07A 4CRIA 1LCKA 2LQ8A 3A5ZB 4RTTA 2EQIA 1V29B 1N27A 4DBHA 5GAN6 1W6XA 1UE9A 2QQ9A 1G8XA 2HAXA 4M7DF 1KJWA 3BY7A 3LGFA 1AWJA 2E6NA 3VS0A 4GLKA 1R0BG 1X2KA 4LD6A 2DRKA 4CC2A 4XU1A 3DKMA 2RH2A 1U1TA 5GMKm 3A98A 3M56A 2V26A 2HEQA 5KCOA 2CUBA 4F14A 1UECA 1UGPB 4BE2A 3OB9A 4PJOE 1AOJA 1G3SA 2JNGA 4F7UE 1YJWT 3HTRA 4RCCA 3CCEA 2RB6A 5LJ3e 5D6WA 1IZ6A 4ANJA 4P5NA 3AHUA 2YRVA 1M9SA 2HMAA 4FYWB 1TS9A 3RKYA 2KRNA 3JCMQ 2OTLQ 2WSCE 1GCPA 4BDZA 1BKBA 3VS5A 4C0GA 2RJEA 1X75C 3CCET 1OULA 2CP2A 3ZL7C 1SKUB 5FRNA 4MMLA 3JCMV 4FCYA 2DBMA 3QXEB 2VB6A 4HT8A 1ARKA 3PMIA 4DOWA 1TUDA 3A8GB 1VQLA 2K7AA 4Y28E 3L2ZA 2WSEE 4PNOA 1K9AA 2K5FA 1OPKA 1KD1C 3AT1B 5GAMd 1YWPA 1QVFP 3OYFA 5GANj 3PTAA 4E6RA 1IGQA 1SHFA 1QVFA 3MP1A 2M1HA 4R56A 5GANh 4BI3A 2CDTA 2FZGB 2JMCA 3I35A 5GAOm 1QVGP 4OMQA 2ZPEB 5CQYA 2COZA 1VQMT 2K57A 2L8DA 2EGCA 4C5GA 3E19A 4ZGEB 3T9NA 2KEAA 1S1NA 3NHNA 3P8HA 2GTJA 2HNIA 2A28A 2C06A 3SFMA 3LGLA 4ATOA 3UF4A 3CPWS 1X2QA 3EH1A 3MEUA 4J9FA 2RQVA 1GXIE 2KYMA 1WQ7A 5EG2A 4QVDA 1VQ4T 4XU3A 2I0NA 3CCLQ 1RI9A 5GMKh 1VQOT 2ECZA 1E6HA 3HFNA 4L59A 1UDLA 4RTWA 1EIFA 3JCMJ 2QDYB 2M9UA 4XAXB 3QKJA 1YIJQ 4XU2A 2EQUA 3VV0A 1FXXA 4DEYA 5KH6A 2EQKA 1RI0A 1BBZA 2XU8A 1VQNQ 2V8IA 1F1BB 2HL5C 3CC4A 4ORZA 1HSQA 4FIBA 2FRYA 1TG0A 2A37A 4EMHA 3HPWA 2VGMA 1HK9A 4D6WA 3CXCA 2GF7A 3J7AF 1G3WA 1XNIA 2L2PA 2VXFA 1M2VB 2AIRB 3KXTA 4F7UB 2MPXC 1VQ6T 2AKKA 1YJNQ 2IG0A 1M8VA 1VIEA 3WVDB 3OW2P 2Y90A 2CH4W 1RAEB 3THKA 5GJWB 2F69A 3HKSA 1MNEA 1RADB 1YWOA 4BY6B 2YDLA 2DVEA 3LH0A 1VIFA 1VQ7A 4PL6A 4MMKA 2DE0X 3M5AA 2J06A 3BDUA 4LE9A 2OI3A 4FM4B 2DZCA 4PK4A 3CCLA 4GY5A 3EGXB 1YJNA 2QEXT 1NJIC 1IB8A 2X3WD 1Y0MA 4F7UF 3JRZA 1U1SA 2KXDA 5KCHA 4RKUE 1K0XA 3JCMf 1QP3A 4FL6A 2E10A 4QQDA 2DYIA 2GCXA 5KYWB 3QWYA 1YHQT 4A4KA 2CP6A 4F16A 2CP5A 1WHKA 2F1LA 5D6XA 2EBPA 4KBMB 2ROTA 3BW1A 3A8MB 1G3YA 3HL8A 1VQLQ 2DLPA 2J6KA 1C0MA 2E41A 4NS5A 2RI3A 2V8KA 5I2MA 3L2WA 4DBRA 2EFIA 2HL3A 4HA8A 3JCMb 3ZFJA 4PLLA 2EJFA 4C8QG 1QWFA 3MKDA 1PD0A 4M78D 3M0UA 1CKAA 4CC4B 4C5EA 2XHCA 1M2OA 1LNXA 2E4HA 3EGUA 2EVRA 5KYXA 2XK0A 4RG8A 2EPDA 3GNFB 3SHWA 2RQRA 1WQWA 5KYYA 2HQXA 3H9NA 5KE2A 5LJ5e 1MV0B 2LVMA 1M27C 8AT1B 1AT1B 5FU6C 4KUDK 1G3TA 4C5HA 2X9HA 2IVWA 4Z89A 1IGUA 4FYYB 4AFSC 2DEQA 4M75C 2PU9B 2RI5A 1D3BA 1K4US 3FDRA 2O4XA 2EYYA 2BKDN 3LWHA 2XG8D 2E5KA 2SRCA 2KE9A 2VGNA 1N8RC 3SB2A 1AWOA 2OTJT 5A0LA 2ATCB 3NGPA 2HSEB 4QKUA 3PNWC 5GAMf 2YRCA 3CPFA 3PVLA 5CVIA 1B3QA 1Q7YC 3OYEA 2DF6A 3ASKA 3QSUA 4HCZA 2VASA 3M58A 2KRMA 3UDCA 2RM4A 2PVOB 1DJ7B 3CC2A 2MCNA 3UA6A 1MUZA 4KGXB 2MYSA 4KUIA 3CD6Q 5GAN2 2XI9A 4JRIA 3CC4Q 3I5RA 3RIRA 5LJ3h 1YJ9A 5KYWA 2DM1A 7AT1B 1JBMA 2FYKA 1VOMA 1D1BA 1T3LA 4EDUA 2E3HA 5FU6B 3OYBA 2V1QA 3V8KA 3EGDB 2RHYA 2EYQA 1EZZB 2MWPA 3CC2Q 1J3TA 4FYVB 3H0FA 2K5IA 1AHJB 1WHMA 1VQ5T 3QDFA 3GOXA 1Y71A 1I4K1 1K73U 3M0PA 5LJ5g 1MV3A 1WYXA 3CBOA 2FEIA 2E6ZA 2HDAA 3BE3A 1WJQA 4Q5WA 4F04B 2CS7A 4OMPA 3CCMQ 4EMGA 1ZSZB 1RAFB 1D1AA 1VQOQ 2NLUA 2Z0WA 1WHHA 2VWFA 2MIOA 4M77D 5GAOn 2RF0A 1BI3A 2JTEA 3ER0A 3NPFA 3VJPA 3HRTA 1IRXA 1IO6A 4M7AA 3R6OA 5GAMe 2JTFA 2DEUA 3V8LA 4RTXA 2A3LA 1OOTA 3VS7A 3GNGA 2Y4XA 3EFOB 3LX7A 4F17A 1N6AA 3VRZA 3RESA 4M77A 2DXCA 3L42A 5GAOq 3PE0A 4CC7A 2CZ0B 2QK0A 5LJ5h 3CMEQ 1IXDA 4M75E 2C0IA 2PZ1A 3VS6A 4F7UA 4XTUA 1YJNT 1Q7YU 1GBQA 3CCSA 1VYUA 2KSSA 4DA4A 1FWZA 3M4GA 1NEGA 2GTOA 2KI7A 2W10A 2OTLA 4LNPA 4DBFA 3TCJA 1JEGA 3F70A 4JRPA 1WI7A 3QZ9B 4FSXA 3G6ET 3VS3A 3H0HA 1MMAA 1ZSGA 2B86A 3INZA 4C8QA 1YITQ 1X6BA 5IXFA 1LJOA 4OMLA 4YTLA 2O9VA 4C92D 2LCCA 3OS0A 2QASA 3RNJA 3FJPA 1SRLA 3REAB 2RK1A 3GPLA 1QVPA 2WACA 1X6OA 2MK5A 1RLPC 3EG2A 2RJCA 2HD0A 2PQWA 3G4SQ 2KBTA 2KT8A 4XTZA 4N0AA 3D7SB 1I0CA 4LDXA 4PJMA 3QJYA 2RO0A 1LVKA 2XD0A 2KRSA 3DLMA 2BUDA 3EG3A 2DAQA 3JB9H 1KD1U 3QBYA 2X4WA 1RAIB 3A1PA 2CSQA 1VQ6A 3REBB 1Q86R 3CCMA 2ZAEA 4C8QF 4EPCA 5CQXA 1K76A 3M59A 3G4SA 1YJ9Q 3FC3A 3CMAQ 2R5AA 3KBGA 1D0YA 1WA7A 2HQHA 1ZA2B 4C92F 2V8JA 3U23A 3I56Q 1WXUA 1PKTA 4A4EA 2M16A 4A63B 2BE7D 1VQ7T 1FX7A 1OU8A 1K1ZA 2CH4A 2NUPB 2PNIA 3CD6A 4FSSA 2OAUA 4JJCA 2JUFA 3RERA 2J6FA 1H3ZA 4QW2A 4GLMA 5CKHA 5LJ5j 3OS2A 1K8AR 1MNDA 2M51A 3X20B 3OQ5A 3UATA 1LPLA 4HKEA 2CKKA 1H3HA 2O9SA 2C0TA 4HVWA 1KSWA 3EFRA 3L1AA 3DB4A 4FT4A 2MOXA 2RNAA 3OW2S 4NOYA 1H641 3L2UA 2MMPA 3CCQT 2V1RA 4MZMA 4OVAA 5KYXB 1M4ZA 2MF2A 3UWNA 3E2UA 1OZ2A 5A0GA 3CXCP 4JDSA 3R6NA 1I8FA 2FB7A 2F5KA 3VRYA 1D3BB 4ME7A 3E1SA 3G6EA 2GGRA 3CCST 1W4SA 1O9SA 3MEWA 2XICA 1QCOA 2P0KA 3G71T 2L3RA 1N8RU 1T0JA 2EW3A 3OYIA 4M77G 2L3QA 4NL2A 4J9IA 1A0NB 1NLOC 2ESWA 1SSFA 1N9RA 2GQVA 8ATCB 5LJ3j 2MI6A 1VQNT 4C0FA 4IUUA 2OX7A 5GAMh 3I55Q 3OBWA 1I5LA 2D6FA 2EIFA 3RR6A 1SRMA 2LRQA 3KUFA 2RD1A 4A54A 4O5VA 3X26B 4JZ3A 2P0PA 2EWNA 3H6ZA 4B9XA 2KVQG 5FW9A 3SEMA 1S72Q 2QQAA 1VUBA 2OTJA 2L3PA 3VKIA 1RAGB 5IH2A 4DEXA 2DJZA 2DX1A 4RMOA 1WDXA 1WFWA 5EC7A 3LYIA 2K5LA 4ELYC 4BI8B 2ED1A 2XIDA 3HHTB 1TXQA 2VC8A 3CCUT 1PG5B 3I56T 3MO8A 4QT7A 2XDDA 3QZ5B 2RK2A 1KQSP 2X4XA 3PMTA 4E2FB 4KULA 2CZ7B 1AZGB 3V7SA 2DL7A 4MDXA 1E6GA 2DTIA 1XQHA 1VQ9A 2OAWA 2E1HA 4IIOA 3FJ5A 3OW2A 1NJIU 4PJOF 2CT3A 4JRQA 1XJWB 3V8JA 2H3JA 1GRIA 5FWCA 4LDVA 1QMCA 3GLXA 2RQTA 4M75B 3PIOA 4M77B 3IQLA 1YCSB 4J83A 5FU7C 2MWOA 1OEBA 2QQRA 3L2VA 2L0AA 1MHNA 4NL3A 5KYUA 1VQ8A 2LNHB 1AWWA 1YHQA 1G83A 1M3CA 1Y96B 3FB9A 2J6OA 4IKFA 1TWBA 4BI4A 2QGFB 2MAMA 3JV3A 3I55A 3QDRB 2CGHA 2VKNA 1UUEA 2JT4A 3E9FA 2SEMA 1UHCA 1KG1A 2A0FB 2JOYA 4AT1B 3QPHA 2LX9A 3OA6A 4A53A 3G71A 2NUTA 1ZUUA 5I2SA 4M7AB 1NYGA 3ZBDA 2DTHA 1AD5A 1VQPA 3JCMW 3L2RA 1TU0B 3MJXA 2E12A 4B9WA 4XK8E 1AVZC 1ZBXA 2DTOA 4D8DA 3RMQA 1NBEB 4CI0C 2E3IA 1JXMA 2BZYA 3JB9D 2QEXQ 2DXUA 3S6WA 5IAYA 1RUWA 1WIEA 4C0DB 3EAEA 4HCBA 4HCKA 1YIJA 1GFCA 1YBYA 3VUBA 1UGRB 1UGSB 2EYWA 3M0QA 4TVRA 1N5ZA 1XTDA 2ZCFB 1UJYA 1Q82C 2FZCB 4Z02A 1I5OB 5IT9E 3EG0A 4IUVA 3RKXA 3M0SA 2JS2A 3CMEA 1S72T 1W2BP 3HRUA 4QVZA 2RHZA 1CSKA 1R8OB 4C5IA 2CYZB 2RA2A 4WCIA 1G2BA 2M0YA 4M78B 2DJQA 2VYTA 5GMKj 1OPLA 2O4XB 5GANg 4E7SA 1KD1R 2FPFA 1Q86U 2DRMA 1Z9QA 3TREA 3CBMA 3JCMP 3CC4T 2DERA 2J05A 2O31A 3CCUA 4J7FA 4RTVA 4ZN1A 4BUGA 5IHNA 4IUQA 3DLLA 3OY9A 2KNBB 2KK4A 1UEBA 2L89A 5CO7A 3NTIA 2R57A 2IIMA 4LUEA 2R5MA 4RCBA 5IN1A 1U8RA 1Q82R 4BY6C 2G3RA 2RQWA 1GBRA 3EGDA 1BI1A 2XDBA 4AG1C 3OYNA 1K73C 4M7AG 4X1VA 4Z8AA 3JCMX 1C6VX 3V7RA 4V2SA 3OSVA 3CCQA 3TU4K 1I1JA 4PJOG 1YP5A 3CCVT 5LJ3d 1M1KU 1IHVA 3S3OA 5IXBA 1VQOA 4MDWA 2QTVA 2BTTA 4EMKA 1VQ8T 5L8RE 2Y4YA 2DYBA
chains in the Genus database with same CATH topology
4YTLA 4EMKC 4C92D 2LCCA 3OS0A 2E5QA 4C92C 3AHUA 3FJPA 2YRVA 1M9SA 2FL7A 4ZN3A 3RKYA 4RG2A 2ZPIB 2RK1A 3JCMQ 5LJ3g 3X24B 3GPLA 1QVPA 5DM7R 2WACA 4E7IA 1X6OA 3JAME 2WSCE 4JS5A 3OYMA 5C6SA 4BDZA 4M7DA 2RJCA 4BACA 1BKBA 2HD0A 3P8BB 2PQWA 1B34A 2PUKB 2LCLA 1ZQ1A 4C0GA 2RJEA 2YLBA 1X75C 3CCET 5GAN5 2FVUA 4X34A 4N0AA 4XTZA 1W2BS 5HK0A 1N9SA 1YI2T 5HK3A 1K9MC 5FRNA 4MMLA 5LJ3f 2DD4A 4LDXA 4M78E 3JCMV 3UPUA 3QJYA 2RO0A 1PSFA 3QG1A 5DLQE 3QXEB 4HT8A 2XD0A 3PMIA 4OMFB 2P4TA 4DOWA 1QP2A 3OYCA 1XOVA 3A8GB 5GAMg 3PT9A 1VQLA 2BIVA 3DLMA 2BUDA 2GFAA 4Y28E 1QW1A 1OYXA 1YITT 2DAQA 3L2ZA 3JB9H 4IUTA 2WSEE 1KD1U 4PNOA 2M0OA 2VUBA 3QBYA 1VQMA 2K5FA 2EJGA 5GMKi 1BI2A 2X4WA 1KD1C 1NZ9A 1VQ6A 2KQWA 2R58A 3CCMA 5GAMd 4C8QF 4EPCA 5CQXA 1KHCA 2PUOB 4Y91A 3M59A 5CR2A 3OYFA 3G4SA 3PTAA 3HP9A 3S3NA 3FC3A 5GANj 3VUZA 4QQ6A 4N0AC 2R5AA 1QVFA 3KBGA 3MP1A 2M1HA 4R56A 5HKCA 4C92F 2V8JA 5GANh 2LT4A 2RHXA 4XTVA 2I2LA 4BI3A 4E47A 1YIJT 3MHXA 5A0DA 3G4ST 3CCJA 5GAN8 3VYHB 2M16A 4A4EA 2QEXA 1G5VA 1VQ7T 1FX7A 4FT2A 5FLXE 3RKWA 4N4IA 3QUIA 5GAOm 3CD6A 2ZPEB 4ZGDB 2OAUA 5CQYA 2JUFA 2RJFA 1VQMT 4L6V5 2K57A 2L8DA 2P0QA 4C5GA 3RERA 1H3ZA 3E19A 3E9GA 3FRNA 4QW2A 3T9NA 2EAYA 4ZGEB 5CKHA 5LJ5j 3OS2A 3P8HA 3SWNA 1P92A 2HNIA 4C92G 2C06A 3X20B 3GP8A 3H8ZA 3OQ5A 3SFMA 3LGLA 4PJOD 4ATOA 4ELZC 2XDPA 3CPWS 4HKEA 2CKKA 2D0QB 2ZZDA 4PJOB 2QQBA 3MEUA 2EKOA 2ZGWA 4R55A 1GXIE 2RJDA 1WQ7A 2JN0A 5EG2A 4QVDA 3I55T 1VQ4T 1JRIA 3EFRA 4XU3A 5CKDA 1NE8A 5GMKh 1VQOT 3L1AA 3DB4A 3HFNA 4FT4A 4L59A 1M1KC 2LNVA 2RI2A 1WGSA 3OW2S 1EIFA 4NOYA 3JCMJ 2QDYB 4OB0B 1H641 2DD5A 2M9UA 5CKEA 3L2UA 2MMPA 4XAXB 3QKJA 4BD3A 4XU2A 2EQUA 5CIUA 1FXXA 3VV0A 4KT0E 5KH6A 3CMET 3CCQT 1S72A 2EQKA 1RI0A 4MZMA 2XU8A 2LC4A 3OSSC 4OVAA 4PLIA 3CCRT 1M4ZA 2MF2A 2V8IA 1KQSS 3UWNA 1YI2A 1WNLA 3CC4A 5KE3A 4FIBA 3LWIA 2QTXA 2EJ9A 3HRSA 4C92A 4A4HA 1OZ2A 4EMHA 5A0GA 1LOJA 3MCAB 4JDSA 3HPWA 2DXTA 3OYDA 2VGMA 3QO3A 1HK9A 4D6WA 3CMAT 4JRKA 1YJWA 1Q82U 1I8FA 3CXCA 5CKBA 2FB7A 2F5KA 2GF7A 2AHJB 1D3BB 4JLIA 3I56A 1KQSA 2K3XA 4ME7A 3E1SA 3J7AF 1G3WA 1XNIA 3G6EA 1PSEA 3OYYA 4L5GA 2VXFA 4M77C 3CCLT 3CCST 3JSCA 3KXTA 4LDWA 1W4SA 2E70A 1O9SA 3WXMB 4F7UB 3MEAA 3OMGA 1VQ6T 3ME9A 5GAN3 4J6WA 3MEWA 2IG0A 3MEVA 2XICA 2P0KA 3G71T 2DPPB 3NFCA 1M8VA 1VIEA 2L3RA 4JLGA 3WVDB 2Y90A 1N8RU 4LDYA 5CAIA 5DLOA 1VQ5A 2X4JA 5GAOl 2E64A 1VQ9T 2ZPHB 3OYIA 4M77G 4J6YA 3OYLA 2F69A 2KY9A 3HKSA 4NL2A 4WF2A 2DIQA 3C12A 4M7AF 4BY6B 1SSFA 3CPWA 1N9RA 2GQVA 2B8AA 5J26A 2MI6A 5LJ3j 4C8QC 2DVEA 1KQ2A 1VQNT 3LH0A 1VIFA 2RHUA 3LW5E 4IUUA 4C0FA 1VQ7A 2DIGA 4IUPA 2K3YA 5GAMh 4BE0A 1B34B 3OBWA 4PL6A 2CZ1B 3EFSA 4MMKA 1I5LA 2D6FA 4X9CA 1VQLT 2EIFA 4OB3B 3M5AA 4PKCC 3M57A 3QYGB 2LRQA 2LTOA 4M78A 1WPYA 2RD1A 3KUFA 3QHSA 4A54A 1TH7A 4ZGJB 2KAFA 4M77F 3BDUA 4O5VA 3X26B 3JB9F 2P0PA 4FM4B 4BB7A 2EWNA 4OGCA 2DZCA 3CCLA 4M7AD 4GY5A 3H6ZA 1YJNA 1Y7XA 2JZ2A 2QEXT 1NJIC 4B9XA 3OYHA 2KVQG 4F7UF 3OYGA 3JRZA 2E65A 4J8OA 1U1SA 2K2VA 2QQAA 1MGQA 4FU6A 5KCHA 5GANf 4PJOA 1VUBA 1Q81C 1M90U 4RKUE 3SDZA 3CEYA 2OTJA 3JCMf 1QP3A 4FL6A 3VKIA 4JJNK 2E10A 4QQDA 3JB9G 2GCXA 2ZPBB 1K8AU 1KC8C 1YHQT 4J7IA 2DJZA 3LLRA 2RHIA 4A4GA 1OZ3A 4A4KA 2PVGB 4F7UG 3CC7A 5CKFA 5J3BA 4RMOA 1RL2A 2QA4A 5LL6S 2PVDB 1VQKA 1VQPT 1YITA 4XTYA 3J81E 2VV5A 1WJRA 3LYIA 4M78G 4XTWA 5D6XA 4KBMB 3JCMh 2K5LA 3META 4ELYC 3BW1A 3A8MB 1G3YA 3UT1A 3JCMg 4BI8B 3ZEHA 3HL8A 4M75F 1YJ9T 2QQSA 3FEOA 4OP0A 2DO3A 2XIDA 5FROA 4M7AC 3HHTB 1KHIA 2EQMA 2VC8A 4M78F 3CCVA 3OYKA 2E41A 2JTMA 3CCUT 3I56T 4M7DG 4NS5A 3SWNB 2FHDA 2QI2A 2RI3A 3MO8A 2V8KA 2KDSA 5I2MA 3CXCS 4M7DE 1UGQB 3L2WA 2X35A 2XDDA 2EFIA 2GFUA 3FLGA 3P8DA 5GAOr 3QZ5B 4HA8A 4J6XA 2RK2A 4C0ZA 2QA4T 1VQKT 3JCMb 2X4XA 1IREB 3MP6A 3PMTA 4KULA 4M75D 1BIBA 4PLLA 2CZ7B 3ZFJA 1K9MU 2EJFA 4C8QG 5CCAA 5GAN7 3V7SA 4HCCA 4M78D 4EMKB 4MDXA 3M9QA 5AYFA 4HT9A 2DTIA 1XQHA 4C5EA 1VQ9A 4MZTA 2XHCA 2E1HA 1LNXA 4QVCA 3OW2A 1NJIU 4PJOF 4JRQA 5D6YA 1Q86C 4XU0A 3V8JA 2XK0A 5FU7B 3JB9I 4RG8A 2H3JA 3GNFB 4J5YA 3CD6T 4LDVA 1WQWA 2HQXA 3GLXA 5KE2A 5M9OA 3PIPA 5LJ5e 4M75B 3PIOA 2LVMA 3CCJT 1O75A 2DKGA 4M77B 1JJ2S 5GMKl 5FU6C 4J83A 5FU7C 1JB0E 5J39A 2MWOA 2QQRA 3L2VA 4KUDK 1G3TA 4C5HA 2IVWA 3OBYA 3CMAA 2DEQA 3NTHA 5HY6A 1NPRA 1MHNA 4NL3A 4M75C 1QVGS 2JVVA 2PU9B 2RI5A 3CC2T 1D3BA 1VQ8A 3FDRA 2O4XA 1YHQA 2BKDN 3A8OB 1Q81U 1Y96B 2XG8D 3LWHA 3C95A 2XKOC 3FB9A 2VGNA 5GAN4 1N8RC 3SB2A 5GANe 4IKFA 2QXFA 2OTJT 3M55A 1M1GA 3WVEB 5A0LA 3BDLA 1X01A 4PJOC 4LD9K 1KQ1A 5LJ5d 3PNWC 4BI4A 5GAMf 3CPFA 2D9TA 1QVFS 3BFMA 2MAMA 1YCYA 5CVIA 3JCMc 1Q7YC 4C8QD 5DY9A 4DOVA 3OYEA 3I55A 3ASKA 1VQ4A 3QDRB 3QSUA 4HCZA 2CGHA 4MZPA 2K4YA 3CCMT 3E9FA 4C8QB 4BDYA 2LQKA 3QYHB 3M58A 1KG1A 3G7ZA 2JOYA 3QPHA 3UDCA 2RM4A 2PVOB 4E7LA 1DJ7B 3CC2A 2O01E 3SD4A 3OS1A 1M5Q1 3OS5A 4M7DD 4C8QE 2LX9A 3OA6A 4A53A 3DB3A 3C94A 3OYAA 3G71A 1K8AC 5CK9A 5I2SA 4M7AB 1WJSA 4KUIA 4QQGA 3ZBDA 2DTHA 3V7CA 2LDMA 2X4YA 1VQPA 3M54A 3JCMW 5GAN2 3L2RA 2XI9A 2KMTA 4JRIA 4C92E 2F5TX 3JCMd 4IURA 3RIRA 2HQEA 5LJ3h 2E12A 3CBPA 4B9WA 1I81A 4XK8E 1ZBXA 1YJ9A 2DTOA 3QJ6A 4M75A 4A4FA 3RMQA 1JBMA 1W2BA 2FYKA 1HXDA 4XQ3A 4CI0C 4EDUA 1ZHIA 5FU6B 3OYBA 3M4YA 3JB9D 3V8KA 2DXUA 4UC4A 3S6WA 2RHYA 5IAYA 2EYQA 1KC8U 2MWPA 1OI1A 4C0DB 3EAEA 3J80E 4HCBA 2K5IA 1AHJB 1YIJA 1YBYA 3VUBA 3RUXA 1UGRB 3PFSA 4M78C 4XTXA 1M90C 4M7AE 1UGSB 1VQ5T 3GF5A 4TVRA 1XTDA 3GOXA 4BE1A 4OF1A 2HBPA 4X9DA 1Y71A 1I4K1 2ZCFB 1K73U 2YHTA 1Q82C 3N5BB 4Z02A 5LJ5g 3L2QA 3CBOA 2E6ZA 3X28B 5A2QE 2EQJA 5IT9E 1Y07A 4JUVA 4II1A 2A7YA 1WJQA 4IUVA 4Q5WA 3SWNC 3CCRA 3RKXA 2CS7A 5C0MA 4M75G 3CMEA 1S72T 1BI0A 4EMGA 2WSFE 2ZPGB 2ZPFB 3HRUA 3JB9J 4QVZA 2RHZA 1R8OB 2NLUA 3NTKA 4C5IA 2CYZB 2RA2A 4M78B 4M7DC 4JS4A 4M77D 5GAOn 2VYTA 1Y96A 4ZTFA 3JCMe 1BI3A 5GMKj 3ER0A 2VXEA 2O4XB 3RMSA 5GANg 3VJPA 2L5QA 3HRTA 3X25B 4C0DC 4M7AA 3R6OA 5GAMe 1Q86U 3TREA 3Q1JA 3CBMA 2JTFA 3JCMP 3V8LA 3QIIA 3OMCA 3URGA 3CC4T 2A3LA 3CCUA 1M1FA 4J7FA 3MP8A 3GNGA 2Y4XA 3O8VA 3LX7A 3PGGA 4LDUA 4BUGA 4ZN1A 1N6AA 1UB4A 2CZ6B 2OTLT 3RESA 3M53A 4IUQA 4M77A 4OGEA 3DLLA 2YLCA 2DXCA 3L42A 4N4GA 3VU3C 5I21A 5GAOq 3OY9A 5GMKe 3OYJA 3S3MA 2CZ0B 5GANd 2KK4A 4ZTJA 1UEBA 2L89A 5CO7A 3NTIA 5GAMj 2R57A 4DQ2A 5LJ5h 3A8LB 4M75E 4OB2B 2R5MA 4CRIA 5GAOp 4RCBA 3C4SA 3HSBA 5IN1A 1U8RA 2LQ8A 3A5ZB 1V29B 4F7UA 1N27A 4XTUA 4BY6C 3TEEA 4O6JA 2G3RA 4N4HA 5GAN6 1YJNT 3GIBA 1Q7YU 2HAXA 2QQ9A 3CCSA 3VYGA 4M7DF 2KSSA 3BY7A 3LGFA 2E6NA 5LJ5f 4DA4A 4E7KA 4GLKA 1BIAA 1FWZA 1BI1A 2LT1A 3M4GA 4LD6A 2XDBA 3OYNA 4XU1A 1QVGA 3DKMA 1K73C 2RH2A 1U1TA 4M7AG 4C92B 5GMKm 2OTLA 3JCMX 2DXBA 3V7RA 4VUBA 3FIFA 4V2SA 3OSVA 4OB1B 3M56A 3CCQA 3TU4K 3TCJA 4E7JA 2DZ9A 1VQNA 4PJOG 3F70A 4JRPA 4M77E 3HFOA 3QZ9B 5KCOA 4FSXA 3CCVT 1JJ2A 3G6ET 1NPPA 5LJ3d 1M1KU 5FRMA 4E7HA 3CC7T 1UGPB 1BYMA 4BE2A 3OB9A 3S3OA 4PJOE 1VQOA 1G3SA 2JNGA 4MDWA 4F7UE 3INZA 4C8QA 1YJWT 4RCCA 3CCEA 1LJOA 4M7DB 4EMKA 1VQ8T 3A8HB 2RB6A 5L8RE 2DK3A 5D6WA 5LJ3e 2Y4YA 1IZ6A 4P5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LCC A;  2EQK A;  1RI0 A;  2E5Q A;  3OS0 A;  4OVA A;  4PLI A;  4UC4 A;  3S6W A;  2RHY A;  2X35 A;  2YRV A;  5IAY A;  3L2W A;  2EFI A;  2GFU A;  1OI1 A;  2MWP A;  3EAE A;  3FLG A;  3P8D A;  3UWN A;  5KE3 A;  4RG2 A;  2X4X A;  3MP6 A;  1OZ2 A;  3PMT A;  4PLL A;  2WAC A;  4A4H A;  4E7I A;  3PFS A;  3OYD A;  3OYM A;  5C6S A;  4BDZ A;  3GOX A;  4BE1 A;  2RJC A;  3M9Q A;  4BAC A;  2F5K A;  2GF7 A;  2PQW A;  2K3X A;  4C5E A;  2RJE A;  4Z02 A;  1XNI A;  3L2Q A;  4X34 A;  2EQJ A;  5D6Y A;  4II1 A;  2XK0 A;  1WJQ A;  4IUV A;  4Q5W A;  5FRN A;  3MEA A;  3OMG A;  2EQU A;  3ME9 A;  5C0M A;  2RO0 A;  3MEW A;  2IG0 A;  3MEV A;  2HQX A;  2P0K A;  3PMI A;  5KE2 A;  5M9O A;  2L3R A;  4QVZ A;  2RHZ A;  3OYC A;  2LVM A;  2BIV A;  2NLU A;  2BUD A;  2GFA A;  3DLM A;  3NTK A;  4C5I A;  1OYX A;  3OYI A;  2DAQ A;  5J39 A;  3OYL A;  2MWO A;  2VYT A;  2QQR A;  4IUT A;  3L2V A;  4ZTF A;  4C5H A;  2DIQ A;  2M0O A;  2O4X B;  3QBY A;  1SSF A;  2B8A A;  5J26 A;  2X4W A;  3NTH A;  3LH0 A;  1MHN A;  3Q1J A;  2RHU A;  2JTF A;  4IUU A;  2DIG A;  3QII A;  2R58 A;  2RI5 A;  2K3Y A;  3OMC A;  4IUP A;  4PL6 A;  4BE0 A;  3FDR A;  2O4X A;  2BKD N;  1KHC A;  3MP8 A;  3O8V A;  3OYF A;  3LX7 A;  3S3N A;  3FC3 A;  4QQ6 A;  2LRQ A;  2LTO A;  4IUQ A;  3KUF A;  4IKF A;  2R5A A;  4N4G A;  3L42 A;  3OY9 A;  3MP1 A;  2M1H A;  3OYJ A;  3S3M A;  3BDL A;  4ZTJ A;  2L89 A;  2RHX A;  3NTI A;  2R57 A;  3H6Z A;  4GY5 A;  3PNW C;  4A4E A;  2M16 A;  2R5M A;  2JZ2 A;  4CRI A;  2D9T A;  3C4S A;  1G5V A;  4B9X A;  3OYH A;  5IN1 A;  3OYG A;  3OYE A;  4N4I A;  3ASK A;  1N27 A;  4HCZ A;  2G3R A;  2RJF A;  4N4H A;  2L8D A;  3E9F A;  4FU6 A;  4C5G A;  5KCH A;  4BDY A;  1H3Z A;  3E9G A;  4QW2 A;  3OS2 A;  3CEY A;  3LGF A;  3P8H A;  2E6N A;  4E7K A;  4E7L A;  4FL6 A;  4LD6 A;  4NS5 A;  3H8Z A;  3OQ5 A;  4QQD A;  3SD4 A;  3LGL A;  3OS1 A;  3OYN A;  2XDP A;  3OA6 A;  3DB3 A;  3OYA A;  2CKK A;  3LLR A;  2RHI A;  4A4G A;  1OZ3 A;  3MEU A;  1WJS A;  2EKO A;  4QQG A;  3OYB A;  4E7J A;  2LDM A;  2X4Y A;  3F70 A;  3L2R A;  3LYI A;  1WJR A;  2RJD A;  5D6X A;  5KCO A;  4IUR A;  3MET A;  2HQE A;  5FRM A;  4E7H A;  3UT1 A;  4B9W A;  4BE2 A;  3OB9 A;  3ZEH A;  3S3O A;  3MO8 A;  2QQS A;  3FEO A;  3DB4 A;  3QJ6 A;  4A4F A;  4L59 A;  2RI2 A;  1WGS A;  5FRO A;  2EQM A;  3OYK A;  4EDU A;  3L2U A;  5D6W A;  3QKJ A;  4BD3 A;  5CIU A;  2FHD A;  5KH6 A;  2RI3 A; 
#chains in the Genus database with same CATH topology
 2E5Q A;  2GBQ A;  4AFZ C;  1UFF A;  4ZN3 A;  4RG2 A;  2JM9 A;  2L3S A;  5LJ3 g;  3X24 B;  2IPO B;  1VQM Q;  3JAM E;  1V76 A;  3TSZ A;  3VS1 A;  4M7D A;  3P8B B;  2HBW A;  1PKS A;  2LCL A;  2K3B A;  2QG9 B;  5GAN 5;  4X34 A;  1OU9 A;  2KYB A;  5HK0 A;  1UG1 A;  1K9M C;  1EX4 A;  2DD4 A;  2NWM A;  3UPU A;  5DLQ E;  1PSF A;  2DL4 A;  4J9C A;  4OMF B;  2P4T A;  1XOV A;  4LUD A;  3PT9 A;  2GFA A;  2F2X A;  1OYX A;  1YIT T;  4AFU C;  4IUT A;  2BZX A;  1VQM A;  2F2W A;  1NZ9 A;  1FMW A;  2KQW A;  2RN8 A;  1NG2 A;  2AK5 A;  1QQJ A;  2PUO B;  4M7D B;  5CR2 A;  3S3N A;  3HP9 A;  3VS2 A;  3VUZ A;  4QQ6 A;  4N0A C;  1HYO A;  1PRL C;  5HKC A;  2YXY A;  2EGE A;  2I2L A;  1YIJ T;  3VYH B;  2QEX A;  2P4R A;  1G5V A;  5FWB A;  1IHW A;  4FT2 A;  3RKW A;  2QA4 Q;  3QUI A;  2RJF A;  4L6V 5;  1ABQ A;  3E9G A;  3FRN A;  3CPW P;  4KH1 B;  3SWN A;  3ULR B;  3GP8 A;  2YUN A;  2XDP A;  2ZZD A;  1HJD A;  4PJO B;  2QQB A;  2EKO A;  4R55 A;  4KH0 B;  2RJD A;  1PCX A;  2JN0 A;  1JRI A;  2JS0 A;  1NE8 A;  3CCJ Q;  2LNV A;  1NEB A;  2RI2 A;  1WGS A;  1WXT A;  1U06 A;  4OB0 B;  2DD5 A;  1JXO A;  4BD3 A;  3CME T;  5AT1 B;  1S72 A;  4KT0 E;  2GQI A;  3OSS C;  2LC4 A;  4PLI A;  3CCR T;  1YI2 A;  1ZUK A;  5KE3 A;  3HRS A;  4GBQ A;  4AMC A;  3MCA B;  2YSQ A;  2XMF A;  3OYD A;  2DXT A;  3QO3 A;  2HKN A;  1PM3 A;  1BCO A;  5KYU B;  3I56 A;  1FYN A;  2K3X A;  1PSE A;  4L5G A;  4M77 C;  3JSC A;  1ZBJ A;  4LDW A;  2E70 A;  2LCS A;  2EKH A;  2G6F X;  3CCV Q;  3MEV A;  3NFC A;  4LDY A;  3UA7 A;  2CT4 A;  5DLO A;  3EG9 B;  4KRT A;  1VQ5 A;  2X4J A;  2E64 A;  2FZK B;  1VQ9 T;  1M1K R;  2ZPH B;  4J6Y A;  5IHI A;  3OYL A;  2KY9 A;  3C12 A;  4M7A F;  3CPW A;  3CCQ Q;  5J26 A;  1KQ2 A;  2RHU A;  2ROL A;  4IUP A;  2K3Y A;  1VQ4 Q;  1B34 B;  3RBB B;  1H92 A;  2LZ6 B;  3EFS A;  3CC7 Q;  4X9C A;  5KYN A;  4OB3 B;  1GCQ C;  1PD1 A;  4PKC C;  3M57 A;  1PC0 A;  1JU5 C;  5L23 A;  4ZGJ B;  2YUP A;  2QYZ A;  4Y92 A;  1Y7X A;  1HD3 A;  1WHJ A;  2RMO A;  2K2V A;  1MGQ A;  4FU6 A;  1Q81 C;  4HVV A;  3JB9 G;  1B7T A;  2ZPB B;  1SSH A;  1KC8 C;  1NLP C;  5I22 A;  3LLR A;  4A4G A;  3CC7 A;  5CKF A;  5LL6 S;  1VQK A;  1VQP T;  1YIT A;  3M0R A;  4XTY A;  1WJR A;  3JCM h;  3EGX A;  3G71 Q;  2LJ1 A;  3UT1 A;  3ZEH A;  4M75 F;  1D1C A;  1X27 A;  4OP0 A;  1YJ9 T;  4JZ4 A;  2DO3 A;  1BU1 A;  2QAZ A;  1EFN A;  4PFP A;  3OYK A;  3CCV A;  1Q81 R;  2JTM A;  2AKL A;  2H8H A;  4M7D G;  3SWN B;  1GCQ A;  1OV3 A;  3CXC S;  1UGQ B;  2X35 A;  1VQ7 Q;  5GAO r;  3FLG A;  1KC8 R;  4J6X A;  1ZX6 A;  1VQK T;  1BIB A;  4ZNX A;  5GAN 7;  4K11 A;  4HCC A;  5AYF A;  4HT9 A;  2AT1 B;  1WXB A;  4MZT A;  2DET A;  5D6Y A;  1JO8 A;  4XU0 A;  5FU7 B;  4J5Y A;  1ABO A;  1MMD A;  5M9O A;  2X3X D;  1QKW A;  2DKG A;  2DL3 A;  5GMK l;  2LMJ A;  1CKB A;  3NTH A;  2JVV A;  3CC2 T;  1SPK A;  3A8O B;  1Q81 U;  2KXC A;  3M0T A;  1QLY A;  2BE9 B;  1KQ1 A;  5ECA A;  3EFO A;  1QVF S;  3JCM c;  1YCY A;  4J9E A;  1TOV A;  1TUC A;  1VQ4 A;  3EHR A;  4MZP A;  3CCM T;  2LQK A;  3QYH B;  4M4Z A;  1YN8 A;  2O01 E;  1KFZ A;  3OS1 A;  2K6D A;  1M5Q 1;  3GBQ A;  4C8Q E;  1N8R R;  2CRE A;  3C94 A;  4JPB W;  1BK2 A;  1WJS A;  4QQG A;  2DA9 A;  3LH5 A;  1VYT A;  2KMT A;  1E7O A;  4C92 E;  1WX6 A;  4IUR A;  2HQE A;  2QDL A;  4ESR A;  1I81 A;  2F2V A;  1BB9 A;  4A4F A;  1WLP B;  2M02 A;  1HXD A;  1SEM A;  3M4Y A;  1KIK A;  1D0X A;  1RAA B;  4UC4 A;  1KC8 U;  4KGV B;  1OI1 A;  3J80 E;  1K9M R;  2JW4 A;  2NUP A;  3PFS A;  4M7A E;  4M78 C;  1TSF A;  1M90 C;  1SF9 A;  4OF1 A;  2HBP A;  1D09 B;  4X9D A;  2RQU A;  1JJ2 P;  2YHT A;  3N5B B;  3L2Q A;  2EYZ A;  2EQJ A;  1Y07 A;  4JUV A;  4II1 A;  4LXC A;  1YFN A;  3SWN C;  1M3A A;  1PWT A;  2WSF E;  2PTK A;  2ZPG B;  1X43 A;  3NTK A;  1QCF A;  2KGT A;  1RLQ C;  1WHG A;  4M7D C;  4JS4 A;  1Y96 A;  4ZTF A;  1QWE A;  2L5Q A;  4C0D C;  4PFO A;  4DBQ A;  1D0Z A;  3EG1 A;  3OMC A;  3URG A;  2O2O A;  3MP8 A;  3O8V A;  2OTL T;  1MMG A;  2CUD A;  2CZ6 B;  2NUZ A;  3M53 A;  1VQ5 Q;  2BZ8 A;  4N4G A;  1YJW Q;  3EG9 A;  5GMK e;  2CP7 A;  3S3M A;  5GAN d;  3RDV A;  1TTH B;  2ABL A;  1ZSZ A;  5GAM j;  3A8L B;  4OB2 B;  5GAO p;  3HSB A;  3C4S A;  2DVJ A;  2HKQ B;  1VQK Q;  3TEE A;  4O6J A;  4N4H A;  3GIB A;  1NJI R;  2K79 A;  1BCM A;  3VYG A;  1ZA1 B;  5LJ5 f;  2CP3 A;  4E7K A;  1BIA A;  2LT1 A;  1QVG A;  4C92 B;  2DXB A;  4VUB A;  3FIF A;  2ED0 A;  4OB1 B;  4E7J A;  4PFZ A;  2DZ9 A;  4JJD A;  1VQN A;  1AWX A;  4M77 E;  3HFO A;  1JJ2 A;  1K0S A;  2D8H A;  1NPP A;  5FRM A;  4E7H A;  3CC7 T;  1BYM A;  2FPE A;  1W70 A;  1I07 A;  4J9G A;  3A8H B;  1MMN A;  2DK3 A;  3KFV A;  4EMK C;  4C92 C;  1TUG B;  3H0I A;  2FL7 A;  2ZPI B;  4E7I A;  5DM7 R;  2YT6 A;  4JS5 A;  3OYM A;  5C6S A;  4BAC A;  1OQK A;  2O88 A;  1B34 A;  2PUK B;  1ZQ1 A;  2YLB A;  2FVU A;  1W2B S;  4R0K A;  3TQ7 P;  1N9S A;  2LJ3 A;  2DMO A;  1GL5 A;  1YI2 T;  5HK3 A;  2JM8 A;  5LJ3 f;  2YRD A;  4M78 E;  3QG1 A;  3G6E Q;  1QP2 A;  3OYC A;  5GAM g;  2BIV A;  1QW1 A;  2FPD A;  1H8K A;  2HCK A;  2YUO A;  1YHQ Q;  2COW A;  2D8J A;  2M0O A;  2VUB A;  2EJG A;  5GMK i;  1M8M A;  1BI2 A;  4RTZ A;  3I5S A;  2DL5 A;  3H41 A;  2R58 A;  1PRM C;  1WHL A;  1KHC A;  1PHT A;  4Y91 A;  2LJ0 A;  4CC3 A;  1SG5 A;  1ZLM A;  2LT4 A;  2RHX A;  4XTV A;  2FG0 A;  4E47 A;  3MHX A;  5A0D A;  3G4S T;  2J7I A;  3CCJ A;  5GAN 8;  2JXB A;  3CCS Q;  1RAB B;  1X69 A;  3O5Z A;  5FLX E;  4N4I A;  4RTY A;  1UHF A;  4ZGD B;  2P0Q A;  2QGG A;  2D1X A;  1RAH B;  2EAY A;  1P92 A;  4C92 G;  2K2M A;  3H8Z A;  2P84 A;  2EYX A;  4PJO D;  2YUQ A;  4ELZ C;  2D0Q B;  2DNU A;  4PJJ A;  2JJ9 A;  3TVT A;  2ENM A;  1OX9 A;  2ZGW A;  1UJ0 A;  4LN2 A;  4FW2 A;  3I55 T;  1M30 A;  3EH2 A;  5CKD A;  1M1K C;  2K9G A;  5CKE A;  4OMN A;  5CIU A;  2KR3 A;  4E7Z A;  2RPN A;  1KQS S;  1T0H A;  1WNL A;  3LWI A;  2QTX A;  2EJ9 A;  4C92 A;  4A4H A;  1LOJ A;  2JMA A;  1RAC B;  5IHK A;  4OMM A;  3CMA T;  1PNJ A;  3G1J A;  4JRK A;  1YJW A;  1Q82 U;  2OTJ Q;  5CKB A;  2AHJ B;  1KQS A;  4JLI A;  1M90 R;  4AG2 C;  3OYY A;  3NMZ C;  3WXM B;  2LQW A;  3MEA A;  3OMG A;  4OMO A;  3ME9 A;  5GAN 3;  4J6W A;  2CSI A;  2DPP B;  4JLG A;  4IIM A;  5CAI A;  4J9H A;  2A36 A;  5GAO l;  5KYY B;  5GJV B;  4WF2 A;  2DIQ A;  2B8A A;  4C8Q C;  3CCR Q;  3LW5 E;  3TSW A;  2DIG A;  4BE0 A;  2EGA A;  2CZ1 B;  4FW1 A;  1VQL T;  1VA7 A;  3QYG B;  4M78 A;  2LTO A;  1WPY A;  3QHS A;  2DBK A;  1TH7 A;  2KAF A;  4J9D A;  4M77 F;  3JB9 F;  1C1A A;  4BB7 A;  1JQQ A;  3CCU Q;  4OGC A;  4M7A D;  3C0C A;  2LX7 A;  2JZ2 A;  3OYH A;  1YI2 Q;  3OYG A;  2E65 A;  4J8O A;  4B6M A;  4PJL A;  1K73 R;  4PJO A;  5GAN f;  1M90 U;  3SDZ A;  3CEY A;  4Z88 A;  4JJN K;  1K8A U;  3CCE Q;  2X51 A;  4J7I A;  2RHI A;  1OZ3 A;  4F7U G;  2PVG B;  3I9Q A;  5J3B A;  1RL2 A;  2OJ2 A;  2QA4 A;  2PVD B;  3J81 E;  2VV5 A;  4M78 G;  4KGZ B;  4XTW A;  3MET A;  1M3B A;  3QWX X;  3JCM g;  6AT1 B;  2QQS A;  3FEO A;  2NUT B;  5FRO A;  4M7A C;  4JJB A;  1UTI A;  1KHI A;  2EQM A;  4M78 F;  4HXJ A;  4WTO B;  2FHD A;  2QI2 A;  1NM7 A;  2KDS A;  4M7D E;  2LQN A;  2GFU A;  3P8D A;  2AZV A;  2QA4 T;  4C0Z A;  1R77 A;  1IRE B;  3MP6 A;  4M75 D;  1K9M U;  3MPU B;  2H3E B;  5CCA A;  2W0Z A;  1T3S A;  4EMK B;  5I11 A;  1W1F A;  3M9Q A;  2CP0 A;  2C0O A;  1X6G A;  1V1C A;  4QVC A;  1Q7Y R;  2VVK A;  1OX8 A;  1Q86 C;  3JB9 I;  1SHG A;  3CD6 T;  1VQP Q;  2KRO A;  2DFU A;  3PIP A;  3CCJ T;  1O75 A;  1Y57 A;  1JJ2 S;  1JB0 E;  5J39 A;  2A08 A;  3OBY A;  3CMA A;  5HY6 A;  1QKX A;  1NPR A;  1QVG S;  2AZS A;  1ZUY A;  9ATC B;  3C95 A;  2XKO C;  1M2V A;  5GAN 4;  5D7U A;  1R0C B;  5GAN e;  2QXF A;  3M55 A;  1M1G A;  3WVE B;  2HZY A;  3BDL A;  1X01 A;  4PJO C;  2DIL A;  4LD9 K;  5LJ5 d;  1AZE A;  4AFQ C;  1FMV A;  2D9T A;  3BFM A;  4C8Q D;  5DY9 A;  4DOV A;  2K4Y A;  4BDY A;  4C8Q B;  2FO0 A;  3G7Z A;  3PVQ A;  3EHQ A;  2DL8 A;  4E7L A;  3SD4 A;  3OS5 A;  4M7D D;  1VQ9 Q;  1U5S A;  1KK7 A;  3DB3 A;  3OYA A;  1K8A C;  5CK9 A;  3V7C A;  2FRW A;  2LDM A;  2X4Y A;  3M54 A;  1VQ6 Q;  2F5T X;  3JCM d;  3CBP A;  2KT1 A;  1Q95 G;  3QJ6 A;  4M75 A;  1FMK A;  2NYS A;  1W2B A;  4XQ3 A;  3VS4 A;  1ZHI A;  5HCK A;  4RTU A;  3RUX A;  1YNZ A;  4XTX A;  2LP5 A;  3GF5 A;  1AEY A;  4D8K A;  1Z9Z A;  4BE1 A;  1ZSZ C;  4J9B A;  4RUG A;  1VYV A;  1ACM B;  3X28 B;  5A2Q E;  2D0N A;  2A7Y A;  3CCR A;  1U3O A;  2HSP A;  5C0M A;  4M75 G;  1BI0 A;  2ZPF B;  3JB9 J;  4PJN A;  4EIK A;  1VQ8 Q;  3JCM e;  1GFD A;  2VXE A;  2YWW A;  3RMS A;  3X25 B;  1UGV A;  2COY A;  3Q1J A;  3QII A;  4HVU A;  1NYF A;  1M1F A;  4LDU A;  3PGG A;  3CCL T;  1UB4 A;  4FYX B;  4OGE A;  3CQT A;  2YLC A;  5I21 A;  3VU3 C;  3OYJ A;  4ZTJ A;  2GNC A;  1QCN A;  1WZO A;  4DQ2 A;  1B07 A;  4CRI A;  1LCK A;  2LQ8 A;  3A5Z B;  4RTT A;  2EQI A;  1V29 B;  1N27 A;  4DBH A;  5GAN 6;  1W6X A;  1UE9 A;  2QQ9 A;  1G8X A;  2HAX A;  4M7D F;  1KJW A;  3BY7 A;  3LGF A;  1AWJ A;  2E6N A;  3VS0 A;  4GLK A;  1R0B G;  1X2K A;  4LD6 A;  2DRK A;  4CC2 A;  4XU1 A;  3DKM A;  2RH2 A;  1U1T A;  5GMK m;  3A98 A;  3M56 A;  2V26 A;  2HEQ A;  5KCO A;  2CUB A;  4F14 A;  1UEC A;  1UGP B;  4BE2 A;  3OB9 A;  4PJO E;  1AOJ A;  1G3S A;  2JNG A;  4F7U E;  1YJW T;  3HTR A;  4RCC A;  3CCE A;  2RB6 A;  5LJ3 e;  5D6W A;  1IZ6 A;  4ANJ A;  4P5N A;  3AHU A;  2YRV A;  1M9S A;  2HMA A;  4FYW B;  1TS9 A;  3RKY A;  2KRN A;  3JCM Q;  2OTL Q;  2WSC E;  1GCP A;  4BDZ A;  1BKB A;  3VS5 A;  4C0G A;  2RJE A;  1X75 C;  3CCE T;  1OUL A;  2CP2 A;  3ZL7 C;  1SKU B;  5FRN A;  4MML A;  3JCM V;  4FCY A;  2DBM A;  3QXE B;  2VB6 A;  4HT8 A;  1ARK A;  3PMI A;  4DOW A;  1TUD A;  3A8G B;  1VQL A;  2K7A A;  4Y28 E;  3L2Z A;  2WSE E;  4PNO A;  1K9A A;  2K5F A;  1OPK A;  1KD1 C;  3AT1 B;  5GAM d;  1YWP A;  1QVF P;  3OYF A;  5GAN j;  3PTA A;  4E6R A;  1IGQ A;  1SHF A;  1QVF A;  3MP1 A;  2M1H A;  4R56 A;  5GAN h;  4BI3 A;  2CDT A;  2FZG B;  2JMC A;  3I35 A;  5GAO m;  1QVG P;  4OMQ A;  2ZPE B;  5CQY A;  2COZ A;  1VQM T;  2K57 A;  2L8D A;  2EGC A;  4C5G A;  3E19 A;  4ZGE B;  3T9N A;  2KEA A;  1S1N A;  3NHN A;  3P8H A;  2GTJ A;  2HNI A;  2A28 A;  2C06 A;  3SFM A;  3LGL A;  4ATO A;  3UF4 A;  3CPW S;  1X2Q A;  3EH1 A;  3MEU A;  4J9F A;  2RQV A;  1GXI E;  2KYM A;  1WQ7 A;  5EG2 A;  4QVD A;  1VQ4 T;  4XU3 A;  2I0N A;  3CCL Q;  1RI9 A;  5GMK h;  1VQO T;  2ECZ A;  1E6H A;  3HFN A;  4L59 A;  1UDL A;  4RTW A;  1EIF A;  3JCM J;  2QDY B;  2M9U A;  4XAX B;  3QKJ A;  1YIJ Q;  4XU2 A;  2EQU A;  3VV0 A;  1FXX A;  4DEY A;  5KH6 A;  2EQK A;  1RI0 A;  1BBZ A;  2XU8 A;  1VQN Q;  2V8I A;  1F1B B;  2HL5 C;  3CC4 A;  4ORZ A;  1HSQ A;  4FIB A;  2FRY A;  1TG0 A;  2A37 A;  4EMH A;  3HPW A;  2VGM A;  1HK9 A;  4D6W A;  3CXC A;  2GF7 A;  3J7A F;  1G3W A;  1XNI A;  2L2P A;  2VXF A;  1M2V B;  2AIR B;  3KXT A;  4F7U B;  2MPX C;  1VQ6 T;  2AKK A;  1YJN Q;  2IG0 A;  1M8V A;  1VIE A;  3WVD B;  3OW2 P;  2Y90 A;  2CH4 W;  1RAE B;  3THK A;  5GJW B;  2F69 A;  3HKS A;  1MNE A;  1RAD B;  1YWO A;  4BY6 B;  2YDL A;  2DVE A;  3LH0 A;  1VIF A;  1VQ7 A;  4PL6 A;  4MMK A;  2DE0 X;  3M5A A;  2J06 A;  3BDU A;  4LE9 A;  2OI3 A;  4FM4 B;  2DZC A;  4PK4 A;  3CCL A;  4GY5 A;  3EGX B;  1YJN A;  2QEX T;  1NJI C;  1IB8 A;  2X3W D;  1Y0M A;  4F7U F;  3JRZ A;  1U1S A;  2KXD A;  5KCH A;  4RKU E;  1K0X A;  3JCM f;  1QP3 A;  4FL6 A;  2E10 A;  4QQD A;  2DYI A;  2GCX A;  5KYW B;  3QWY A;  1YHQ T;  4A4K A;  2CP6 A;  4F16 A;  2CP5 A;  1WHK A;  2F1L A;  5D6X A;  2EBP A;  4KBM B;  2ROT A;  3BW1 A;  3A8M B;  1G3Y A;  3HL8 A;  1VQL Q;  2DLP A;  2J6K A;  1C0M A;  2E41 A;  4NS5 A;  2RI3 A;  2V8K A;  5I2M A;  3L2W A;  4DBR A;  2EFI A;  2HL3 A;  4HA8 A;  3JCM b;  3ZFJ A;  4PLL A;  2EJF A;  4C8Q G;  1QWF A;  3MKD A;  1PD0 A;  4M78 D;  3M0U A;  1CKA A;  4CC4 B;  4C5E A;  2XHC A;  1M2O A;  1LNX A;  2E4H A;  3EGU A;  2EVR A;  5KYX A;  2XK0 A;  4RG8 A;  2EPD A;  3GNF B;  3SHW A;  2RQR A;  1WQW A;  5KYY A;  2HQX A;  3H9N A;  5KE2 A;  5LJ5 e;  1MV0 B;  2LVM A;  1M27 C;  8AT1 B;  1AT1 B;  5FU6 C;  4KUD K;  1G3T A;  4C5H A;  2X9H A;  2IVW A;  4Z89 A;  1IGU A;  4FYY B;  4AFS C;  2DEQ A;  4M75 C;  2PU9 B;  2RI5 A;  1D3B A;  1K4U S;  3FDR A;  2O4X A;  2EYY A;  2BKD N;  3LWH A;  2XG8 D;  2E5K A;  2SRC A;  2KE9 A;  2VGN A;  1N8R C;  3SB2 A;  1AWO A;  2OTJ T;  5A0L A;  2ATC B;  3NGP A;  2HSE B;  4QKU A;  3PNW C;  5GAM f;  2YRC A;  3CPF A;  3PVL A;  5CVI A;  1B3Q A;  1Q7Y C;  3OYE A;  2DF6 A;  3ASK A;  3QSU A;  4HCZ A;  2VAS A;  3M58 A;  2KRM A;  3UDC A;  2RM4 A;  2PVO B;  1DJ7 B;  3CC2 A;  2MCN A;  3UA6 A;  1MUZ A;  4KGX B;  2MYS A;  4KUI A;  3CD6 Q;  5GAN 2;  2XI9 A;  4JRI A;  3CC4 Q;  3I5R A;  3RIR A;  5LJ3 h;  1YJ9 A;  5KYW A;  2DM1 A;  7AT1 B;  1JBM A;  2FYK A;  1VOM A;  1D1B A;  1T3L A;  4EDU A;  2E3H A;  5FU6 B;  3OYB A;  2V1Q A;  3V8K A;  3EGD B;  2RHY A;  2EYQ A;  1EZZ B;  2MWP A;  3CC2 Q;  1J3T A;  4FYV B;  3H0F A;  2K5I A;  1AHJ B;  1WHM A;  1VQ5 T;  3QDF A;  3GOX A;  1Y71 A;  1I4K 1;  1K73 U;  3M0P A;  5LJ5 g;  1MV3 A;  1WYX A;  3CBO A;  2FEI A;  2E6Z A;  2HDA A;  3BE3 A;  1WJQ A;  4Q5W A;  4F04 B;  2CS7 A;  4OMP A;  3CCM Q;  4EMG A;  1ZSZ B;  1RAF B;  1D1A A;  1VQO Q;  2NLU A;  2Z0W A;  1WHH A;  2VWF A;  2MIO A;  4M77 D;  5GAO n;  2RF0 A;  1BI3 A;  2JTE A;  3ER0 A;  3NPF A;  3VJP A;  3HRT A;  1IRX A;  1IO6 A;  4M7A A;  3R6O A;  5GAM e;  2JTF A;  2DEU A;  3V8L A;  4RTX A;  2A3L A;  1OOT A;  3VS7 A;  3GNG A;  2Y4X A;  3EFO B;  3LX7 A;  4F17 A;  1N6A A;  3VRZ A;  3RES A;  4M77 A;  2DXC A;  3L42 A;  5GAO q;  3PE0 A;  4CC7 A;  2CZ0 B;  2QK0 A;  5LJ5 h;  3CME Q;  1IXD A;  4M75 E;  2C0I A;  2PZ1 A;  3VS6 A;  4F7U A;  4XTU A;  1YJN T;  1Q7Y U;  1GBQ A;  3CCS A;  1VYU A;  2KSS A;  4DA4 A;  1FWZ A;  3M4G A;  1NEG A;  2GTO A;  2KI7 A;  2W10 A;  2OTL A;  4LNP A;  4DBF A;  3TCJ A;  1JEG A;  3F70 A;  4JRP A;  1WI7 A;  3QZ9 B;  4FSX A;  3G6E T;  3VS3 A;  3H0H A;  1MMA A;  1ZSG A;  2B86 A;  3INZ A;  4C8Q A;  1YIT Q;  1X6B A;  5IXF A;  1LJO A;  4OML A;  4YTL A;  2O9V A;  4C92 D;  2LCC A;  3OS0 A;  2QAS A;  3RNJ A;  3FJP A;  1SRL A;  3REA B;  2RK1 A;  3GPL A;  1QVP A;  2WAC A;  1X6O A;  2MK5 A;  1RLP C;  3EG2 A;  2RJC A;  2HD0 A;  2PQW A;  3G4S Q;  2KBT A;  2KT8 A;  4XTZ A;  4N0A A;  3D7S B;  1I0C A;  4LDX A;  4PJM A;  3QJY A;  2RO0 A;  1LVK A;  2XD0 A;  2KRS A;  3DLM A;  2BUD A;  3EG3 A;  2DAQ A;  3JB9 H;  1KD1 U;  3QBY A;  2X4W A;  1RAI B;  3A1P A;  2CSQ A;  1VQ6 A;  3REB B;  1Q86 R;  3CCM A;  2ZAE A;  4C8Q F;  4EPC A;  5CQX A;  1K76 A;  3M59 A;  3G4S A;  1YJ9 Q;  3FC3 A;  3CMA Q;  2R5A A;  3KBG A;  1D0Y A;  1WA7 A;  2HQH A;  1ZA2 B;  4C92 F;  2V8J A;  3U23 A;  3I56 Q;  1WXU A;  1PKT A;  4A4E A;  2M16 A;  4A63 B;  2BE7 D;  1VQ7 T;  1FX7 A;  1OU8 A;  1K1Z A;  2CH4 A;  2NUP B;  2PNI A;  3CD6 A;  4FSS A;  2OAU A;  4JJC A;  2JUF A;  3RER A;  2J6F A;  1H3Z A;  4QW2 A;  4GLM A;  5CKH A;  5LJ5 j;  3OS2 A;  1K8A R;  1MND A;  2M51 A;  3X20 B;  3OQ5 A;  3UAT A;  1LPL A;  4HKE A;  2CKK A;  1H3H A;  2O9S A;  2C0T A;  4HVW A;  1KSW A;  3EFR A;  3L1A A;  3DB4 A;  4FT4 A;  2MOX A;  2RNA A;  3OW2 S;  4NOY A;  1H64 1;  3L2U A;  2MMP A;  3CCQ T;  2V1R A;  4MZM A;  4OVA A;  5KYX B;  1M4Z A;  2MF2 A;  3UWN A;  3E2U A;  1OZ2 A;  5A0G A;  3CXC P;  4JDS A;  3R6N A;  1I8F A;  2FB7 A;  2F5K A;  3VRY A;  1D3B B;  4ME7 A;  3E1S A;  3G6E A;  2GGR A;  3CCS T;  1W4S A;  1O9S A;  3MEW A;  2XIC A;  1QCO A;  2P0K A;  3G71 T;  2L3R A;  1N8R U;  1T0J A;  2EW3 A;  3OYI A;  4M77 G;  2L3Q A;  4NL2 A;  4J9I A;  1A0N B;  1NLO C;  2ESW A;  1SSF A;  1N9R A;  2GQV A;  8ATC B;  5LJ3 j;  2MI6 A;  1VQN T;  4C0F A;  4IUU A;  2OX7 A;  5GAM h;  3I55 Q;  3OBW A;  1I5L A;  2D6F A;  2EIF A;  3RR6 A;  1SRM A;  2LRQ A;  3KUF A;  2RD1 A;  4A54 A;  4O5V A;  3X26 B;  4JZ3 A;  2P0P A;  2EWN A;  3H6Z A;  4B9X A;  2KVQ G;  5FW9 A;  3SEM A;  1S72 Q;  2QQA A;  1VUB A;  2OTJ A;  2L3P A;  3VKI A;  1RAG B;  5IH2 A;  4DEX A;  2DJZ A;  2DX1 A;  4RMO A;  1WDX A;  1WFW A;  5EC7 A;  3LYI A;  2K5L A;  4ELY C;  4BI8 B;  2ED1 A;  2XID A;  3HHT B;  1TXQ A;  2VC8 A;  3CCU T;  1PG5 B;  3I56 T;  3MO8 A;  4QT7 A;  2XDD A;  3QZ5 B;  2RK2 A;  1KQS P;  2X4X A;  3PMT A;  4E2F B;  4KUL A;  2CZ7 B;  1AZG B;  3V7S A;  2DL7 A;  4MDX A;  1E6G A;  2DTI A;  1XQH A;  1VQ9 A;  2OAW A;  2E1H A;  4IIO A;  3FJ5 A;  3OW2 A;  1NJI U;  4PJO F;  2CT3 A;  4JRQ A;  1XJW B;  3V8J A;  2H3J A;  1GRI A;  5FWC A;  4LDV A;  1QMC A;  3GLX A;  2RQT A;  4M75 B;  3PIO A;  4M77 B;  3IQL A;  1YCS B;  4J83 A;  5FU7 C;  2MWO A;  1OEB A;  2QQR A;  3L2V A;  2L0A A;  1MHN A;  4NL3 A;  5KYU A;  1VQ8 A;  2LNH B;  1AWW A;  1YHQ A;  1G83 A;  1M3C A;  1Y96 B;  3FB9 A;  2J6O A;  4IKF A;  1TWB A;  4BI4 A;  2QGF B;  2MAM A;  3JV3 A;  3I55 A;  3QDR B;  2CGH A;  2VKN A;  1UUE A;  2JT4 A;  3E9F A;  2SEM A;  1UHC A;  1KG1 A;  2A0F B;  2JOY A;  4AT1 B;  3QPH A;  2LX9 A;  3OA6 A;  4A53 A;  3G71 A;  2NUT A;  1ZUU A;  5I2S A;  4M7A B;  1NYG A;  3ZBD A;  2DTH A;  1AD5 A;  1VQP A;  3JCM W;  3L2R A;  1TU0 B;  3MJX A;  2E12 A;  4B9W A;  4XK8 E;  1AVZ C;  1ZBX A;  2DTO A;  4D8D A;  3RMQ A;  1NBE B;  4CI0 C;  2E3I A;  1JXM A;  2BZY A;  3JB9 D;  2QEX Q;  2DXU A;  3S6W A;  5IAY A;  1RUW A;  1WIE A;  4C0D B;  3EAE A;  4HCB A;  4HCK A;  1YIJ A;  1GFC A;  1YBY A;  3VUB A;  1UGR B;  1UGS B;  2EYW A;  3M0Q A;  4TVR A;  1N5Z A;  1XTD A;  2ZCF B;  1UJY A;  1Q82 C;  2FZC B;  4Z02 A;  1I5O B;  5IT9 E;  3EG0 A;  4IUV A;  3RKX A;  3M0S A;  2JS2 A;  3CME A;  1S72 T;  1W2B P;  3HRU A;  4QVZ A;  2RHZ A;  1CSK A;  1R8O B;  4C5I A;  2CYZ B;  2RA2 A;  4WCI A;  1G2B A;  2M0Y A;  4M78 B;  2DJQ A;  2VYT A;  5GMK j;  1OPL A;  2O4X B;  5GAN g;  4E7S A;  1KD1 R;  2FPF A;  1Q86 U;  2DRM A;  1Z9Q A;  3TRE A;  3CBM A;  3JCM P;  3CC4 T;  2DER A;  2J05 A;  2O31 A;  3CCU A;  4J7F A;  4RTV A;  4ZN1 A;  4BUG A;  5IHN A;  4IUQ A;  3DLL A;  3OY9 A;  2KNB B;  2KK4 A;  1UEB A;  2L89 A;  5CO7 A;  3NTI A;  2R57 A;  2IIM A;  4LUE A;  2R5M A;  4RCB A;  5IN1 A;  1U8R A;  1Q82 R;  4BY6 C;  2G3R A;  2RQW A;  1GBR A;  3EGD A;  1BI1 A;  2XDB A;  4AG1 C;  3OYN A;  1K73 C;  4M7A G;  4X1V A;  4Z8A A;  3JCM X;  1C6V X;  3V7R A;  4V2S A;  3OSV A;  3CCQ A;  3TU4 K;  1I1J A;  4PJO G;  1YP5 A;  3CCV T;  5LJ3 d;  1M1K U;  1IHV A;  3S3O A;  5IXB A;  1VQO A;  4MDW A;  2QTV A;  2BTT A;  4EMK A;  1VQ8 T;  5L8R E;  2Y4Y A;  2DYB A; 
#chains in the Genus database with same CATH homology
 4YTL A;  4EMK C;  4C92 D;  2LCC A;  3OS0 A;  2E5Q A;  4C92 C;  3AHU A;  3FJP A;  2YRV A;  1M9S A;  2FL7 A;  4ZN3 A;  3RKY A;  4RG2 A;  2ZPI B;  2RK1 A;  3JCM Q;  5LJ3 g;  3X24 B;  3GPL A;  1QVP A;  5DM7 R;  2WAC A;  4E7I A;  1X6O A;  3JAM E;  2WSC E;  4JS5 A;  3OYM A;  5C6S A;  4BDZ A;  4M7D A;  2RJC A;  4BAC A;  1BKB A;  2HD0 A;  3P8B B;  2PQW A;  1B34 A;  2PUK B;  2LCL A;  1ZQ1 A;  4C0G A;  2RJE A;  2YLB A;  1X75 C;  3CCE T;  5GAN 5;  2FVU A;  4X34 A;  4N0A A;  4XTZ A;  1W2B S;  5HK0 A;  1N9S A;  1YI2 T;  5HK3 A;  1K9M C;  5FRN A;  4MML A;  5LJ3 f;  2DD4 A;  4LDX A;  4M78 E;  3JCM V;  3UPU A;  3QJY A;  2RO0 A;  1PSF A;  3QG1 A;  5DLQ E;  3QXE B;  4HT8 A;  2XD0 A;  3PMI A;  4OMF B;  2P4T A;  4DOW A;  1QP2 A;  3OYC A;  1XOV A;  3A8G B;  5GAM g;  3PT9 A;  1VQL A;  2BIV A;  3DLM A;  2BUD A;  2GFA A;  4Y28 E;  1QW1 A;  1OYX A;  1YIT T;  2DAQ A;  3L2Z A;  3JB9 H;  4IUT A;  2WSE E;  1KD1 U;  4PNO A;  2M0O A;  2VUB A;  3QBY A;  1VQM A;  2K5F A;  2EJG A;  5GMK i;  1BI2 A;  2X4W A;  1KD1 C;  1NZ9 A;  1VQ6 A;  2KQW A;  2R58 A;  3CCM A;  5GAM d;  4C8Q F;  4EPC A;  5CQX A;  1KHC A;  2PUO B;  4Y91 A;  3M59 A;  5CR2 A;  3OYF A;  3G4S A;  3PTA A;  3HP9 A;  3S3N A;  3FC3 A;  5GAN j;  3VUZ A;  4QQ6 A;  4N0A C;  2R5A A;  1QVF A;  3KBG A;  3MP1 A;  2M1H A;  4R56 A;  5HKC A;  4C92 F;  2V8J A;  5GAN h;  2LT4 A;  2RHX A;  4XTV A;  2I2L A;  4BI3 A;  4E47 A;  1YIJ T;  3MHX A;  5A0D A;  3G4S T;  3CCJ A;  5GAN 8;  3VYH B;  2M16 A;  4A4E A;  2QEX A;  1G5V A;  1VQ7 T;  1FX7 A;  4FT2 A;  5FLX E;  3RKW A;  4N4I A;  3QUI A;  5GAO m;  3CD6 A;  2ZPE B;  4ZGD B;  2OAU A;  5CQY A;  2JUF A;  2RJF A;  1VQM T;  4L6V 5;  2K57 A;  2L8D A;  2P0Q A;  4C5G A;  3RER A;  1H3Z A;  3E19 A;  3E9G A;  3FRN A;  4QW2 A;  3T9N A;  2EAY A;  4ZGE B;  5CKH A;  5LJ5 j;  3OS2 A;  3P8H A;  3SWN A;  1P92 A;  2HNI A;  4C92 G;  2C06 A;  3X20 B;  3GP8 A;  3H8Z A;  3OQ5 A;  3SFM A;  3LGL A;  4PJO D;  4ATO A;  4ELZ C;  2XDP A;  3CPW S;  4HKE A;  2CKK A;  2D0Q B;  2ZZD A;  4PJO B;  2QQB A;  3MEU A;  2EKO A;  2ZGW A;  4R55 A;  1GXI E;  2RJD A;  1WQ7 A;  2JN0 A;  5EG2 A;  4QVD A;  3I55 T;  1VQ4 T;  1JRI A;  3EFR A;  4XU3 A;  5CKD A;  1NE8 A;  5GMK h;  1VQO T;  3L1A A;  3DB4 A;  3HFN A;  4FT4 A;  4L59 A;  1M1K C;  2LNV A;  2RI2 A;  1WGS A;  3OW2 S;  1EIF A;  4NOY A;  3JCM J;  2QDY B;  4OB0 B;  1H64 1;  2DD5 A;  2M9U A;  5CKE A;  3L2U A;  2MMP A;  4XAX B;  3QKJ A;  4BD3 A;  4XU2 A;  2EQU A;  5CIU A;  1FXX A;  3VV0 A;  4KT0 E;  5KH6 A;  3CME T;  3CCQ T;  1S72 A;  2EQK A;  1RI0 A;  4MZM A;  2XU8 A;  2LC4 A;  3OSS C;  4OVA A;  4PLI A;  3CCR T;  1M4Z A;  2MF2 A;  2V8I A;  1KQS S;  3UWN A;  1YI2 A;  1WNL A;  3CC4 A;  5KE3 A;  4FIB A;  3LWI A;  2QTX A;  2EJ9 A;  3HRS A;  4C92 A;  4A4H A;  1OZ2 A;  4EMH A;  5A0G A;  1LOJ A;  3MCA B;  4JDS A;  3HPW A;  2DXT A;  3OYD A;  2VGM A;  3QO3 A;  1HK9 A;  4D6W A;  3CMA T;  4JRK A;  1YJW A;  1Q82 U;  1I8F A;  3CXC A;  5CKB A;  2FB7 A;  2F5K A;  2GF7 A;  2AHJ B;  1D3B B;  4JLI A;  3I56 A;  1KQS A;  2K3X A;  4ME7 A;  3E1S A;  3J7A F;  1G3W A;  1XNI A;  3G6E A;  1PSE A;  3OYY A;  4L5G A;  2VXF A;  4M77 C;  3CCL T;  3CCS T;  3JSC A;  3KXT A;  4LDW A;  1W4S A;  2E70 A;  1O9S A;  3WXM B;  4F7U B;  3MEA A;  3OMG A;  1VQ6 T;  3ME9 A;  5GAN 3;  4J6W A;  3MEW A;  2IG0 A;  3MEV A;  2XIC A;  2P0K A;  3G71 T;  2DPP B;  3NFC A;  1M8V A;  1VIE A;  2L3R A;  4JLG A;  3WVD B;  2Y90 A;  1N8R U;  4LDY A;  5CAI A;  5DLO A;  1VQ5 A;  2X4J A;  5GAO l;  2E64 A;  1VQ9 T;  2ZPH B;  3OYI A;  4M77 G;  4J6Y A;  3OYL A;  2F69 A;  2KY9 A;  3HKS A;  4NL2 A;  4WF2 A;  2DIQ A;  3C12 A;  4M7A F;  4BY6 B;  1SSF A;  3CPW A;  1N9R A;  2GQV A;  2B8A A;  5J26 A;  2MI6 A;  5LJ3 j;  4C8Q C;  2DVE A;  1KQ2 A;  1VQN T;  3LH0 A;  1VIF A;  2RHU A;  3LW5 E;  4IUU A;  4C0F A;  1VQ7 A;  2DIG A;  4IUP A;  2K3Y A;  5GAM h;  4BE0 A;  1B34 B;  3OBW A;  4PL6 A;  2CZ1 B;  3EFS A;  4MMK A;  1I5L A;  2D6F A;  4X9C A;  1VQL T;  2EIF A;  4OB3 B;  3M5A A;  4PKC C;  3M57 A;  3QYG B;  2LRQ A;  2LTO A;  4M78 A;  1WPY A;  2RD1 A;  3KUF A;  3QHS A;  4A54 A;  1TH7 A;  4ZGJ B;  2KAF A;  4M77 F;  3BDU A;  4O5V A;  3X26 B;  3JB9 F;  2P0P A;  4FM4 B;  4BB7 A;  2EWN A;  4OGC A;  2DZC A;  3CCL A;  4M7A D;  4GY5 A;  3H6Z A;  1YJN A;  1Y7X A;  2JZ2 A;  2QEX T;  1NJI C;  4B9X A;  3OYH A;  2KVQ G;  4F7U F;  3OYG A;  3JRZ A;  2E65 A;  4J8O A;  1U1S A;  2K2V A;  2QQA A;  1MGQ A;  4FU6 A;  5KCH A;  5GAN f;  4PJO A;  1VUB A;  1Q81 C;  1M90 U;  4RKU E;  3SDZ A;  3CEY A;  2OTJ A;  3JCM f;  1QP3 A;  4FL6 A;  3VKI A;  4JJN K;  2E10 A;  4QQD A;  3JB9 G;  2GCX A;  2ZPB B;  1K8A U;  1KC8 C;  1YHQ T;  4J7I A;  2DJZ A;  3LLR A;  2RHI A;  4A4G A;  1OZ3 A;  4A4K A;  2PVG B;  4F7U G;  3CC7 A;  5CKF A;  5J3B A;  4RMO A;  1RL2 A;  2QA4 A;  5LL6 S;  2PVD B;  1VQK A;  1VQP T;  1YIT A;  4XTY A;  3J81 E;  2VV5 A;  1WJR A;  3LYI A;  4M78 G;  4XTW A;  5D6X A;  4KBM B;  3JCM h;  2K5L A;  3MET A;  4ELY C;  3BW1 A;  3A8M B;  1G3Y A;  3UT1 A;  3JCM g;  4BI8 B;  3ZEH A;  3HL8 A;  4M75 F;  1YJ9 T;  2QQS A;  3FEO A;  4OP0 A;  2DO3 A;  2XID A;  5FRO A;  4M7A C;  3HHT B;  1KHI A;  2EQM A;  2VC8 A;  4M78 F;  3CCV A;  3OYK A;  2E41 A;  2JTM A;  3CCU T;  3I56 T;  4M7D G;  4NS5 A;  3SWN B;  2FHD A;  2QI2 A;  2RI3 A;  3MO8 A;  2V8K A;  2KDS A;  5I2M A;  3CXC S;  4M7D E;  1UGQ B;  3L2W A;  2X35 A;  2XDD A;  2EFI A;  2GFU A;  3FLG A;  3P8D A;  5GAO r;  3QZ5 B;  4HA8 A;  4J6X A;  2RK2 A;  4C0Z A;  2QA4 T;  1VQK T;  3JCM b;  2X4X A;  1IRE B;  3MP6 A;  3PMT A;  4KUL A;  4M75 D;  1BIB A;  4PLL A;  2CZ7 B;  3ZFJ A;  1K9M U;  2EJF A;  4C8Q G;  5CCA A;  5GAN 7;  3V7S A;  4HCC A;  4M78 D;  4EMK B;  4MDX A;  3M9Q A;  5AYF A;  4HT9 A;  2DTI A;  1XQH A;  4C5E A;  1VQ9 A;  4MZT A;  2XHC A;  2E1H A;  1LNX A;  4QVC A;  3OW2 A;  1NJI U;  4PJO F;  4JRQ A;  5D6Y A;  1Q86 C;  4XU0 A;  3V8J A;  2XK0 A;  5FU7 B;  3JB9 I;  4RG8 A;  2H3J A;  3GNF B;  4J5Y A;  3CD6 T;  4LDV A;  1WQW A;  2HQX A;  3GLX A;  5KE2 A;  5M9O A;  3PIP A;  5LJ5 e;  4M75 B;  3PIO A;  2LVM A;  3CCJ T;  1O75 A;  2DKG A;  4M77 B;  1JJ2 S;  5GMK l;  5FU6 C;  4J83 A;  5FU7 C;  1JB0 E;  5J39 A;  2MWO A;  2QQR A;  3L2V A;  4KUD K;  1G3T A;  4C5H A;  2IVW A;  3OBY A;  3CMA A;  2DEQ A;  3NTH A;  5HY6 A;  1NPR A;  1MHN A;  4NL3 A;  4M75 C;  1QVG S;  2JVV A;  2PU9 B;  2RI5 A;  3CC2 T;  1D3B A;  1VQ8 A;  3FDR A;  2O4X A;  1YHQ A;  2BKD N;  3A8O B;  1Q81 U;  1Y96 B;  2XG8 D;  3LWH A;  3C95 A;  2XKO C;  3FB9 A;  2VGN A;  5GAN 4;  1N8R C;  3SB2 A;  5GAN e;  4IKF A;  2QXF A;  2OTJ T;  3M55 A;  1M1G A;  3WVE B;  5A0L A;  3BDL A;  1X01 A;  4PJO C;  4LD9 K;  1KQ1 A;  5LJ5 d;  3PNW C;  4BI4 A;  5GAM f;  3CPF A;  2D9T A;  1QVF S;  3BFM A;  2MAM A;  1YCY A;  5CVI A;  3JCM c;  1Q7Y C;  4C8Q D;  5DY9 A;  4DOV A;  3OYE A;  3I55 A;  3ASK A;  1VQ4 A;  3QDR B;  3QSU A;  4HCZ A;  2CGH A;  4MZP A;  2K4Y A;  3CCM T;  3E9F A;  4C8Q B;  4BDY A;  2LQK A;  3QYH B;  3M58 A;  1KG1 A;  3G7Z A;  2JOY A;  3QPH A;  3UDC A;  2RM4 A;  2PVO B;  4E7L A;  1DJ7 B;  3CC2 A;  2O01 E;  3SD4 A;  3OS1 A;  1M5Q 1;  3OS5 A;  4M7D D;  4C8Q E;  2LX9 A;  3OA6 A;  4A53 A;  3DB3 A;  3C94 A;  3OYA A;  3G71 A;  1K8A C;  5CK9 A;  5I2S A;  4M7A B;  1WJS A;  4KUI A;  4QQG A;  3ZBD A;  2DTH A;  3V7C A;  2LDM A;  2X4Y A;  1VQP A;  3M54 A;  3JCM W;  5GAN 2;  3L2R A;  2XI9 A;  2KMT A;  4JRI A;  4C92 E;  2F5T X;  3JCM d;  4IUR A;  3RIR A;  2HQE A;  5LJ3 h;  2E12 A;  3CBP A;  4B9W A;  1I81 A;  4XK8 E;  1ZBX A;  1YJ9 A;  2DTO A;  3QJ6 A;  4M75 A;  4A4F A;  3RMQ A;  1JBM A;  1W2B A;  2FYK A;  1HXD A;  4XQ3 A;  4CI0 C;  4EDU A;  1ZHI A;  5FU6 B;  3OYB A;  3M4Y A;  3JB9 D;  3V8K A;  2DXU A;  4UC4 A;  3S6W A;  2RHY A;  5IAY A;  2EYQ A;  1KC8 U;  2MWP A;  1OI1 A;  4C0D B;  3EAE A;  3J80 E;  4HCB A;  2K5I A;  1AHJ B;  1YIJ A;  1YBY A;  3VUB A;  3RUX A;  1UGR B;  3PFS A;  4M78 C;  4XTX A;  1M90 C;  4M7A E;  1UGS B;  1VQ5 T;  3GF5 A;  4TVR A;  1XTD A;  3GOX A;  4BE1 A;  4OF1 A;  2HBP A;  4X9D A;  1Y71 A;  1I4K 1;  2ZCF B;  1K73 U;  2YHT A;  1Q82 C;  3N5B B;  4Z02 A;  5LJ5 g;  3L2Q A;  3CBO A;  2E6Z A;  3X28 B;  5A2Q E;  2EQJ A;  5IT9 E;  1Y07 A;  4JUV A;  4II1 A;  2A7Y A;  1WJQ A;  4IUV A;  4Q5W A;  3SWN C;  3CCR A;  3RKX A;  2CS7 A;  5C0M A;  4M75 G;  3CME A;  1S72 T;  1BI0 A;  4EMG A;  2WSF E;  2ZPG B;  2ZPF B;  3HRU A;  3JB9 J;  4QVZ A;  2RHZ A;  1R8O B;  2NLU A;  3NTK A;  4C5I A;  2CYZ B;  2RA2 A;  4M78 B;  4M7D C;  4JS4 A;  4M77 D;  5GAO n;  2VYT A;  1Y96 A;  4ZTF A;  3JCM e;  1BI3 A;  5GMK j;  3ER0 A;  2VXE A;  2O4X B;  3RMS A;  5GAN g;  3VJP A;  2L5Q A;  3HRT A;  3X25 B;  4C0D C;  4M7A A;  3R6O A;  5GAM e;  1Q86 U;  3TRE A;  3Q1J A;  3CBM A;  2JTF A;  3JCM P;  3V8L A;  3QII A;  3OMC A;  3URG A;  3CC4 T;  2A3L A;  3CCU A;  1M1F A;  4J7F A;  3MP8 A;  3GNG A;  2Y4X A;  3O8V A;  3LX7 A;  3PGG A;  4LDU A;  4BUG A;  4ZN1 A;  1N6A A;  1UB4 A;  2CZ6 B;  2OTL T;  3RES A;  3M53 A;  4IUQ A;  4M77 A;  4OGE A;  3DLL A;  2YLC A;  2DXC A;  3L42 A;  4N4G A;  3VU3 C;  5I21 A;  5GAO q;  3OY9 A;  5GMK e;  3OYJ A;  3S3M A;  2CZ0 B;  5GAN d;  2KK4 A;  4ZTJ A;  1UEB A;  2L89 A;  5CO7 A;  3NTI A;  5GAM j;  2R57 A;  4DQ2 A;  5LJ5 h;  3A8L B;  4M75 E;  4OB2 B;  2R5M A;  4CRI A;  5GAO p;  4RCB A;  3C4S A;  3HSB A;  5IN1 A;  1U8R A;  2LQ8 A;  3A5Z B;  1V29 B;  4F7U A;  1N27 A;  4XTU A;  4BY6 C;  3TEE A;  4O6J A;  2G3R A;  4N4H A;  5GAN 6;  1YJN T;  3GIB A;  1Q7Y U;  2HAX A;  2QQ9 A;  3CCS A;  3VYG A;  4M7D F;  2KSS A;  3BY7 A;  3LGF A;  2E6N A;  5LJ5 f;  4DA4 A;  4E7K A;  4GLK A;  1BIA A;  1FWZ A;  1BI1 A;  2LT1 A;  3M4G A;  4LD6 A;  2XDB A;  3OYN A;  4XU1 A;  1QVG A;  3DKM A;  1K73 C;  2RH2 A;  1U1T A;  4M7A G;  4C92 B;  5GMK m;  2OTL A;  3JCM X;  2DXB A;  3V7R A;  4VUB A;  3FIF A;  4V2S A;  3OSV A;  4OB1 B;  3M56 A;  3CCQ A;  3TU4 K;  3TCJ A;  4E7J A;  2DZ9 A;  1VQN A;  4PJO G;  3F70 A;  4JRP A;  4M77 E;  3HFO A;  3QZ9 B;  5KCO A;  4FSX A;  3CCV T;  1JJ2 A;  3G6E T;  1NPP A;  5LJ3 d;  1M1K U;  5FRM A;  4E7H A;  3CC7 T;  1UGP B;  1BYM A;  4BE2 A;  3OB9 A;  3S3O A;  4PJO E;  1VQO A;  1G3S A;  2JNG A;  4MDW A;  4F7U E;  3INZ A;  4C8Q A;  1YJW T;  4RCC A;  3CCE A;  1LJO A;  4M7D B;  4EMK A;  1VQ8 T;  3A8H B;  2RB6 A;  5L8R E;  2DK3 A;  5D6W A;  5LJ3 e;  2Y4Y A;  1IZ6 A;  4P5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...