2FHDA

Crystal structure of crb2 tandem tudor domains
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
150
structure length
150
Chain Sequence
HMSRRSFKNRVLAFFKGYPSFYYPATLVAPVHSAVTSSIMYKVQFDDATMSTVNSNQIKRFFLKKGDVVQSTRLGKIKHTVVKTFRSTNEQLSLIAVDALNNDMVILAHGEIEVTVPISTIYVAPVNIRRFQGRDLSFSTLKDMKFEETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein rhp9/CRB2
publication title Structural basis for the methylation state-specific recognition of histone H4-K20 by 53BP1 and Crb2 in DNA repair.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
total genus 29
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18115 Tudor_3 DNA repair protein Crb2 Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fhdA01
2.30.30.810 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fhdA02
2VYTA 2DIQA 4UC4A 3L2RA 1KHCA 3P8DA 4FL6A 4ZTFA 3OYDA 3PFSA 4BE2A 4PLIA 1SSFA 2M1HA 5D6XA 2LDMA 5J39A 2RI2A 2FHDA 2RI5A 3PMIA 2P0KA 4PLLA 2F5KA 1OI1A 3OYLA 2R5MA 2LVMA 5D6WA 5KCOA 3DLMA 3QJ6A 2NLUA 3LGLA 4IUVA 4A4HA 4BE0A 1RI0A 2E6NA 4B9WA 2L89A 2EQMA 2MWPA 2R57A 3OB9A 4CRIA 4C5EA 4ZTJA 3S6WA 3DB4A 2RHXA 5IN1A 3L2UA 2RJFA 4A4GA 2R5AA 4QVZA 4A4FA 3OYFA 3L2WA 4BE1A 4IUPA 2RHYA 2JZ2A 2EKOA 1OZ2A 1N27A 2RI3A 3OS2A 4E7KA 4BDYA 3NTHA 3DB3A 4GY5A 2M16A 3MP6A 4LD6A 3OYEA 3OS1A 2GF7A 3L2VA 5C0MA 2L3RA 2HQEA 2EFIA 3META 4NS5A 4BACA 3O8VA 3QKJA 3OMGA 3KUFA 2DAQA 2RJDA 3EAEA 3NTIA 3OYGA 2RHUA 4Q5WA 4EDUA 4N4GA 4C5IA 3L42A 3GOXA 2D9TA 2X4XA 3LX7A 3UT1A 4BD3A 4QW2A 2BKDN 3PMTA 4RG2A 4C5GA 5KE3A 3FLGA 2K3YA 2EQKA 3H6ZA 3PNWC 3OY9A 3OYJA 2BUDA 3QBYA 2B8AA 3QIIA 3MEVA 3OYNA 2RHIA 2LRQA 2L8DA 2G3RA 4OVAA 3MP1A 3ZEHA 3F70A 2CKKA 5M9OA 3ME9A 4E7HA 4E7IA 4QQDA 2PQWA 3E9FA 3LYIA 4QQGA 3OYMA 3OYIA 1WGSA 4N4IA 3S3OA 2WACA 3MEWA 2X35A 4C5HA 3P8HA 3OS0A 2X4WA 2XK0A 2EQUA 3SD4A 2QQRA 5J26A 4E7LA 2O4XB 1OYXA 2RO0A 4QQ6A 3OYKA 4E7JA 2RJCA 2R58A 5C6SA 3MO8A 3M9QA 3OA6A 4II1A 2JTFA 3OYHA 1MHNA 4Z02A 1OZ3A 5FRMA 2DIGA 3OYCA 2BIVA 5KE2A 2MWOA 5KCHA 4IUTA 3LH0A 3LLRA 3MEAA 4HCZA 4IURA 3LGFA 3E9GA 2QQSA 2O4XA 3H8ZA 2IG0A 4L59A 2XDPA 3MP8A 4FU6A 4B9XA 3L2QA 2X4YA 4BDZA 2HQXA 2M0OA 4N4HA 1WJSA 3NTKA 5CIUA 3FEOA 5FROA 3OYBA 1WJQA 2K3XA 3Q1JA 5IAYA 4IKFA 5D6YA 2GFAA 3S3NA 1H3ZA 3UWNA 2RJEA 3ASKA 2E5QA 2GFUA 2YRVA 3C4SA 3FC3A 3OMCA 2LCCA 4IUUA 4IUQA 4PL6A 2EQJA 3OQ5A 5KH6A 3S3MA 1XNIA 3MEUA 3FDRA 4X34A 2RHZA 3BDLA 1WJRA 3CEYA 1G5VA 3OYAA 5FRNA 4A4EA 2LTOA
chains in the Genus database with same CATH superfamily
1JBMA 1T0HA 2AHJB 1Q7YC 4JDSA 3OYDA 3JCMV 5DLQE 5ECAA 5J39A 3JCMQ 1BCOA 1WZOA 1SEMA 5CR2A 2EKHA 2K2MA 3HSBA 1PD0A 4J6YA 1U1SA 1QP2A 2QXFA 2EGEA 5IN1A 3WVEB 4A4FA 1PWTA 1BI2A 4Y92A 3DB3A 1X27A 3BE3A 2CUBA 2EFIA 2QEXA 3KBGA 1YWOA 3KUFA 1PCXA 1OQKA 1X43A 3VYHB 5LJ5h 1J3TA 3JB9F 4QW2A 1Y0MA 1QCNA 4PJOC 2MYSA 1VQOA 1I5OB 1PKTA 4BUGA 3X24B 3AHUA 1WXBA 1Q7YU 2CZ0B 4MDXA 4M7AE 4MZPA 1QW1A 3EGDB 4JZ3A 2M51A 4HKEA 3OW2P 2O4XB 4O5VA 3G71Q 4M7AD 2MMPA 1OZ3A 1SRLA 1VQ8Q 3OW2S 1WX6A 2BIVA 3CCUA 2KYBA 4XTWA 3A8GB 1D1CA 3EFOA 2HQXA 4E6RA 1I8FA 3A5ZB 1FXXA 1VQ9Q 2VKNA 3RMSA 3TU4K 2LCCA 4Z88A 3RUXA 2HEQA 3OSVA 4FYVB 1SPKA 1WPYA 4FW2A 1ABOA 1VQLA 1IGQA 3VJPA 2P4TA 4F7UA 1YIJA 4F14A 2QQBA 3E1SA 1AHJB 2CSIA 4PLIA 3EG2A 1I5LA 1GFCA 2F5KA 2R5MA 1QKXA 2QQ9A 2XI9A 2EYWA 3CPWA 1B34B 1RI0A 1VQ5T 1M1GA 5I22A 1JRIA 2EQMA 3C0CA 1QLYA 3WXMB 3HRUA 4DOVA 4E2FB 1YHQQ 3NTHA 3CC4A 3ER0A 2V8KA 4BACA 1VQMQ 3GF5A 1YI2A 3M0RA 1YJNT 3LH5A 3CCVA 3G6EQ 4LDXA 3M55A 3MKDA 1Q7YR 2CP0A 3UDCA 3VS5A 4C8QA 5IHIA 1IZ6A 4ZGEB 4M7AF 2JNGA 1Q95G 4C0DC 1HJDA 2RHIA 1M27C 3CC7A 2V1RA 2J06A 5KYYA 1ABQA 4KH1B 4M7DA 2WACA 4KBMB 5KYXB 1S72A 4PNOA 4ME7A 2EGAA 1MMAA 4MMLA 2GBQA 4QQ6A 4C0ZA 5C6SA 2A37A 4J9HA 4XTZA 3R6NA 3MEAA 2I0NA 3SWNA 5GAMf 4B9XA 3MP8A 2EYYA 1OPKA 1UGPB 4C8QC 4HXJA 1AT1B 3HTRA 2EYQA 4M75A 2GTJA 1MGQA 4X9CA 1IO6A 2KEAA 4HCCA 2X3XD 4ORZA 3RKWA 1M1KC 2YXYA 1NG2A 3BY7A 2YUPA 1X2KA 4KGZB 2VXFA 3L2ZA 4UC4A 4NL2A 1ZUYA 1S1NA 1YITA 2COYA 2D0QB 2EYXA 1NBEB 1NJIC 1VQNA 3SWNC 1VUBA 1GXIE 4FM4B 4PJOE 1W2BP 1YN8A 1QQJA 2X51A 4M78A 4M75C 1SHGA 3GBQA 1N27A 3ZL7C 2DJZA 4PJOD 1W2BS 1E6HA 1TS9A 2HQEA 4PKCC 3O8VA 3QKJA 4RTTA 3NGPA 4JS5A 2ZPBB 4AFUC 2YRDA 1ZSZB 1VQ6Q 3LX7A 3UT1A 1Y7XA 1K8AC 2VWFA 1AZGB 2KNBB 1YJ9A 1M1KU 1VQPT 5HY6A 2IVWA 2DO3A 4E7HA 2LQ8A 3CC2T 3JCMe 1PD1A 2DD5A 3OYMA 5IXBA 1M90U 3EG9B 4M78C 4K11A 2NUZA 1NM7A 3OYKA 2R58A 1VQKT 1N6AA 2FO0A 1JO8A 4PJOB 1NJIU 1ZX6A 1QP3A 3ULRB 1HSQA 3SFMA 2FB7A 1C1AA 3X25B 3GP8A 2DBMA 3UA7A 3LH0A 2DD4A 4FU6A 4XAXB 5GAMh 3HP9A 1K76A 2DERA 2XD0A 3NTKA 3OYBA 1WJQA 5GJVB 1VQLT 1XQHA 4QKUA 2JW4A 5LJ3j 2RMOA 2OI3A 5FU7C 1OX9A 3EG0A 1WHGA 2K9GA 4BI8B 1M5Q1 3I35A 2EQJA 3FJPA 4C92G 1XNIA 2H8HA 3FDRA 5L8RE 3QYGB 2L5QA 2GQIA 1ZHIA 1K8AU 2PVGB 2X9HA 3P8DA 2EYZA 3GNFB 5GAOq 3EFSA 4PJOF 1M8MA 2ZPIB 3NMZC 2CP2A 3V7CA 4J83A 3CBMA 2KROA 3EGUA 4J9DA 4PFPA 5D6WA 3CC4T 1D0YA 4ZGJB 2AKLA 2K79A 5GAN5 2E6NA 4E47A 1Q81C 1OOTA 2E12A 2FZKB 1ZLMA 3L2UA 2R5AA 3A8HB 3M0UA 3RESA 1BIAA 4AFSC 3OS1A 3RIRA 5C0MA 1YCSB 1M1KR 1C0MA 4J5YA 2GNCA 2EQIA 1GCPA 4LDWA 2J05A 2RHUA 4N0AA 3CC7T 5KYUB 4RTWA 2O31A 3I56Q 4ELYC 4JRIA 5CVIA 1AOJA 3EGDA 1ZBXA 1S72T 4RTVA 3CCMQ 5DM7R 1ZUKA 1NJIR 1WYXA 3GLXA 2LX9A 2CKKA 4JPBW 4R0KA 2JXBA 1BI0A 5FWBA 1PSFA 1TSFA 2ZGWA 4OMFB 4R56A 2PUOB 3S3OA 5LJ3e 1EZZB 4OGCA 5FU6C 1MV0B 2XHCA 2YSQA 3MO8A 3OA6A 2QI2A 1ZQ1A 3A8OB 3V7SA 1UDLA 4C0DB 1M9SA 2MWOA 1Q81U 2DMOA 1VQ7T 2HAXA 4A54A 2DVEA 4N0AC 2KXDA 5GAOr 2V26A 3PVLA 1K8AR 2M0OA 1YJWA 4B6MA 2K7AA 3JCMg 1WNLA 1X69A 2GFAA 3UWNA 5GAN7 3EH1A 2F2XA 3PGGA 2E41A 2DZ9A 1OU8A 4P5NA 4M75E 1I0CA 4JJBA 3JCMd 5IXFA 3J7AF 3H0HA 1YFNA 3RDVA 2NUPB 2LJ3A 1B07A 2NUTB 2KVQG 3CCLT 2D8JA 2F69A 2PNIA 3QXEB 4GBQA 2MWPA 4OB1B 4ANJA 2BTTA 1G3TA 1XTDA 3M4GA 2FPDA 1LJOA 2RI3A 1KIKA 4GY5A 3MJXA 2OJ2A 4AG1C 3CCEQ 4JRQA 2DX1A 2DLPA 4VUBA 2RF0A 5IT9E 2JM9A 4M78E 4ZN1A 5GANj 1UFFA 3L42A 4XU3A 1ACMB 1XJWB 2QAZA 3E2UA 3PMTA 2K3YA 2KR3A 5KYXA 2XU8A 3KFVA 1OU9A 1YP5A 3MP1A 2DYIA 3ZEHA 4BI3A 2YRCA 1Q81R 3JB9G 2HL5C 4CI0C 2RQRA 2BZ8A 5DLOA 2LJ0A 3JCMJ 1VQ4T 2QTXA 2YLBA 2A7YA 1YBYA 3URGA 2QQSA 4LUDA 3HFNA 1IHVA 2XIDA 1M2VB 5I11A 4R55A 3QWYA 1X2QA 5FROA 5LJ3g 1QVGP 4OMOA 1AWWA 2DPPB 3CCEA 3I9QA 4MZMA 4PFOA 1QVFA 1MMGA 4ZNXA 1QVGS 3LWHA 3OSSC 1D1AA 3M56A 3I55Q 1IRXA 2HD0A 2JN0A 3J81E 2CZ1B 2L0AA 4CC2A 1KQ2A 2VYTA 2MI6A 2QGGA 1D0ZA 5LJ3d 2RM4A 1BBZA 4JRKA 2P0QA 5FU7B 5GANe 3CCQQ 1PKSA 1OI1A 4M77C 3DLMA 3VV0A 5CQXA 2AT1B 1D1BA 1H92A 3EG3A 1M2OA 4QVZA 2F2VA 3REAB 2X4JA 2ZPHB 1ZSZA 1KJWA 2RQWA 4XTUA 1TUDA 2LQWA 2LCSA 1PRMC 4CC7A 1WDXA 2OTLA 3OYGA 1KQSA 3CCJT 2RQVA 2D9TA 1ZSGA 3SEMA 2H3EB 1NLPC 1PNJA 2LQKA 3H6ZA 3PNWC 1U1TA 3QBYA 1QWEA 1RLPC 5GMKm 1TWBA 2P0PA 4QQDA 1UUEA 5CCAA 5GMKl 1V76A 1W4SA 2YDLA 4PJMA 3CC2Q 4M7AG 5IH2A 3G4SA 1PM3A 4JJCA 1CKBA 2DXTA 1QVFS 1YJWT 2CSQA 1VYTA 1K4US 2QA4A 1YWPA 2JTFA 1VQKQ 5KYWB 3CMAQ 3FIFA 3CQTA 3CD6A 2FG0A 3GPLA 1X6OA 3VS2A 1BCMA 3H8ZA 2IG0A 2XDPA 4J7IA 8ATCB 3A1PA 3M0PA 1W1FA 5IAYA 5FU6B 2F5TX 4OGEA 1H3ZA 1T0JA 2YRVA 3C4SA 1Y96A 4AT1B 4PL6A 4BY6B 4X34A 2DFUA 2JT4A 2HCKA 1RUWA 3R6OA 2RD1A 1WFWA 4DEXA 1KQSP 2LT4A 1WIEA 2PVOB 3REBB 2D0NA 4J8OA 4RKUE 2LDMA 1KQSS 2LT1A 2JMAA 2ECZA 2IIMA 3OYLA 3M0SA 3EGXB 5CAIA 4EMHA 2OTJT 3ZBDA 4ZTJA 4EMGA 2FZGB 2RHYA 1OZ2A 2DYBA 2J7IA 3JCMW 3OYEA 4M7AB 1UGSB 4OP0A 4XTYA 1M30A 2L3QA 2L3SA 1TTHB 5AT1B 5GANg 2EVRA 1WXUA 2MCNA 1NPRA 4RG2A 4J9CA 4X9DA 2DEQA 5FLXE 5GAN3 1MNDA 2CUDA 2JUFA 3G71A 1H8KA 4C92A 2A36A 5M9OA 2DTOA 4X1VA 3E19A 4AG2C 1VQ8A 4Y28E 2KQWA 5GANd 4E7SA 2VUBA 2K5LA 1B7TA 1VYUA 3OS0A 2XK0A 3SD4A 2O9VA 3A8MB 4E7LA 4WF2A 2RJCA 3UF4A 4OMPA 4F16A 1JJ2A 2K5FA 1VQ9A 1HXDA 5KE2A 5GAN2 5LJ5e 2MF2A 4L59A 1VQ7Q 1PC0A 1I07A 1G2BA 1C6VX 2DA9A 5J3BA 4IKFA 4ZGDB 3A98A 3JB9J 4RG8A 2DILA 4M77E 3QG1A 4D8KA 3OQ5A 3JCMh 3S3MA 5IHNA 3LW5E 3CCST 4M77D 5CKFA 1KHCA 3FB9A 4L5GA 1Y71A 2FPFA 1U3OA 3CPWP 5D7UA 3EH2A 3CMET 2FHDA 1YHQA 2RI5A 4XU2A 1GFDA 4ESRA 1OX8A 3CPWS 1VQMA 1XOVA 3VU3C 3CCLQ 2MPXC 5CKDA 2YUNA 2KRMA 2L89A 3G6EA 1U5SA 3OB9A 4PJOG 1KHIA 4CRIA 1V29B 3S6WA 1RACB 4M7DC 4A4GA 3CBOA 3X28B 3OYFA 3QPHA 4E7KA 2EGCA 2L3PA 4J9GA 3RR6A 5HK0A 4KH0B 5DY9A 3META 1M90C 4A4KA 1N9SA 2AKKA 3QDFA 1PRLC 4M77B 4D6WA 5GAN4 2C0IA 4EMKB 4C5IA 2X4XA 1JJ2S 2BKDN 2QEXT 1WA7A 3DLLA 3TVTA 2KAFA 3G4ST 2B8AA 1SHFA 3D7SB 3SB2A 1WHJA 3I5SA 1VQOT 2X35A 1JQQA 2BZXA 2X4WA 2ZCFB 2VV5A 4O6JA 5CQYA 1SSHA 1ZA2B 4F04B 3OYHA 1VQ4Q 3OYCA 4M77F 1E6GA 2JMCA 2RK2A 1E7OA 2O01E 2M02A 2LCLA 1D3BB 3L1AA 4YTLA 2WSCE 4J9BA 3CCUT 4LNPA 2KXCA 2CS7A 4JJNK 4XTXA 1NZ9A 2P4RA 5CKEA 3MEUA 2HNIA 5GMKj 3QYHB 1UGRB 2KY9A 1Z9ZA 4DA4A 1G5VA 3CXCA 4RCBA 5LJ5g 2DIQA 2QK0A 4QVDA 4XQ3A 4GLKA 2KK4A 2NWMA 4XK8E 2K5IA 5D6XA 1GL5A 2RB6A 3CCRQ 1YIJT 1N5ZA 4OMNA 5HKCA 2NLUA 2DVJA 1WI7A 2ENMA 3OYYA 2R57A 2RPNA 3TSZA 5LJ5d 1IGUA 1QKWA 1VQ6A 4FSSA 4BDYA 1OPLA 2EW3A 2M16A 5GAOn 3HRSA 3C94A 2K2VA 2DAQA 5GJWB 3OBWA 4LD9K 1WQ7A 4N4GA 3UPUA 4F7UE 3CCJQ 1LOJA 2JVVA 3INZA 3FLGA 1YI2T 2HKNA 3OYJA 1LCKA 3CCVT 4FSXA 1UHFA 2KRNA 1PG5B 3M0QA 2L8DA 2QASA 1X01A 2OAWA 3ME9A 4KGVB 1D09B 4RMOA 1TOVA 1RAEB 4OMLA 2C06A 4HVWA 2K6DA 5GAOm 2DJQA 2ESWA 1M90R 5GMKe 2EJ9A 2GCXA 3T9NA 3CCRA 2Z0WA 3M5AA 5GAOl 2DTIA 2RQTA 3LLRA 3LGFA 2A08A 2OAUA 2O4XA 1A0NB 2BZYA 1EIFA 4A63B 4C8QE 1W70A 3MCAB 4F7UB 3CPFA 4C8QD 4IUQA 2PTKA 2ZPFB 3M58A 2KBTA 3H0FA 1YHQT 4M7DE 1FWZA 3CEYA 3HPWA 3EGXA 2G6FX 4PFZA 4ZTFA 3G6ET 2LZ6B 4M7DD 4ATOA 2D6FA 1PSEA 2B86A 1GRIA 2LVMA 5GAMe 5KCOA 1AEYA 1O75A 1YITT 4M7AA 1NE8A 2KRSA 5GAN6 1I81A 3DB4A 2OTJQ 3L2WA 4HVUA 4F7UF 3I56A 1VQNT 4C8QB 2L3RA 1B34A 3CCMA 2CYZB 3OMGA 2NYSA 4M75D 5IHKA 4EDUA 4M78G 3NFCA 1AWOA 3QSUA 5KYYB 1R0CB 4M7DB 2ABLA 3QZ9B 4Z8AA 1VQ5Q 1QCFA 1JXMA 2DBKA 1QVPA 2LRQA 1Y57A 2AZSA 2J6OA 1BYMA 5I2MA 3PIOA 4FW1A 5CKHA 3VS3A 1YJ9T 4C5HA 3PTAA 5GMKi 1I4K1 2QQRA 5J26A 3SWNB 1YJNQ 2RO0A 2RA2A 2FL7A 4C8QF 3M9QA 2CDTA 4II1A 1R8OB 1IXDA 3GNGA 4M78D 4M75B 5HCKA 2QGFB 1D0XA 2KGTA 1H641 1HYOA 2CGHA 3RERA 2LNVA 2ATCB 2ZPEB 3EHQA 2KSSA 4M7DF 2VXEA 2RH2A 3VS7A 1EFNA 2A3LA 4PK4A 1FMVA 2J6FA 1UECA 3BDLA 3UATA 2HQHA 4DEYA 3CCSQ 5FRNA 1N8RC 1W6XA 2ROTA 4QT7A 2K57A 2LQNA 3L2RA 2XMFA 2MK5A 2M1HA 1UJYA 2M9UA 4RTUA 4M78B 1BB9A 4M75F 1KG1A 2KT1A 3CMEQ 3LGLA 4IUVA 1UTIA 1M1FA 1CKAA 4XU0A 1KC8C 1FX7A 1OEBA 2RJFA 2HBPA 5I21A 4OF1A 4Z89A 3HRTA 1MV3A 2JZ2A 3J80E 4EMKA 2EBPA 2QG9B 2VB6A 3L2VA 4PJLA 4NS5A 3WVDB 3NTIA 3PVQA 3EG1A 1T3LA 1JB0E 3H41A 1BI3A 3EFRA 2RN8A 1O9SA 4LE9A 5GAMg 3V8JA 2A28A 4QVCA 1JXOA 2KE9A 3O5ZA 2PVDB 3NHNA 2EQKA 4V2SA 2QEXQ 4HVVA 3OYNA 4M78F 1AD5A 1NYGA 4MZTA 2CZ6B 2HBWA 4E7IA 1N8RU 3E9FA 2CH4A 1TU0B 3OYIA 3VS0A 1WHHA 2JS0A 2V8IA 3RBBB 4CC4B 4AFQC 5GAMd 4FYYB 1VQOQ 2QYZA 4LUEA 1NEBA 4NL3A 3THKA 2AZVA 1I1JA 3C95A 2Y4XA 1AWXA 3EG9A 3OW2A 4EPCA 1KC8U 4IURA 1BKBA 2LC4A 5FW9A 4PJOA 2DL7A 1SRMA 1VQPQ 2JTEA 1QVFP 3I55A 3FEOA 1M3AA 1B3QA 1LPLA 2CP6A 2EAYA 2DEUA 1G3SA 3ASKA 5I2SA 1WQWA 3CCUQ 2CH4W 3V8LA 2O88A 1IHWA 1ZSZC 1K73C 2EWNA 1MNEA 2LJ1A 2A0FB 2HKQB 2QDYB 3CCQA 2RHZA 4J7FA 1F1BB 3M59A 1KSWA 2LTOA 4HA8A 8AT1B 4D8DA 2HL3A 3FRNA 1VOMA 1TXQA 3I56T 4FIBA 5GAOp 3BFMA 1VQLQ 5GAN8 3V7RA 3CCMT 1YIJQ 1KFZA 3JCMf 2VC8A 4MDWA 4EIKA 4C5EA 1X6BA 4BE1A 4IIMA 2EKOA 1GBRA 4LD6A 4C0GA 4HT9A 1M8VA 5LJ5j 2XICA 3JB9H 2J6KA 4WTOB 1N8RR 3VS4A 3JSCA 3H0IA 2V8JA 4J6XA 1VIFA 2PU9B 4ZN3A 1VQPA 3GOXA 4OB3B 4WCIA 4BD3A 3C12A 3CC2A 1RLQC 2I2LA 3CC4Q 1K73U 5KYNA 1YI2Q 2BE9B 1VA7A 1G3WA 3CCVQ 1SF9A 3F70A 2FVUA 5KYUA 1VQKA 1BI1A 3CMAA 1KC8R 4E7ZA 3QHSA 4FCYA 3JRZA 2JS2A 1UGVA 2D8HA 2VGNA 2XDBA 1OYXA 3CC7Q 1OV3A 2DL8A 3KXTA 2E64A 5EC7A 1RAFB 2YUOA 5FWCA 1S72Q 3PE0A 1U06A 4BDZA 2EJFA 4DQ2A 5LL6S 1WJSA 3Q1JA 3JCMP 1NPPA 3HFOA 3S3NA 1QMCA 1KK7A 4RUGA 4M77G 3RNJA 1Z9QA 5A2QE 4BB7A 2V1QA 4LXCA 2EIFA 2E1HA 2KT8A 4PJNA 3VYGA 1AVZC 2Y90A 3CCET 4BI4A 2WSFE 4BE2A 1SSFA 2C0TA 1UHCA 2E6ZA 1TG0A 4C92C 4DBRA 4B9WA 2FZCB 1K9MC 5LJ3f 2E3IA 2NUPA 3M4YA 4C0FA 1YITQ 2HSPA 2ROLA 5A0LA 4Y91A 2E4HA 2NUTA 1K73R 3GIBA 3MP6A 1VQNQ 1W2BA 2P84A 4J9FA 3G7ZA 1WHMA 3EAEA 2YWWA 2JJ9A 1UG1A 2PZ1A 3N5BB 2OTLT 2KDSA 2DRKA 4RTZA 2G3RA 2DL4A 1GCQA 2PQWA 1R0BG 3LYIA 2ZAEA 4QQGA 1RAGB 3M54A 1WGSA 4N4IA 1JJ2P 3MEWA 1K1ZA 3P8HA 1ARKA 4RTXA 1VQ7A 1YJ9Q 2QQAA 1UE9A 2CZ7B 4F17A 1K0SA 1PHTA 4RTYA 5A0GA 3I55T 3HKSA 3TEEA 4XU1A 2DXCA 2ZZDA 2DNUA 4DBHA 4J9EA 2DL5A 1K9MU 1V1CA 1HK9A 3E9GA 3V8KA 2QDLA 1MMDA 5CK9A 1Y07A 2LP5A 2QA4T 3CCQT 5CIUA 1BK2A 3CBPA 3CD6T 1RL2A 2COWA 1DJ7B 4IIOA 2YUQA 3TREA 3QZ5B 7AT1B 1GCQC 5KH6A 5A0DA 1M2VA 1K0XA 4JUVA 1WJRA 4M4ZA 3HHTB 2E70A 2DZCA 3CCLA 2LX7A 5GMKh 1YNZA 4J6WA 1M4ZA 3PFSA 2DL3A 3VUBA 3PT9A 1Q86C 1P92A 6AT1B 1VYVA 4A4HA 1OULA 2QTVA 2E65A 2IPOB 1RAIB 5LJ3h 4DBQA 4IUPA 1K9AA 1UEBA 4JRPA 2MOXA 2GF7A 4HT8A 1VIEA 2VVKA 2EJGA 5CO7A 3JV3A 3CMAT 4JZ4A 4F7UG 1RI9A 1WLPB 3BDUA 2RQUA 2ED1A 3QIIA 3BW1A 1NYFA 4JJDA 1VQ4A 1K9MR 3SDZA 2VASA 2XG8D 2EQUA 3TSWA 1Q86U 1FYNA 2HDAA 3G71T 4E7JA 3RKXA 2GQVA 4KUDK 2K4YA 1VQ8T 1UGQB 5GAMj 1QCOA 1MHNA 4DOWA 3PIPA 2GGRA 1FMWA 3VS6A 5GANf 4KULA 5KCHA 2ZPGB 4OB0B 2LMJA 4TVRA 1WXTA 1Y96B 2FEIA 2DXBA 2RK1A 3M57A 2FPEA 4C8QG 2DRMA 1FMKA 3IQLA 2CT3A 5KYWA 1VQ9T 1NLOC 2GTOA 1TH7A 3VRZA 4L6V5 5HK3A 3A8LB 3FC3A 1GBQA 3CXCP 1RAHB 4C92E 3EFOB 2CT4A 3QUIA 3QO3A 1JU5C 1JEGA 1MUZA 1YJWQ 2JM8A 5AYFA 2HZYA 4J9IA 3U23A 3CXCS 4M7DG 4A4EA 2ED0A 4C92D 4FL6A 1IREB 3X26B 3MHXA 4MMKA 1UB4A 2F1LA 2C0OA 3PMIA 2P0KA 4KRTA 3QJ6A 4BE0A 3X20B 1KD1C 4JLGA 3QJYA 3JAME 4OB2B 3FJ5A 3OS2A 2DE0X 3CCJA 1Q82C 1SG5A 2K3BA 4M75G 1VQMT 2W0ZA 4AFZC 4FYXB 1BIBA 4KUIA 2E3HA 2MIOA 1G8XA 2JTMA 4C92B 1ZBJA 4BY6C 4C5GA 5KE3A 1Q86R 2LNHB 2BUDA 1TUGB 2SEMA 3NPFA 3MEVA 1WHLA 4OVAA 4XTVA 1TUCA 1X75C 2DKGA 2DETA 1LVKA 4LDYA 4KT0E 1M3CA 3M53A 3ZFJA 2VGMA 2FRYA 4FYWB 3VS1A 1M3BA 4KGXB 2DK3A 1ZA1B 2JOYA 3VKIA 2E10A 3OS5A 2FRWA 3EHRA 4Z02A 5FRMA 4A53A 3JCMb 1KD1U 2DTHA 3RMQA 4CC3A 4IUTA 5GANh 3TCJA 2HMAA 1H3HA 4C92F 4PJJA 2X4YA 1Q82U 4HCKA 1KQ1A 4N4HA 2M0YA 1QWFA 2H3JA 4M7AC 2MAMA 2E5KA 1ZUUA 4HCBA 2E5QA 3OMCA 3P8BB 2COZA 4ELZC 2O2OA 2OX7A 4GLMA 3LWIA 2DF6A 1N9RA 2DXUA 1QVGA 1EX4A 2RNAA 3OYAA 2AIRB 2CP5A 4OMMA 3M0TA 4NOYA 1RADB 4JLIA 4OMQA 2OTJA 1G83A 2KI7A 2RI2A 4PLLA 1T3SA 2W10A 3OBYA 2RHXA 5CKBA 2CREA 4DBFA 1HD3A 4LDVA 4FT4A 2YHTA 4JS4A 2YLCA 1U8RA 1AZEA 3RKYA 1WHKA 1VQ5A 2BE7D 3HL8A 3JCMc 3QDRB 2RJDA 1VQ6T 4Q5WA 5LJ5f 2O9SA 4LDUA 3JB9I 1YCYA 1LNXA 3UA6A 3OY9A 3JCMX 1NEGA 1YJNA 1G3YA 3SHWA 1AWJA 4M77A 2OTLQ 2YT6A 2X3WD 2F2WA 3DKMA 1BU1A 3G1JA 3TQ7P 4AMCA 1KD1R 5EG2A 3H9NA 1CSKA 2CP3A 2CP7A 2FYKA 3QWXX 1Q82R 2KMTA 4LN2A 1X6GA 3MPUB 3JB9D 1MMNA 2PUKB 2DIGA 2KYMA 2SRCA 9ATCB 4FT2A 2D1XA 4HCZA 2XKOC 1IB8A 4RCCA 5L23A 3I5RA 3G4SQ 1UJ0A 3L2QA 3VRYA 2XDDA 3VUZA 3CCRT 2QA4Q 2K3XA 3CCSA 2EPDA 5D6YA 1RABB 2RJEA 2Y4YA 3CD6Q 2GFUA 4IUUA 2L2PA 2HSEB 4EMKC 1RAAB 2WSEE 3AT1B 1D3BA 1R77A 2DM1A 2AK5A 1SKUB 3CMEA
chains in the Genus database with same CATH topology
4RCBA 3JCMd 3J7AF 5LJ5g 1JBMA 2DIQA 3CCET 1Q7YC 2AHJB 4QVDA 4XQ3A 4GLKA 4JDSA 4BI4A 3OYDA 3JCMV 2WSFE 5DLQE 4BE2A 2KK4A 1SSFA 4XK8E 5D6XA 2K5IA 5J39A 2RB6A 3JCMQ 5CR2A 1YIJT 2KVQG 3HSBA 3CCLT 2F69A 2E6ZA 3QXEB 5HKCA 2NLUA 4C92C 4J6YA 1U1SA 3OYYA 1QP2A 4B9WA 2MWPA 2R57A 4OB1B 1K9MC 5LJ3f 5LJ5d 1G3TA 2QXFA 3M4YA 4C0FA 5IN1A 1XTDA 3M4GA 3WVEB 4A4FA 5A0LA 1VQ6A 4Y91A 1LJOA 2RI3A 1BI2A 4BDYA 3GIBA 3DB3A 4GY5A 2M16A 3MP6A 5GAOn 3HRSA 1W2BA 2EFIA 3C94A 2QEXA 2K2VA 3KBGA 3G7ZA 4JRQA 3KUFA 2DAQA 3EAEA 4VUBA 3OBWA 4LD9K 1WQ7A 5IT9E 3VYHB 4M78E 4ZN1A 5GANj 4N4GA 5LJ5h 3UPUA 3L42A 4XU3A 4F7UE 3JB9F 4QW2A 1LOJA 2JVVA 3INZA 3PMTA 3N5BB 4PJOC 3FLGA 1YI2T 2K3YA 3OYJA 2OTLT 2KDSA 3CCVT 1VQOA 2XU8A 4FSXA 2L8DA 2G3RA 3MP1A 3ZEHA 4BI3A 3X24B 1X01A 4BUGA 3AHUA 3ME9A 2PQWA 4RMOA 3LYIA 4QQGA 1Q7YU 3JB9G 2CZ0B 4MDXA 3M54A 4M7AE 1WGSA 4MZPA 4N4IA 1QW1A 3MEWA 4CI0C 2C06A 3P8HA 4HKEA 1VQ7A 2QQAA 5DLOA 2O4XB 2CZ7B 4O5VA 3JCMJ 5GAOm 5GMKe 5A0GA 2EJ9A 2GCXA 3I55T 3HKSA 1VQ4T 3TEEA 4M7AD 2QTXA 2MMPA 2YLBA 4XU1A 3T9NA 2A7YA 1OZ3A 3CCRA 2DXCA 2ZZDA 3M5AA 5GAOl 2DTIA 3OW2S 2BIVA 3CCUA 1K9MU 3LLRA 1YBYA 3URGA 3LGFA 1HK9A 2OAUA 2QQSA 3E9GA 3V8KA 5CK9A 2O4XA 4XTWA 3HFNA 1Y07A 3A8GB 1EIFA 2QA4T 2HQXA 4C8QE 3CCQT 2XIDA 4R55A 5CIUA 3CBPA 5FROA 3MCAB 1I8FA 3A5ZB 1FXXA 3CD6T 1RL2A 5LJ3g 1DJ7B 4F7UB 3CPFA 2DPPB 3RMSA 3TU4K 4C8QD 3TREA 2LCCA 4IUQA 3CCEA 3QZ5B 4MZMA 3RUXA 2ZPFB 1QVFA 3M58A 3OSVA 5KH6A 5A0DA 1QVGS 3LWHA 3OSSC 3M56A 1YHQT 1WPYA 4JUVA 4M7DE 1WJRA 2HD0A 1FWZA 2JN0A 3CEYA 3HHTB 1VQLA 2E70A 2CZ1B 3J81E 2DZCA 2P4TA 3VJPA 4F7UA 2VYTA 3HPWA 2MI6A 1YIJA 3CCLA 1KQ2A 2QQBA 5GMKh 4ZTFA 3E1SA 5LJ3d 1AHJB 2RM4A 4J6WA 3G6ET 1M4ZA 4JRKA 3PFSA 4M7DD 4PLIA 3VUBA 3PT9A 4ATOA 1Q86C 2P0QA 5FU7B 2D6FA 1PSEA 1P92A 5GANe 1I5LA 2F5KA 1OI1A 2R5MA 4M77C 2LVMA 2XI9A 2QQ9A 5GAMe 3DLMA 5KCOA 3VV0A 5CQXA 3CPWA 4A4HA 1B34B 1O75A 1RI0A 1YITT 1NE8A 1VQ5T 1M1GA 5GAN6 4M7AA 1JRIA 2EQMA 2E65A 1I81A 3WXMB 3DB4A 5LJ3h 3HRUA 4QVZA 3L2WA 4IUPA 4DOVA 1UEBA 4F7UF 2X4JA 3I56A 2ZPHB 4JRPA 1VQNT 4XTUA 4C8QB 3NTHA 3CC4A 2GF7A 4HT8A 2L3RA 1B34A 1VIEA 3ER0A 3CCMA 2V8KA 4BACA 3GF5A 2CYZB 1YI2A 1YJNT 3OMGA 2OTLA 3CCVA 4M75D 2EJGA 3OYGA 1KQSA 4LDXA 3M55A 4EDUA 3CCJT 4M78G 3NFCA 3UDCA 5CO7A 4C8QA 2D9TA 3CMAT 3QSUA 4F7UG 1IZ6A 4ZGEB 4M7AF 2JNGA 4M7DB 2LQKA 3H6ZA 3PNWC 3QZ9B 1U1TA 3QBYA 3BDUA 3QIIA 4C0DC 1QVPA 2LRQA 2RHIA 5GMKm 3BW1A 2P0PA 3CC7A 4QQDA 1VQ4A 1BYMA 5CCAA 5GMKl 1W4SA 5I2MA 3SDZA 4M7DA 3PIOA 5CKHA 2WACA 4M7AG 4KBMB 1YJ9T 4C5HA 2XG8D 4PNOA 3PTAA 1S72A 3G4SA 5GMKi 4ME7A 2EQUA 1I4K1 1Q86U 2QQRA 4MMLA 5J26A 3SWNB 3G71T 4KUDK 2DXTA 2RO0A 4QQ6A 2RA2A 3RKXA 2GQVA 2FL7A 4C0ZA 5C6SA 4E7JA 4C8QF 1YJWT 3M9QA 2K4YA 1VQ8T 2QA4A 4II1A 2JTFA 1UGQB 5GAMj 1R8OB 1MHNA 4DOWA 3PIPA 3GNGA 3FIFA 5GANf 3CD6A 4KULA 4M78D 4XTZA 4M75B 5KCHA 1X6OA 2ZPGB 3GPLA 3MEAA 4OB0B 4TVRA 3SWNA 1Y96B 5GAMf 3H8ZA 2IG0A 4B9XA 2XDPA 3MP8A 2DXBA 2RK1A 3M57A 1UGPB 4J7IA 1H641 4C8QC 2CGHA 3RERA 2LNVA 2ZPEB 4C8QG 2KSSA 1QVFS 2VXEA 4M7DF 1VQ9T 5IAYA 2RH2A 5FU6B 1TH7A 2A3LA 2F5TX 4OGEA 1H3ZA 4L6V5 2EYQA 4M75A 5HK3A 3A8LB 2YRVA 3C4SA 1MGQA 3FC3A 1Y96A 4X9CA 4PL6A 4BY6B 4C92E 4HCCA 3QUIA 4X34A 3QO3A 3BDLA 3RKWA 5AYFA 1M1KC 3R6OA 2RD1A 3BY7A 3CXCS 4M7DG 5FRNA 4A4EA 1N8RC 2LT4A 4C92D 2VXFA 2K57A 3L2ZA 3L2RA 4UC4A 4FL6A 1IREB 2PVOB 4NL2A 3X26B 3MHXA 4J8OA 1YITA 4MMKA 1UB4A 2M1HA 4RKUE 2LDMA 1KQSS 2D0QB 2LT1A 2M9UA 4M78B 3PMIA 2P0KA 4M75F 1KG1A 1NJIC 3OYLA 1VQNA 3SWNC 1VUBA 3QJ6A 1GXIE 3LGLA 4IUVA 4FM4B 5CAIA 4BE0A 4EMHA 3X20B 1M1FA 1KD1C 4PJOE 4JLGA 4XU0A 1KC8C 2OTJT 3ZBDA 4ZTJA 1FX7A 4EMGA 3QJYA 2RJFA 5I21A 2HBPA 4OF1A 4M78A 3JAME 4OB2B 3HRTA 4M75C 2JZ2A 2RHYA 3OS2A 1OZ2A 1N27A 3J80E 4EMKA 3CCJA 1Q82C 4M75G 2DJZA 3JCMW 1VQMT 1W2BS 4PJOD 3L2VA 3OYEA 2HQEA 4NS5A 4M7AB 1BIBA 1UGSB 4OP0A 4PKCC 3O8VA 3QKJA 4KUIA 4XTYA 3WVDB 3NTIA 5GANg 4JS5A 2ZPBB 2JTMA 1JB0E 4C92B 1BI3A 3EFRA 1NPRA 5GAMg 1O9SA 3LX7A 3UT1A 3V8JA 1Y7XA 4QVCA 4RG2A 4BY6C 4C5GA 4X9DA 5KE3A 1K8AC 2PVDB 2EQKA 2DEQA 4V2SA 5FLXE 2BUDA 1YJ9A 3MEVA 3OYNA 4M78F 5GAN3 4OVAA 4XTVA 1M1KU 2JUFA 1VQPT 3G71A 5HY6A 1X75C 2IVWA 4MZTA 4C92A 2DO3A 2CZ6B 2DKGA 2DTOA 5M9OA 4E7HA 4E7IA 3E19A 1N8RU 1VQ8A 2LQ8A 3E9FA 3CC2T 4Y28E 2KQWA 2DD5A 4LDYA 3JCMe 5GANd 3OYMA 3OYIA 4KT0E 3M53A 1M90U 2VUBA 2V8IA 2K5LA 3ZFJA 2VGMA 5GAMd 3OS0A 2XK0A 3SD4A 4M78C 3A8MB 4E7LA 4WF2A 3OYKA 2RJCA 2R58A 2DK3A 2JOYA 1N6AA 1VQKT 4NL3A 4PJOB 1NJIU 3VKIA 1QP3A 3C95A 2E10A 3OS5A 1JJ2A 2Y4XA 4Z02A 5FRMA 3SFMA 2K5FA 4A53A 1YHQA 2FB7A 1VQ9A 1HXDA 3JCMb 5KE2A 1KD1U 3X25B 2DTHA 3RMQA 5GANh 4IUTA 3LH0A 2DD4A 3TCJA 4EPCA 3GP8A 4IURA 5GAN2 1KC8U 5LJ5e 1BKBA 2MF2A 4L59A 4FU6A 4XAXB 2LC4A 4C92F 5GAMh 2X4YA 1Q82U 4PJOA 3HP9A 1KQ1A 4N4HA 2XD0A 3I55A 2H3JA 3NTKA 3FEOA 3OYBA 5J3BA 1WJQA 4M7AC 2MAMA 1VQLT 4IKFA 2EAYA 4ZGDB 1G3SA 1XQHA 4RG8A 3JB9J 5LJ3j 3ASKA 5FU7C 4HCBA 5I2SA 2E5QA 1WQWA 4M77E 3OMCA 3P8BB 4ELZC 3V8LA 3LWIA 4BI8B 1M5Q1 3QG1A 2EQJA 2EWNA 3FJPA 3OQ5A 3JCMh 4C92G 1XNIA 3S3MA 1K73C 3LW5E 2QDYB 3FDRA 3CCQA 2RHZA 3QYGB 4J7FA 2L5QA 1N9RA 2DXUA 5L8RE 3CCST 3OW2A 1QVGA 3M59A 1ZHIA 4M77D 5CKFA 1K8AU 2PVGB 3OYAA 2LTOA 4HA8A 1KHCA 3P8DA 3FB9A 3GNFB 4L5GA 5GAOq 3EFSA 4PJOF 4NOYA 1Y71A 2ZPIB 3FRNA 4JLIA 2OTJA 2RI2A 3CMET 2FHDA 3V7CA 2RI5A 4PLLA 4J83A 4FIBA 4XU2A 3CBMA 5GAOp 3I56T 3BFMA 5D6WA 5GAN8 3V7RA 4ZGJB 3CPWS 3CC4T 3CCMT 1VQMA 5GAN5 1XOVA 3JCMf 3VU3C 2VC8A 5CKDA 2E6NA 4MDWA 3OBYA 2L89A 4E47A 3G6EA 4CRIA 3OB9A 4PJOG 1KHIA 1Q81C 4C5EA 2E12A 1V29B 3S6WA 2RHXA 5CKBA 3L2UA 4M7DC 4A4GA 2R5AA 3A8HB 3CBOA 3X28B 3OYFA 4BE1A 3QPHA 4LDVA 2EKOA 4FT4A 4E7KA 2YHTA 4JS4A 2YLCA 3RESA 1U8RA 5HK0A 1BIAA 4LD6A 4C0GA 4HT9A 1M8VA 5LJ5j 3OS1A 2XICA 3RIRA 5C0MA 1M90C 5DY9A 3META 4A4KA 3JB9H 3RKYA 1N9SA 1VQ5A 3HL8A 3JCMc 3QDRB 4J5YA 2RJDA 3JSCA 4LDWA 4M77B 2RHUA 4J6XA 2V8JA 4Q5WA 4D6WA 5LJ5f 4N0AA 1VIFA 1VQ6T 5GAN4 2PU9B 4ZN3A 1VQPA 3CC7T 4EMKB 4C5IA 3GOXA 2X4XA 4OB3B 4LDUA 4BD3A 3JB9I 1YCYA 1JJ2S 3C12A 4JRIA 4ELYC 2BKDN 5CVIA 2QEXT 3CC2A 3DLLA 2I2LA 1LNXA 2KAFA 1S72T 1ZBXA 3OY9A 3JCMX 3G4ST 1K73U 5DM7R 2B8AA 1YJNA 1G3YA 4M77A 1G3WA 3DKMA 3GLXA 2LX9A 3F70A 2FVUA 2CKKA 3SB2A 1VQKA 5EG2A 1BI0A 1BI1A 3CMAA 1PSFA 2ZGWA 4OMFB 4R56A 2PUOB 3S3OA 5LJ3e 1VQOT 2X35A 3QHSA 3JRZA 2FYKA 4OGCA 2KMTA 2X4WA 2ZCFB 2VV5A 5FU6C 2VGNA 4O6JA 2XDBA 1OYXA 5CQYA 3JB9D 2XHCA 3MO8A 3OA6A 2PUKB 2QI2A 3OYHA 1ZQ1A 3A8OB 3V7SA 4C0DB 2DIGA 1M9SA 3OYCA 3KXTA 2E64A 2MWOA 1Q81U 1VQ7T 4FT2A 4HCZA 4M77F 2XKOC 4RCCA 4A54A 2HAXA 2DVEA 4N0AC 2RK2A 3L2QA 4BDZA 5GAOr 2XDDA 2EJFA 2O01E 2M0OA 5LL6S 3VUZA 4DQ2A 1YJWA 2LCLA 1D3BB 3L1AA 3JCMg 1WJSA 3CCRT 4YTLA 2WSCE 2K3XA 3Q1JA 1WNLA 3CCSA 3JCMP 1NPPA 3HFOA 5D6YA 3CCUT 2GFAA 3S3NA 3UWNA 2CS7A 2RJEA 4JJNK 2Y4YA 2GFUA 4XTXA 4IUUA 4M77G 1NZ9A 5GAN7 4EMKC 2WSEE 5CKEA 3MEUA 2HNIA 2E41A 3PGGA 5GMKj 1D3BA 3QYHB 1UGRB 4BB7A 5A2QE 2KY9A 2DZ9A 2EIFA 2E1HA 4P5NA 3VYGA 3CMEA 4DA4A 1G5VA 4M75E 3CXCA 2Y90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VYT A;  2DIQ A;  4UC4 A;  3L2R A;  1KHC A;  3P8D A;  4FL6 A;  4ZTF A;  3OYD A;  3PFS A;  4BE2 A;  4PLI A;  1SSF A;  2M1H A;  5D6X A;  2LDM A;  5J39 A;  2RI2 A;  2FHD A;  2RI5 A;  3PMI A;  2P0K A;  4PLL A;  2F5K A;  1OI1 A;  3OYL A;  2R5M A;  2LVM A;  5D6W A;  5KCO A;  3DLM A;  3QJ6 A;  2NLU A;  3LGL A;  4IUV A;  4A4H A;  4BE0 A;  1RI0 A;  2E6N A;  4B9W A;  2L89 A;  2EQM A;  2MWP A;  2R57 A;  3OB9 A;  4CRI A;  4C5E A;  4ZTJ A;  3S6W A;  3DB4 A;  2RHX A;  5IN1 A;  3L2U A;  2RJF A;  4A4G A;  2R5A A;  4QVZ A;  4A4F A;  3OYF A;  3L2W A;  4BE1 A;  4IUP A;  2RHY A;  2JZ2 A;  2EKO A;  1OZ2 A;  1N27 A;  2RI3 A;  3OS2 A;  4E7K A;  4BDY A;  3NTH A;  3DB3 A;  4GY5 A;  2M16 A;  3MP6 A;  4LD6 A;  3OYE A;  3OS1 A;  2GF7 A;  3L2V A;  5C0M A;  2L3R A;  2HQE A;  2EFI A;  3MET A;  4NS5 A;  4BAC A;  3O8V A;  3QKJ A;  3OMG A;  3KUF A;  2DAQ A;  2RJD A;  3EAE A;  3NTI A;  3OYG A;  2RHU A;  4Q5W A;  4EDU A;  4N4G A;  4C5I A;  3L42 A;  3GOX A;  2D9T A;  2X4X A;  3LX7 A;  3UT1 A;  4BD3 A;  4QW2 A;  2BKD N;  3PMT A;  4RG2 A;  4C5G A;  5KE3 A;  3FLG A;  2K3Y A;  2EQK A;  3H6Z A;  3PNW C;  3OY9 A;  3OYJ A;  2BUD A;  3QBY A;  2B8A A;  3QII A;  3MEV A;  3OYN A;  2RHI A;  2LRQ A;  2L8D A;  2G3R A;  4OVA A;  3MP1 A;  3ZEH A;  3F70 A;  2CKK A;  5M9O A;  3ME9 A;  4E7H A;  4E7I A;  4QQD A;  2PQW A;  3E9F A;  3LYI A;  4QQG A;  3OYM A;  3OYI A;  1WGS A;  4N4I A;  3S3O A;  2WAC A;  3MEW A;  2X35 A;  4C5H A;  3P8H A;  3OS0 A;  2X4W A;  2XK0 A;  2EQU A;  3SD4 A;  2QQR A;  5J26 A;  4E7L A;  2O4X B;  1OYX A;  2RO0 A;  4QQ6 A;  3OYK A;  4E7J A;  2RJC A;  2R58 A;  5C6S A;  3MO8 A;  3M9Q A;  3OA6 A;  4II1 A;  2JTF A;  3OYH A;  1MHN A;  4Z02 A;  1OZ3 A;  5FRM A;  2DIG A;  3OYC A;  2BIV A;  5KE2 A;  2MWO A;  5KCH A;  4IUT A;  3LH0 A;  3LLR A;  3MEA A;  4HCZ A;  4IUR A;  3LGF A;  3E9G A;  2QQS A;  2O4X A;  3H8Z A;  2IG0 A;  4L59 A;  2XDP A;  3MP8 A;  4FU6 A;  4B9X A;  3L2Q A;  2X4Y A;  4BDZ A;  2HQX A;  2M0O A;  4N4H A;  1WJS A;  3NTK A;  5CIU A;  3FEO A;  5FRO A;  3OYB A;  1WJQ A;  2K3X A;  3Q1J A;  5IAY A;  4IKF A;  5D6Y A;  2GFA A;  3S3N A;  1H3Z A;  3UWN A;  2RJE A;  3ASK A;  2E5Q A;  2GFU A;  2YRV A;  3C4S A;  3FC3 A;  3OMC A;  2LCC A;  4IUU A;  4IUQ A;  4PL6 A;  2EQJ A;  3OQ5 A;  5KH6 A;  3S3M A;  1XNI A;  3MEU A;  3FDR A;  4X34 A;  2RHZ A;  3BDL A;  1WJR A;  3CEY A;  1G5V A;  3OYA A;  5FRN A;  4A4E A;  2LTO A; 
#chains in the Genus database with same CATH topology
 1JBM A;  1T0H A;  2AHJ B;  1Q7Y C;  4JDS A;  3OYD A;  3JCM V;  5DLQ E;  5ECA A;  5J39 A;  3JCM Q;  1BCO A;  1WZO A;  1SEM A;  5CR2 A;  2EKH A;  2K2M A;  3HSB A;  1PD0 A;  4J6Y A;  1U1S A;  1QP2 A;  2QXF A;  2EGE A;  5IN1 A;  3WVE B;  4A4F A;  1PWT A;  1BI2 A;  4Y92 A;  3DB3 A;  1X27 A;  3BE3 A;  2CUB A;  2EFI A;  2QEX A;  3KBG A;  1YWO A;  3KUF A;  1PCX A;  1OQK A;  1X43 A;  3VYH B;  5LJ5 h;  1J3T A;  3JB9 F;  4QW2 A;  1Y0M A;  1QCN A;  4PJO C;  2MYS A;  1VQO A;  1I5O B;  1PKT A;  4BUG A;  3X24 B;  3AHU A;  1WXB A;  1Q7Y U;  2CZ0 B;  4MDX A;  4M7A E;  4MZP A;  1QW1 A;  3EGD B;  4JZ3 A;  2M51 A;  4HKE A;  3OW2 P;  2O4X B;  4O5V A;  3G71 Q;  4M7A D;  2MMP A;  1OZ3 A;  1SRL A;  1VQ8 Q;  3OW2 S;  1WX6 A;  2BIV A;  3CCU A;  2KYB A;  4XTW A;  3A8G B;  1D1C A;  3EFO A;  2HQX A;  4E6R A;  1I8F A;  3A5Z B;  1FXX A;  1VQ9 Q;  2VKN A;  3RMS A;  3TU4 K;  2LCC A;  4Z88 A;  3RUX A;  2HEQ A;  3OSV A;  4FYV B;  1SPK A;  1WPY A;  4FW2 A;  1ABO A;  1VQL A;  1IGQ A;  3VJP A;  2P4T A;  4F7U A;  1YIJ A;  4F14 A;  2QQB A;  3E1S A;  1AHJ B;  2CSI A;  4PLI A;  3EG2 A;  1I5L A;  1GFC A;  2F5K A;  2R5M A;  1QKX A;  2QQ9 A;  2XI9 A;  2EYW A;  3CPW A;  1B34 B;  1RI0 A;  1VQ5 T;  1M1G A;  5I22 A;  1JRI A;  2EQM A;  3C0C A;  1QLY A;  3WXM B;  3HRU A;  4DOV A;  4E2F B;  1YHQ Q;  3NTH A;  3CC4 A;  3ER0 A;  2V8K A;  4BAC A;  1VQM Q;  3GF5 A;  1YI2 A;  3M0R A;  1YJN T;  3LH5 A;  3CCV A;  3G6E Q;  4LDX A;  3M55 A;  3MKD A;  1Q7Y R;  2CP0 A;  3UDC A;  3VS5 A;  4C8Q A;  5IHI A;  1IZ6 A;  4ZGE B;  4M7A F;  2JNG A;  1Q95 G;  4C0D C;  1HJD A;  2RHI A;  1M27 C;  3CC7 A;  2V1R A;  2J06 A;  5KYY A;  1ABQ A;  4KH1 B;  4M7D A;  2WAC A;  4KBM B;  5KYX B;  1S72 A;  4PNO A;  4ME7 A;  2EGA A;  1MMA A;  4MML A;  2GBQ A;  4QQ6 A;  4C0Z A;  5C6S A;  2A37 A;  4J9H A;  4XTZ A;  3R6N A;  3MEA A;  2I0N A;  3SWN A;  5GAM f;  4B9X A;  3MP8 A;  2EYY A;  1OPK A;  1UGP B;  4C8Q C;  4HXJ A;  1AT1 B;  3HTR A;  2EYQ A;  4M75 A;  2GTJ A;  1MGQ A;  4X9C A;  1IO6 A;  2KEA A;  4HCC A;  2X3X D;  4ORZ A;  3RKW A;  1M1K C;  2YXY A;  1NG2 A;  3BY7 A;  2YUP A;  1X2K A;  4KGZ B;  2VXF A;  3L2Z A;  4UC4 A;  4NL2 A;  1ZUY A;  1S1N A;  1YIT A;  2COY A;  2D0Q B;  2EYX A;  1NBE B;  1NJI C;  1VQN A;  3SWN C;  1VUB A;  1GXI E;  4FM4 B;  4PJO E;  1W2B P;  1YN8 A;  1QQJ A;  2X51 A;  4M78 A;  4M75 C;  1SHG A;  3GBQ A;  1N27 A;  3ZL7 C;  2DJZ A;  4PJO D;  1W2B S;  1E6H A;  1TS9 A;  2HQE A;  4PKC C;  3O8V A;  3QKJ A;  4RTT A;  3NGP A;  4JS5 A;  2ZPB B;  4AFU C;  2YRD A;  1ZSZ B;  1VQ6 Q;  3LX7 A;  3UT1 A;  1Y7X A;  1K8A C;  2VWF A;  1AZG B;  2KNB B;  1YJ9 A;  1M1K U;  1VQP T;  5HY6 A;  2IVW A;  2DO3 A;  4E7H A;  2LQ8 A;  3CC2 T;  3JCM e;  1PD1 A;  2DD5 A;  3OYM A;  5IXB A;  1M90 U;  3EG9 B;  4M78 C;  4K11 A;  2NUZ A;  1NM7 A;  3OYK A;  2R58 A;  1VQK T;  1N6A A;  2FO0 A;  1JO8 A;  4PJO B;  1NJI U;  1ZX6 A;  1QP3 A;  3ULR B;  1HSQ A;  3SFM A;  2FB7 A;  1C1A A;  3X25 B;  3GP8 A;  2DBM A;  3UA7 A;  3LH0 A;  2DD4 A;  4FU6 A;  4XAX B;  5GAM h;  3HP9 A;  1K76 A;  2DER A;  2XD0 A;  3NTK A;  3OYB A;  1WJQ A;  5GJV B;  1VQL T;  1XQH A;  4QKU A;  2JW4 A;  5LJ3 j;  2RMO A;  2OI3 A;  5FU7 C;  1OX9 A;  3EG0 A;  1WHG A;  2K9G A;  4BI8 B;  1M5Q 1;  3I35 A;  2EQJ A;  3FJP A;  4C92 G;  1XNI A;  2H8H A;  3FDR A;  5L8R E;  3QYG B;  2L5Q A;  2GQI A;  1ZHI A;  1K8A U;  2PVG B;  2X9H A;  3P8D A;  2EYZ A;  3GNF B;  5GAO q;  3EFS A;  4PJO F;  1M8M A;  2ZPI B;  3NMZ C;  2CP2 A;  3V7C A;  4J83 A;  3CBM A;  2KRO A;  3EGU A;  4J9D A;  4PFP A;  5D6W A;  3CC4 T;  1D0Y A;  4ZGJ B;  2AKL A;  2K79 A;  5GAN 5;  2E6N A;  4E47 A;  1Q81 C;  1OOT A;  2E12 A;  2FZK B;  1ZLM A;  3L2U A;  2R5A A;  3A8H B;  3M0U A;  3RES A;  1BIA A;  4AFS C;  3OS1 A;  3RIR A;  5C0M A;  1YCS B;  1M1K R;  1C0M A;  4J5Y A;  2GNC A;  2EQI A;  1GCP A;  4LDW A;  2J05 A;  2RHU A;  4N0A A;  3CC7 T;  5KYU B;  4RTW A;  2O31 A;  3I56 Q;  4ELY C;  4JRI A;  5CVI A;  1AOJ A;  3EGD A;  1ZBX A;  1S72 T;  4RTV A;  3CCM Q;  5DM7 R;  1ZUK A;  1NJI R;  1WYX A;  3GLX A;  2LX9 A;  2CKK A;  4JPB W;  4R0K A;  2JXB A;  1BI0 A;  5FWB A;  1PSF A;  1TSF A;  2ZGW A;  4OMF B;  4R56 A;  2PUO B;  3S3O A;  5LJ3 e;  1EZZ B;  4OGC A;  5FU6 C;  1MV0 B;  2XHC A;  2YSQ A;  3MO8 A;  3OA6 A;  2QI2 A;  1ZQ1 A;  3A8O B;  3V7S A;  1UDL A;  4C0D B;  1M9S A;  2MWO A;  1Q81 U;  2DMO A;  1VQ7 T;  2HAX A;  4A54 A;  2DVE A;  4N0A C;  2KXD A;  5GAO r;  2V26 A;  3PVL A;  1K8A R;  2M0O A;  1YJW A;  4B6M A;  2K7A A;  3JCM g;  1WNL A;  1X69 A;  2GFA A;  3UWN A;  5GAN 7;  3EH1 A;  2F2X A;  3PGG A;  2E41 A;  2DZ9 A;  1OU8 A;  4P5N A;  4M75 E;  1I0C A;  4JJB A;  3JCM d;  5IXF A;  3J7A F;  3H0H A;  1YFN A;  3RDV A;  2NUP B;  2LJ3 A;  1B07 A;  2NUT B;  2KVQ G;  3CCL T;  2D8J A;  2F69 A;  2PNI A;  3QXE B;  4GBQ A;  2MWP A;  4OB1 B;  4ANJ A;  2BTT A;  1G3T A;  1XTD A;  3M4G A;  2FPD A;  1LJO A;  2RI3 A;  1KIK A;  4GY5 A;  3MJX A;  2OJ2 A;  4AG1 C;  3CCE Q;  4JRQ A;  2DX1 A;  2DLP A;  4VUB A;  2RF0 A;  5IT9 E;  2JM9 A;  4M78 E;  4ZN1 A;  5GAN j;  1UFF A;  3L42 A;  4XU3 A;  1ACM B;  1XJW B;  2QAZ A;  3E2U A;  3PMT A;  2K3Y A;  2KR3 A;  5KYX A;  2XU8 A;  3KFV A;  1OU9 A;  1YP5 A;  3MP1 A;  2DYI A;  3ZEH A;  4BI3 A;  2YRC A;  1Q81 R;  3JB9 G;  2HL5 C;  4CI0 C;  2RQR A;  2BZ8 A;  5DLO A;  2LJ0 A;  3JCM J;  1VQ4 T;  2QTX A;  2YLB A;  2A7Y A;  1YBY A;  3URG A;  2QQS A;  4LUD A;  3HFN A;  1IHV A;  2XID A;  1M2V B;  5I11 A;  4R55 A;  3QWY A;  1X2Q A;  5FRO A;  5LJ3 g;  1QVG P;  4OMO A;  1AWW A;  2DPP B;  3CCE A;  3I9Q A;  4MZM A;  4PFO A;  1QVF A;  1MMG A;  4ZNX A;  1QVG S;  3LWH A;  3OSS C;  1D1A A;  3M56 A;  3I55 Q;  1IRX A;  2HD0 A;  2JN0 A;  3J81 E;  2CZ1 B;  2L0A A;  4CC2 A;  1KQ2 A;  2VYT A;  2MI6 A;  2QGG A;  1D0Z A;  5LJ3 d;  2RM4 A;  1BBZ A;  4JRK A;  2P0Q A;  5FU7 B;  5GAN e;  3CCQ Q;  1PKS A;  1OI1 A;  4M77 C;  3DLM A;  3VV0 A;  5CQX A;  2AT1 B;  1D1B A;  1H92 A;  3EG3 A;  1M2O A;  4QVZ A;  2F2V A;  3REA B;  2X4J A;  2ZPH B;  1ZSZ A;  1KJW A;  2RQW A;  4XTU A;  1TUD A;  2LQW A;  2LCS A;  1PRM C;  4CC7 A;  1WDX A;  2OTL A;  3OYG A;  1KQS A;  3CCJ T;  2RQV A;  2D9T A;  1ZSG A;  3SEM A;  2H3E B;  1NLP C;  1PNJ A;  2LQK A;  3H6Z A;  3PNW C;  1U1T A;  3QBY A;  1QWE A;  1RLP C;  5GMK m;  1TWB A;  2P0P A;  4QQD A;  1UUE A;  5CCA A;  5GMK l;  1V76 A;  1W4S A;  2YDL A;  4PJM A;  3CC2 Q;  4M7A G;  5IH2 A;  3G4S A;  1PM3 A;  4JJC A;  1CKB A;  2DXT A;  1QVF S;  1YJW T;  2CSQ A;  1VYT A;  1K4U S;  2QA4 A;  1YWP A;  2JTF A;  1VQK Q;  5KYW B;  3CMA Q;  3FIF A;  3CQT A;  3CD6 A;  2FG0 A;  3GPL A;  1X6O A;  3VS2 A;  1BCM A;  3H8Z A;  2IG0 A;  2XDP A;  4J7I A;  8ATC B;  3A1P A;  3M0P A;  1W1F A;  5IAY A;  5FU6 B;  2F5T X;  4OGE A;  1H3Z A;  1T0J A;  2YRV A;  3C4S A;  1Y96 A;  4AT1 B;  4PL6 A;  4BY6 B;  4X34 A;  2DFU A;  2JT4 A;  2HCK A;  1RUW A;  3R6O A;  2RD1 A;  1WFW A;  4DEX A;  1KQS P;  2LT4 A;  1WIE A;  2PVO B;  3REB B;  2D0N A;  4J8O A;  4RKU E;  2LDM A;  1KQS S;  2LT1 A;  2JMA A;  2ECZ A;  2IIM A;  3OYL A;  3M0S A;  3EGX B;  5CAI A;  4EMH A;  2OTJ T;  3ZBD A;  4ZTJ A;  4EMG A;  2FZG B;  2RHY A;  1OZ2 A;  2DYB A;  2J7I A;  3JCM W;  3OYE A;  4M7A B;  1UGS B;  4OP0 A;  4XTY A;  1M30 A;  2L3Q A;  2L3S A;  1TTH B;  5AT1 B;  5GAN g;  2EVR A;  1WXU A;  2MCN A;  1NPR A;  4RG2 A;  4J9C A;  4X9D A;  2DEQ A;  5FLX E;  5GAN 3;  1MND A;  2CUD A;  2JUF A;  3G71 A;  1H8K A;  4C92 A;  2A36 A;  5M9O A;  2DTO A;  4X1V A;  3E19 A;  4AG2 C;  1VQ8 A;  4Y28 E;  2KQW A;  5GAN d;  4E7S A;  2VUB A;  2K5L A;  1B7T A;  1VYU A;  3OS0 A;  2XK0 A;  3SD4 A;  2O9V A;  3A8M B;  4E7L A;  4WF2 A;  2RJC A;  3UF4 A;  4OMP A;  4F16 A;  1JJ2 A;  2K5F A;  1VQ9 A;  1HXD A;  5KE2 A;  5GAN 2;  5LJ5 e;  2MF2 A;  4L59 A;  1VQ7 Q;  1PC0 A;  1I07 A;  1G2B A;  1C6V X;  2DA9 A;  5J3B A;  4IKF A;  4ZGD B;  3A98 A;  3JB9 J;  4RG8 A;  2DIL A;  4M77 E;  3QG1 A;  4D8K A;  3OQ5 A;  3JCM h;  3S3M A;  5IHN A;  3LW5 E;  3CCS T;  4M77 D;  5CKF A;  1KHC A;  3FB9 A;  4L5G A;  1Y71 A;  2FPF A;  1U3O A;  3CPW P;  5D7U A;  3EH2 A;  3CME T;  2FHD A;  1YHQ A;  2RI5 A;  4XU2 A;  1GFD A;  4ESR A;  1OX8 A;  3CPW S;  1VQM A;  1XOV A;  3VU3 C;  3CCL Q;  2MPX C;  5CKD A;  2YUN A;  2KRM A;  2L89 A;  3G6E A;  1U5S A;  3OB9 A;  4PJO G;  1KHI A;  4CRI A;  1V29 B;  3S6W A;  1RAC B;  4M7D C;  4A4G A;  3CBO A;  3X28 B;  3OYF A;  3QPH A;  4E7K A;  2EGC A;  2L3P A;  4J9G A;  3RR6 A;  5HK0 A;  4KH0 B;  5DY9 A;  3MET A;  1M90 C;  4A4K A;  1N9S A;  2AKK A;  3QDF A;  1PRL C;  4M77 B;  4D6W A;  5GAN 4;  2C0I A;  4EMK B;  4C5I A;  2X4X A;  1JJ2 S;  2BKD N;  2QEX T;  1WA7 A;  3DLL A;  3TVT A;  2KAF A;  3G4S T;  2B8A A;  1SHF A;  3D7S B;  3SB2 A;  1WHJ A;  3I5S A;  1VQO T;  2X35 A;  1JQQ A;  2BZX A;  2X4W A;  2ZCF B;  2VV5 A;  4O6J A;  5CQY A;  1SSH A;  1ZA2 B;  4F04 B;  3OYH A;  1VQ4 Q;  3OYC A;  4M77 F;  1E6G A;  2JMC A;  2RK2 A;  1E7O A;  2O01 E;  2M02 A;  2LCL A;  1D3B B;  3L1A A;  4YTL A;  2WSC E;  4J9B A;  3CCU T;  4LNP A;  2KXC A;  2CS7 A;  4JJN K;  4XTX A;  1NZ9 A;  2P4R A;  5CKE A;  3MEU A;  2HNI A;  5GMK j;  3QYH B;  1UGR B;  2KY9 A;  1Z9Z A;  4DA4 A;  1G5V A;  3CXC A;  4RCB A;  5LJ5 g;  2DIQ A;  2QK0 A;  4QVD A;  4XQ3 A;  4GLK A;  2KK4 A;  2NWM A;  4XK8 E;  2K5I A;  5D6X A;  1GL5 A;  2RB6 A;  3CCR Q;  1YIJ T;  1N5Z A;  4OMN A;  5HKC A;  2NLU A;  2DVJ A;  1WI7 A;  2ENM A;  3OYY A;  2R57 A;  2RPN A;  3TSZ A;  5LJ5 d;  1IGU A;  1QKW A;  1VQ6 A;  4FSS A;  4BDY A;  1OPL A;  2EW3 A;  2M16 A;  5GAO n;  3HRS A;  3C94 A;  2K2V A;  2DAQ A;  5GJW B;  3OBW A;  4LD9 K;  1WQ7 A;  4N4G A;  3UPU A;  4F7U E;  3CCJ Q;  1LOJ A;  2JVV A;  3INZ A;  3FLG A;  1YI2 T;  2HKN A;  3OYJ A;  1LCK A;  3CCV T;  4FSX A;  1UHF A;  2KRN A;  1PG5 B;  3M0Q A;  2L8D A;  2QAS A;  1X01 A;  2OAW A;  3ME9 A;  4KGV B;  1D09 B;  4RMO A;  1TOV A;  1RAE B;  4OML A;  2C06 A;  4HVW A;  2K6D A;  5GAO m;  2DJQ A;  2ESW A;  1M90 R;  5GMK e;  2EJ9 A;  2GCX A;  3T9N A;  3CCR A;  2Z0W A;  3M5A A;  5GAO l;  2DTI A;  2RQT A;  3LLR A;  3LGF A;  2A08 A;  2OAU A;  2O4X A;  1A0N B;  2BZY A;  1EIF A;  4A63 B;  4C8Q E;  1W70 A;  3MCA B;  4F7U B;  3CPF A;  4C8Q D;  4IUQ A;  2PTK A;  2ZPF B;  3M58 A;  2KBT A;  3H0F A;  1YHQ T;  4M7D E;  1FWZ A;  3CEY A;  3HPW A;  3EGX A;  2G6F X;  4PFZ A;  4ZTF A;  3G6E T;  2LZ6 B;  4M7D D;  4ATO A;  2D6F A;  1PSE A;  2B86 A;  1GRI A;  2LVM A;  5GAM e;  5KCO A;  1AEY A;  1O75 A;  1YIT T;  4M7A A;  1NE8 A;  2KRS A;  5GAN 6;  1I81 A;  3DB4 A;  2OTJ Q;  3L2W A;  4HVU A;  4F7U F;  3I56 A;  1VQN T;  4C8Q B;  2L3R A;  1B34 A;  3CCM A;  2CYZ B;  3OMG A;  2NYS A;  4M75 D;  5IHK A;  4EDU A;  4M78 G;  3NFC A;  1AWO A;  3QSU A;  5KYY B;  1R0C B;  4M7D B;  2ABL A;  3QZ9 B;  4Z8A A;  1VQ5 Q;  1QCF A;  1JXM A;  2DBK A;  1QVP A;  2LRQ A;  1Y57 A;  2AZS A;  2J6O A;  1BYM A;  5I2M A;  3PIO A;  4FW1 A;  5CKH A;  3VS3 A;  1YJ9 T;  4C5H A;  3PTA A;  5GMK i;  1I4K 1;  2QQR A;  5J26 A;  3SWN B;  1YJN Q;  2RO0 A;  2RA2 A;  2FL7 A;  4C8Q F;  3M9Q A;  2CDT A;  4II1 A;  1R8O B;  1IXD A;  3GNG A;  4M78 D;  4M75 B;  5HCK A;  2QGF B;  1D0X A;  2KGT A;  1H64 1;  1HYO A;  2CGH A;  3RER A;  2LNV A;  2ATC B;  2ZPE B;  3EHQ A;  2KSS A;  4M7D F;  2VXE A;  2RH2 A;  3VS7 A;  1EFN A;  2A3L A;  4PK4 A;  1FMV A;  2J6F A;  1UEC A;  3BDL A;  3UAT A;  2HQH A;  4DEY A;  3CCS Q;  5FRN A;  1N8R C;  1W6X A;  2ROT A;  4QT7 A;  2K57 A;  2LQN A;  3L2R A;  2XMF A;  2MK5 A;  2M1H A;  1UJY A;  2M9U A;  4RTU A;  4M78 B;  1BB9 A;  4M75 F;  1KG1 A;  2KT1 A;  3CME Q;  3LGL A;  4IUV A;  1UTI A;  1M1F A;  1CKA A;  4XU0 A;  1KC8 C;  1FX7 A;  1OEB A;  2RJF A;  2HBP A;  5I21 A;  4OF1 A;  4Z89 A;  3HRT A;  1MV3 A;  2JZ2 A;  3J80 E;  4EMK A;  2EBP A;  2QG9 B;  2VB6 A;  3L2V A;  4PJL A;  4NS5 A;  3WVD B;  3NTI A;  3PVQ A;  3EG1 A;  1T3L A;  1JB0 E;  3H41 A;  1BI3 A;  3EFR A;  2RN8 A;  1O9S A;  4LE9 A;  5GAM g;  3V8J A;  2A28 A;  4QVC A;  1JXO A;  2KE9 A;  3O5Z A;  2PVD B;  3NHN A;  2EQK A;  4V2S A;  2QEX Q;  4HVV A;  3OYN A;  4M78 F;  1AD5 A;  1NYG A;  4MZT A;  2CZ6 B;  2HBW A;  4E7I A;  1N8R U;  3E9F A;  2CH4 A;  1TU0 B;  3OYI A;  3VS0 A;  1WHH A;  2JS0 A;  2V8I A;  3RBB B;  4CC4 B;  4AFQ C;  5GAM d;  4FYY B;  1VQO Q;  2QYZ A;  4LUE A;  1NEB A;  4NL3 A;  3THK A;  2AZV A;  1I1J A;  3C95 A;  2Y4X A;  1AWX A;  3EG9 A;  3OW2 A;  4EPC A;  1KC8 U;  4IUR A;  1BKB A;  2LC4 A;  5FW9 A;  4PJO A;  2DL7 A;  1SRM A;  1VQP Q;  2JTE A;  1QVF P;  3I55 A;  3FEO A;  1M3A A;  1B3Q A;  1LPL A;  2CP6 A;  2EAY A;  2DEU A;  1G3S A;  3ASK A;  5I2S A;  1WQW A;  3CCU Q;  2CH4 W;  3V8L A;  2O88 A;  1IHW A;  1ZSZ C;  1K73 C;  2EWN A;  1MNE A;  2LJ1 A;  2A0F B;  2HKQ B;  2QDY B;  3CCQ A;  2RHZ A;  4J7F A;  1F1B B;  3M59 A;  1KSW A;  2LTO A;  4HA8 A;  8AT1 B;  4D8D A;  2HL3 A;  3FRN A;  1VOM A;  1TXQ A;  3I56 T;  4FIB A;  5GAO p;  3BFM A;  1VQL Q;  5GAN 8;  3V7R A;  3CCM T;  1YIJ Q;  1KFZ A;  3JCM f;  2VC8 A;  4MDW A;  4EIK A;  4C5E A;  1X6B A;  4BE1 A;  4IIM A;  2EKO A;  1GBR A;  4LD6 A;  4C0G A;  4HT9 A;  1M8V A;  5LJ5 j;  2XIC A;  3JB9 H;  2J6K A;  4WTO B;  1N8R R;  3VS4 A;  3JSC A;  3H0I A;  2V8J A;  4J6X A;  1VIF A;  2PU9 B;  4ZN3 A;  1VQP A;  3GOX A;  4OB3 B;  4WCI A;  4BD3 A;  3C12 A;  3CC2 A;  1RLQ C;  2I2L A;  3CC4 Q;  1K73 U;  5KYN A;  1YI2 Q;  2BE9 B;  1VA7 A;  1G3W A;  3CCV Q;  1SF9 A;  3F70 A;  2FVU A;  5KYU A;  1VQK A;  1BI1 A;  3CMA A;  1KC8 R;  4E7Z A;  3QHS A;  4FCY A;  3JRZ A;  2JS2 A;  1UGV A;  2D8H A;  2VGN A;  2XDB A;  1OYX A;  3CC7 Q;  1OV3 A;  2DL8 A;  3KXT A;  2E64 A;  5EC7 A;  1RAF B;  2YUO A;  5FWC A;  1S72 Q;  3PE0 A;  1U06 A;  4BDZ A;  2EJF A;  4DQ2 A;  5LL6 S;  1WJS A;  3Q1J A;  3JCM P;  1NPP A;  3HFO A;  3S3N A;  1QMC A;  1KK7 A;  4RUG A;  4M77 G;  3RNJ A;  1Z9Q A;  5A2Q E;  4BB7 A;  2V1Q A;  4LXC A;  2EIF A;  2E1H A;  2KT8 A;  4PJN A;  3VYG A;  1AVZ C;  2Y90 A;  3CCE T;  4BI4 A;  2WSF E;  4BE2 A;  1SSF A;  2C0T A;  1UHC A;  2E6Z A;  1TG0 A;  4C92 C;  4DBR A;  4B9W A;  2FZC B;  1K9M C;  5LJ3 f;  2E3I A;  2NUP A;  3M4Y A;  4C0F A;  1YIT Q;  2HSP A;  2ROL A;  5A0L A;  4Y91 A;  2E4H A;  2NUT A;  1K73 R;  3GIB A;  3MP6 A;  1VQN Q;  1W2B A;  2P84 A;  4J9F A;  3G7Z A;  1WHM A;  3EAE A;  2YWW A;  2JJ9 A;  1UG1 A;  2PZ1 A;  3N5B B;  2OTL T;  2KDS A;  2DRK A;  4RTZ A;  2G3R A;  2DL4 A;  1GCQ A;  2PQW A;  1R0B G;  3LYI A;  2ZAE A;  4QQG A;  1RAG B;  3M54 A;  1WGS A;  4N4I A;  1JJ2 P;  3MEW A;  1K1Z A;  3P8H A;  1ARK A;  4RTX A;  1VQ7 A;  1YJ9 Q;  2QQA A;  1UE9 A;  2CZ7 B;  4F17 A;  1K0S A;  1PHT A;  4RTY A;  5A0G A;  3I55 T;  3HKS A;  3TEE A;  4XU1 A;  2DXC A;  2ZZD A;  2DNU A;  4DBH A;  4J9E A;  2DL5 A;  1K9M U;  1V1C A;  1HK9 A;  3E9G A;  3V8K A;  2QDL A;  1MMD A;  5CK9 A;  1Y07 A;  2LP5 A;  2QA4 T;  3CCQ T;  5CIU A;  1BK2 A;  3CBP A;  3CD6 T;  1RL2 A;  2COW A;  1DJ7 B;  4IIO A;  2YUQ A;  3TRE A;  3QZ5 B;  7AT1 B;  1GCQ C;  5KH6 A;  5A0D A;  1M2V A;  1K0X A;  4JUV A;  1WJR A;  4M4Z A;  3HHT B;  2E70 A;  2DZC A;  3CCL A;  2LX7 A;  5GMK h;  1YNZ A;  4J6W A;  1M4Z A;  3PFS A;  2DL3 A;  3VUB A;  3PT9 A;  1Q86 C;  1P92 A;  6AT1 B;  1VYV A;  4A4H A;  1OUL A;  2QTV A;  2E65 A;  2IPO B;  1RAI B;  5LJ3 h;  4DBQ A;  4IUP A;  1K9A A;  1UEB A;  4JRP A;  2MOX A;  2GF7 A;  4HT8 A;  1VIE A;  2VVK A;  2EJG A;  5CO7 A;  3JV3 A;  3CMA T;  4JZ4 A;  4F7U G;  1RI9 A;  1WLP B;  3BDU A;  2RQU A;  2ED1 A;  3QII A;  3BW1 A;  1NYF A;  4JJD A;  1VQ4 A;  1K9M R;  3SDZ A;  2VAS A;  2XG8 D;  2EQU A;  3TSW A;  1Q86 U;  1FYN A;  2HDA A;  3G71 T;  4E7J A;  3RKX A;  2GQV A;  4KUD K;  2K4Y A;  1VQ8 T;  1UGQ B;  5GAM j;  1QCO A;  1MHN A;  4DOW A;  3PIP A;  2GGR A;  1FMW A;  3VS6 A;  5GAN f;  4KUL A;  5KCH A;  2ZPG B;  4OB0 B;  2LMJ A;  4TVR A;  1WXT A;  1Y96 B;  2FEI A;  2DXB A;  2RK1 A;  3M57 A;  2FPE A;  4C8Q G;  2DRM A;  1FMK A;  3IQL A;  2CT3 A;  5KYW A;  1VQ9 T;  1NLO C;  2GTO A;  1TH7 A;  3VRZ A;  4L6V 5;  5HK3 A;  3A8L B;  3FC3 A;  1GBQ A;  3CXC P;  1RAH B;  4C92 E;  3EFO B;  2CT4 A;  3QUI A;  3QO3 A;  1JU5 C;  1JEG A;  1MUZ A;  1YJW Q;  2JM8 A;  5AYF A;  2HZY A;  4J9I A;  3U23 A;  3CXC S;  4M7D G;  4A4E A;  2ED0 A;  4C92 D;  4FL6 A;  1IRE B;  3X26 B;  3MHX A;  4MMK A;  1UB4 A;  2F1L A;  2C0O A;  3PMI A;  2P0K A;  4KRT A;  3QJ6 A;  4BE0 A;  3X20 B;  1KD1 C;  4JLG A;  3QJY A;  3JAM E;  4OB2 B;  3FJ5 A;  3OS2 A;  2DE0 X;  3CCJ A;  1Q82 C;  1SG5 A;  2K3B A;  4M75 G;  1VQM T;  2W0Z A;  4AFZ C;  4FYX B;  1BIB A;  4KUI A;  2E3H A;  2MIO A;  1G8X A;  2JTM A;  4C92 B;  1ZBJ A;  4BY6 C;  4C5G A;  5KE3 A;  1Q86 R;  2LNH B;  2BUD A;  1TUG B;  2SEM A;  3NPF A;  3MEV A;  1WHL A;  4OVA A;  4XTV A;  1TUC A;  1X75 C;  2DKG A;  2DET A;  1LVK A;  4LDY A;  4KT0 E;  1M3C A;  3M53 A;  3ZFJ A;  2VGM A;  2FRY A;  4FYW B;  3VS1 A;  1M3B A;  4KGX B;  2DK3 A;  1ZA1 B;  2JOY A;  3VKI A;  2E10 A;  3OS5 A;  2FRW A;  3EHR A;  4Z02 A;  5FRM A;  4A53 A;  3JCM b;  1KD1 U;  2DTH A;  3RMQ A;  4CC3 A;  4IUT A;  5GAN h;  3TCJ A;  2HMA A;  1H3H A;  4C92 F;  4PJJ A;  2X4Y A;  1Q82 U;  4HCK A;  1KQ1 A;  4N4H A;  2M0Y A;  1QWF A;  2H3J A;  4M7A C;  2MAM A;  2E5K A;  1ZUU A;  4HCB A;  2E5Q A;  3OMC A;  3P8B B;  2COZ A;  4ELZ C;  2O2O A;  2OX7 A;  4GLM A;  3LWI A;  2DF6 A;  1N9R A;  2DXU A;  1QVG A;  1EX4 A;  2RNA A;  3OYA A;  2AIR B;  2CP5 A;  4OMM A;  3M0T A;  4NOY A;  1RAD B;  4JLI A;  4OMQ A;  2OTJ A;  1G83 A;  2KI7 A;  2RI2 A;  4PLL A;  1T3S A;  2W10 A;  3OBY A;  2RHX A;  5CKB A;  2CRE A;  4DBF A;  1HD3 A;  4LDV A;  4FT4 A;  2YHT A;  4JS4 A;  2YLC A;  1U8R A;  1AZE A;  3RKY A;  1WHK A;  1VQ5 A;  2BE7 D;  3HL8 A;  3JCM c;  3QDR B;  2RJD A;  1VQ6 T;  4Q5W A;  5LJ5 f;  2O9S A;  4LDU A;  3JB9 I;  1YCY A;  1LNX A;  3UA6 A;  3OY9 A;  3JCM X;  1NEG A;  1YJN A;  1G3Y A;  3SHW A;  1AWJ A;  4M77 A;  2OTL Q;  2YT6 A;  2X3W D;  2F2W A;  3DKM A;  1BU1 A;  3G1J A;  3TQ7 P;  4AMC A;  1KD1 R;  5EG2 A;  3H9N A;  1CSK A;  2CP3 A;  2CP7 A;  2FYK A;  3QWX X;  1Q82 R;  2KMT A;  4LN2 A;  1X6G A;  3MPU B;  3JB9 D;  1MMN A;  2PUK B;  2DIG A;  2KYM A;  2SRC A;  9ATC B;  4FT2 A;  2D1X A;  4HCZ A;  2XKO C;  1IB8 A;  4RCC A;  5L23 A;  3I5R A;  3G4S Q;  1UJ0 A;  3L2Q A;  3VRY A;  2XDD A;  3VUZ A;  3CCR T;  2QA4 Q;  2K3X A;  3CCS A;  2EPD A;  5D6Y A;  1RAB B;  2RJE A;  2Y4Y A;  3CD6 Q;  2GFU A;  4IUU A;  2L2P A;  2HSE B;  4EMK C;  1RAA B;  2WSE E;  3AT1 B;  1D3B A;  1R77 A;  2DM1 A;  2AK5 A;  1SKU B;  3CME A; 
#chains in the Genus database with same CATH homology
 4RCB A;  3JCM d;  3J7A F;  5LJ5 g;  1JBM A;  2DIQ A;  3CCE T;  1Q7Y C;  2AHJ B;  4QVD A;  4XQ3 A;  4GLK A;  4JDS A;  4BI4 A;  3OYD A;  3JCM V;  2WSF E;  5DLQ E;  4BE2 A;  2KK4 A;  1SSF A;  4XK8 E;  5D6X A;  2K5I A;  5J39 A;  2RB6 A;  3JCM Q;  5CR2 A;  1YIJ T;  2KVQ G;  3HSB A;  3CCL T;  2F69 A;  2E6Z A;  3QXE B;  5HKC A;  2NLU A;  4C92 C;  4J6Y A;  1U1S A;  3OYY A;  1QP2 A;  4B9W A;  2MWP A;  2R57 A;  4OB1 B;  1K9M C;  5LJ3 f;  5LJ5 d;  1G3T A;  2QXF A;  3M4Y A;  4C0F A;  5IN1 A;  1XTD A;  3M4G A;  3WVE B;  4A4F A;  5A0L A;  1VQ6 A;  4Y91 A;  1LJO A;  2RI3 A;  1BI2 A;  4BDY A;  3GIB A;  3DB3 A;  4GY5 A;  2M16 A;  3MP6 A;  5GAO n;  3HRS A;  1W2B A;  2EFI A;  3C94 A;  2QEX A;  2K2V A;  3KBG A;  3G7Z A;  4JRQ A;  3KUF A;  2DAQ A;  3EAE A;  4VUB A;  3OBW A;  4LD9 K;  1WQ7 A;  5IT9 E;  3VYH B;  4M78 E;  4ZN1 A;  5GAN j;  4N4G A;  5LJ5 h;  3UPU A;  3L42 A;  4XU3 A;  4F7U E;  3JB9 F;  4QW2 A;  1LOJ A;  2JVV A;  3INZ A;  3PMT A;  3N5B B;  4PJO C;  3FLG A;  1YI2 T;  2K3Y A;  3OYJ A;  2OTL T;  2KDS A;  3CCV T;  1VQO A;  2XU8 A;  4FSX A;  2L8D A;  2G3R A;  3MP1 A;  3ZEH A;  4BI3 A;  3X24 B;  1X01 A;  4BUG A;  3AHU A;  3ME9 A;  2PQW A;  4RMO A;  3LYI A;  4QQG A;  1Q7Y U;  3JB9 G;  2CZ0 B;  4MDX A;  3M54 A;  4M7A E;  1WGS A;  4MZP A;  4N4I A;  1QW1 A;  3MEW A;  4CI0 C;  2C06 A;  3P8H A;  4HKE A;  1VQ7 A;  2QQA A;  5DLO A;  2O4X B;  2CZ7 B;  4O5V A;  3JCM J;  5GAO m;  5GMK e;  5A0G A;  2EJ9 A;  2GCX A;  3I55 T;  3HKS A;  1VQ4 T;  3TEE A;  4M7A D;  2QTX A;  2MMP A;  2YLB A;  4XU1 A;  3T9N A;  2A7Y A;  1OZ3 A;  3CCR A;  2DXC A;  2ZZD A;  3M5A A;  5GAO l;  2DTI A;  3OW2 S;  2BIV A;  3CCU A;  1K9M U;  3LLR A;  1YBY A;  3URG A;  3LGF A;  1HK9 A;  2OAU A;  2QQS A;  3E9G A;  3V8K A;  5CK9 A;  2O4X A;  4XTW A;  3HFN A;  1Y07 A;  3A8G B;  1EIF A;  2QA4 T;  2HQX A;  4C8Q E;  3CCQ T;  2XID A;  4R55 A;  5CIU A;  3CBP A;  5FRO A;  3MCA B;  1I8F A;  3A5Z B;  1FXX A;  3CD6 T;  1RL2 A;  5LJ3 g;  1DJ7 B;  4F7U B;  3CPF A;  2DPP B;  3RMS A;  3TU4 K;  4C8Q D;  3TRE A;  2LCC A;  4IUQ A;  3CCE A;  3QZ5 B;  4MZM A;  3RUX A;  2ZPF B;  1QVF A;  3M58 A;  3OSV A;  5KH6 A;  5A0D A;  1QVG S;  3LWH A;  3OSS C;  3M56 A;  1YHQ T;  1WPY A;  4JUV A;  4M7D E;  1WJR A;  2HD0 A;  1FWZ A;  2JN0 A;  3CEY A;  3HHT B;  1VQL A;  2E70 A;  2CZ1 B;  3J81 E;  2DZC A;  2P4T A;  3VJP A;  4F7U A;  2VYT A;  3HPW A;  2MI6 A;  1YIJ A;  3CCL A;  1KQ2 A;  2QQB A;  5GMK h;  4ZTF A;  3E1S A;  5LJ3 d;  1AHJ B;  2RM4 A;  4J6W A;  3G6E T;  1M4Z A;  4JRK A;  3PFS A;  4M7D D;  4PLI A;  3VUB A;  3PT9 A;  4ATO A;  1Q86 C;  2P0Q A;  5FU7 B;  2D6F A;  1PSE A;  1P92 A;  5GAN e;  1I5L A;  2F5K A;  1OI1 A;  2R5M A;  4M77 C;  2LVM A;  2XI9 A;  2QQ9 A;  5GAM e;  3DLM A;  5KCO A;  3VV0 A;  5CQX A;  3CPW A;  4A4H A;  1B34 B;  1O75 A;  1RI0 A;  1YIT T;  1NE8 A;  1VQ5 T;  1M1G A;  5GAN 6;  4M7A A;  1JRI A;  2EQM A;  2E65 A;  1I81 A;  3WXM B;  3DB4 A;  5LJ3 h;  3HRU A;  4QVZ A;  3L2W A;  4IUP A;  4DOV A;  1UEB A;  4F7U F;  2X4J A;  3I56 A;  2ZPH B;  4JRP A;  1VQN T;  4XTU A;  4C8Q B;  3NTH A;  3CC4 A;  2GF7 A;  4HT8 A;  2L3R A;  1B34 A;  1VIE A;  3ER0 A;  3CCM A;  2V8K A;  4BAC A;  3GF5 A;  2CYZ B;  1YI2 A;  1YJN T;  3OMG A;  2OTL A;  3CCV A;  4M75 D;  2EJG A;  3OYG A;  1KQS A;  4LDX A;  3M55 A;  4EDU A;  3CCJ T;  4M78 G;  3NFC A;  3UDC A;  5CO7 A;  4C8Q A;  2D9T A;  3CMA T;  3QSU A;  4F7U G;  1IZ6 A;  4ZGE B;  4M7A F;  2JNG A;  4M7D B;  2LQK A;  3H6Z A;  3PNW C;  3QZ9 B;  1U1T A;  3QBY A;  3BDU A;  3QII A;  4C0D C;  1QVP A;  2LRQ A;  2RHI A;  5GMK m;  3BW1 A;  2P0P A;  3CC7 A;  4QQD A;  1VQ4 A;  1BYM A;  5CCA A;  5GMK l;  1W4S A;  5I2M A;  3SDZ A;  4M7D A;  3PIO A;  5CKH A;  2WAC A;  4M7A G;  4KBM B;  1YJ9 T;  4C5H A;  2XG8 D;  4PNO A;  3PTA A;  1S72 A;  3G4S A;  5GMK i;  4ME7 A;  2EQU A;  1I4K 1;  1Q86 U;  2QQR A;  4MML A;  5J26 A;  3SWN B;  3G71 T;  4KUD K;  2DXT A;  2RO0 A;  4QQ6 A;  2RA2 A;  3RKX A;  2GQV A;  2FL7 A;  4C0Z A;  5C6S A;  4E7J A;  4C8Q F;  1YJW T;  3M9Q A;  2K4Y A;  1VQ8 T;  2QA4 A;  4II1 A;  2JTF A;  1UGQ B;  5GAM j;  1R8O B;  1MHN A;  4DOW A;  3PIP A;  3GNG A;  3FIF A;  5GAN f;  3CD6 A;  4KUL A;  4M78 D;  4XTZ A;  4M75 B;  5KCH A;  1X6O A;  2ZPG B;  3GPL A;  3MEA A;  4OB0 B;  4TVR A;  3SWN A;  1Y96 B;  5GAM f;  3H8Z A;  2IG0 A;  4B9X A;  2XDP A;  3MP8 A;  2DXB A;  2RK1 A;  3M57 A;  1UGP B;  4J7I A;  1H64 1;  4C8Q C;  2CGH A;  3RER A;  2LNV A;  2ZPE B;  4C8Q G;  2KSS A;  1QVF S;  2VXE A;  4M7D F;  1VQ9 T;  5IAY A;  2RH2 A;  5FU6 B;  1TH7 A;  2A3L A;  2F5T X;  4OGE A;  1H3Z A;  4L6V 5;  2EYQ A;  4M75 A;  5HK3 A;  3A8L B;  2YRV A;  3C4S A;  1MGQ A;  3FC3 A;  1Y96 A;  4X9C A;  4PL6 A;  4BY6 B;  4C92 E;  4HCC A;  3QUI A;  4X34 A;  3QO3 A;  3BDL A;  3RKW A;  5AYF A;  1M1K C;  3R6O A;  2RD1 A;  3BY7 A;  3CXC S;  4M7D G;  5FRN A;  4A4E A;  1N8R C;  2LT4 A;  4C92 D;  2VXF A;  2K57 A;  3L2Z A;  3L2R A;  4UC4 A;  4FL6 A;  1IRE B;  2PVO B;  4NL2 A;  3X26 B;  3MHX A;  4J8O A;  1YIT A;  4MMK A;  1UB4 A;  2M1H A;  4RKU E;  2LDM A;  1KQS S;  2D0Q B;  2LT1 A;  2M9U A;  4M78 B;  3PMI A;  2P0K A;  4M75 F;  1KG1 A;  1NJI C;  3OYL A;  1VQN A;  3SWN C;  1VUB A;  3QJ6 A;  1GXI E;  3LGL A;  4IUV A;  4FM4 B;  5CAI A;  4BE0 A;  4EMH A;  3X20 B;  1M1F A;  1KD1 C;  4PJO E;  4JLG A;  4XU0 A;  1KC8 C;  2OTJ T;  3ZBD A;  4ZTJ A;  1FX7 A;  4EMG A;  3QJY A;  2RJF A;  5I21 A;  2HBP A;  4OF1 A;  4M78 A;  3JAM E;  4OB2 B;  3HRT A;  4M75 C;  2JZ2 A;  2RHY A;  3OS2 A;  1OZ2 A;  1N27 A;  3J80 E;  4EMK A;  3CCJ A;  1Q82 C;  4M75 G;  2DJZ A;  3JCM W;  1VQM T;  1W2B S;  4PJO D;  3L2V A;  3OYE A;  2HQE A;  4NS5 A;  4M7A B;  1BIB A;  1UGS B;  4OP0 A;  4PKC C;  3O8V A;  3QKJ A;  4KUI A;  4XTY A;  3WVD B;  3NTI A;  5GAN g;  4JS5 A;  2ZPB B;  2JTM A;  1JB0 E;  4C92 B;  1BI3 A;  3EFR A;  1NPR A;  5GAM g;  1O9S A;  3LX7 A;  3UT1 A;  3V8J A;  1Y7X A;  4QVC A;  4RG2 A;  4BY6 C;  4C5G A;  4X9D A;  5KE3 A;  1K8A C;  2PVD B;  2EQK A;  2DEQ A;  4V2S A;  5FLX E;  2BUD A;  1YJ9 A;  3MEV A;  3OYN A;  4M78 F;  5GAN 3;  4OVA A;  4XTV A;  1M1K U;  2JUF A;  1VQP T;  3G71 A;  5HY6 A;  1X75 C;  2IVW A;  4MZT A;  4C92 A;  2DO3 A;  2CZ6 B;  2DKG A;  2DTO A;  5M9O A;  4E7H A;  4E7I A;  3E19 A;  1N8R U;  1VQ8 A;  2LQ8 A;  3E9F A;  3CC2 T;  4Y28 E;  2KQW A;  2DD5 A;  4LDY A;  3JCM e;  5GAN d;  3OYM A;  3OYI A;  4KT0 E;  3M53 A;  1M90 U;  2VUB A;  2V8I A;  2K5L A;  3ZFJ A;  2VGM A;  5GAM d;  3OS0 A;  2XK0 A;  3SD4 A;  4M78 C;  3A8M B;  4E7L A;  4WF2 A;  3OYK A;  2RJC A;  2R58 A;  2DK3 A;  2JOY A;  1N6A A;  1VQK T;  4NL3 A;  4PJO B;  1NJI U;  3VKI A;  1QP3 A;  3C95 A;  2E10 A;  3OS5 A;  1JJ2 A;  2Y4X A;  4Z02 A;  5FRM A;  3SFM A;  2K5F A;  4A53 A;  1YHQ A;  2FB7 A;  1VQ9 A;  1HXD A;  3JCM b;  5KE2 A;  1KD1 U;  3X25 B;  2DTH A;  3RMQ A;  5GAN h;  4IUT A;  3LH0 A;  2DD4 A;  3TCJ A;  4EPC A;  3GP8 A;  4IUR A;  5GAN 2;  1KC8 U;  5LJ5 e;  1BKB A;  2MF2 A;  4L59 A;  4FU6 A;  4XAX B;  2LC4 A;  4C92 F;  5GAM h;  2X4Y A;  1Q82 U;  4PJO A;  3HP9 A;  1KQ1 A;  4N4H A;  2XD0 A;  3I55 A;  2H3J A;  3NTK A;  3FEO A;  3OYB A;  5J3B A;  1WJQ A;  4M7A C;  2MAM A;  1VQL T;  4IKF A;  2EAY A;  4ZGD B;  1G3S A;  1XQH A;  4RG8 A;  3JB9 J;  5LJ3 j;  3ASK A;  5FU7 C;  4HCB A;  5I2S A;  2E5Q A;  1WQW A;  4M77 E;  3OMC A;  3P8B B;  4ELZ C;  3V8L A;  3LWI A;  4BI8 B;  1M5Q 1;  3QG1 A;  2EQJ A;  2EWN A;  3FJP A;  3OQ5 A;  3JCM h;  4C92 G;  1XNI A;  3S3M A;  1K73 C;  3LW5 E;  2QDY B;  3FDR A;  3CCQ A;  2RHZ A;  3QYG B;  4J7F A;  2L5Q A;  1N9R A;  2DXU A;  5L8R E;  3CCS T;  3OW2 A;  1QVG A;  3M59 A;  1ZHI A;  4M77 D;  5CKF A;  1K8A U;  2PVG B;  3OYA A;  2LTO A;  4HA8 A;  1KHC A;  3P8D A;  3FB9 A;  3GNF B;  4L5G A;  5GAO q;  3EFS A;  4PJO F;  4NOY A;  1Y71 A;  2ZPI B;  3FRN A;  4JLI A;  2OTJ A;  2RI2 A;  3CME T;  2FHD A;  3V7C A;  2RI5 A;  4PLL A;  4J83 A;  4FIB A;  4XU2 A;  3CBM A;  5GAO p;  3I56 T;  3BFM A;  5D6W A;  5GAN 8;  3V7R A;  4ZGJ B;  3CPW S;  3CC4 T;  3CCM T;  1VQM A;  5GAN 5;  1XOV A;  3JCM f;  3VU3 C;  2VC8 A;  5CKD A;  2E6N A;  4MDW A;  3OBY A;  2L89 A;  4E47 A;  3G6E A;  4CRI A;  3OB9 A;  4PJO G;  1KHI A;  1Q81 C;  4C5E A;  2E12 A;  1V29 B;  3S6W A;  2RHX A;  5CKB A;  3L2U A;  4M7D C;  4A4G A;  2R5A A;  3A8H B;  3CBO A;  3X28 B;  3OYF A;  4BE1 A;  3QPH A;  4LDV A;  2EKO A;  4FT4 A;  4E7K A;  2YHT A;  4JS4 A;  2YLC A;  3RES A;  1U8R A;  5HK0 A;  1BIA A;  4LD6 A;  4C0G A;  4HT9 A;  1M8V A;  5LJ5 j;  3OS1 A;  2XIC A;  3RIR A;  5C0M A;  1M90 C;  5DY9 A;  3MET A;  4A4K A;  3JB9 H;  3RKY A;  1N9S A;  1VQ5 A;  3HL8 A;  3JCM c;  3QDR B;  4J5Y A;  2RJD A;  3JSC A;  4LDW A;  4M77 B;  2RHU A;  4J6X A;  2V8J A;  4Q5W A;  4D6W A;  5LJ5 f;  4N0A A;  1VIF A;  1VQ6 T;  5GAN 4;  2PU9 B;  4ZN3 A;  1VQP A;  3CC7 T;  4EMK B;  4C5I A;  3GOX A;  2X4X A;  4OB3 B;  4LDU A;  4BD3 A;  3JB9 I;  1YCY A;  1JJ2 S;  3C12 A;  4JRI A;  4ELY C;  2BKD N;  5CVI A;  2QEX T;  3CC2 A;  3DLL A;  2I2L A;  1LNX A;  2KAF A;  1S72 T;  1ZBX A;  3OY9 A;  3JCM X;  3G4S T;  1K73 U;  5DM7 R;  2B8A A;  1YJN A;  1G3Y A;  4M77 A;  1G3W A;  3DKM A;  3GLX A;  2LX9 A;  3F70 A;  2FVU A;  2CKK A;  3SB2 A;  1VQK A;  5EG2 A;  1BI0 A;  1BI1 A;  3CMA A;  1PSF A;  2ZGW A;  4OMF B;  4R56 A;  2PUO B;  3S3O A;  5LJ3 e;  1VQO T;  2X35 A;  3QHS A;  3JRZ A;  2FYK A;  4OGC A;  2KMT A;  2X4W A;  2ZCF B;  2VV5 A;  5FU6 C;  2VGN A;  4O6J A;  2XDB A;  1OYX A;  5CQY A;  3JB9 D;  2XHC A;  3MO8 A;  3OA6 A;  2PUK B;  2QI2 A;  3OYH A;  1ZQ1 A;  3A8O B;  3V7S A;  4C0D B;  2DIG A;  1M9S A;  3OYC A;  3KXT A;  2E64 A;  2MWO A;  1Q81 U;  1VQ7 T;  4FT2 A;  4HCZ A;  4M77 F;  2XKO C;  4RCC A;  4A54 A;  2HAX A;  2DVE A;  4N0A C;  2RK2 A;  3L2Q A;  4BDZ A;  5GAO r;  2XDD A;  2EJF A;  2O01 E;  2M0O A;  5LL6 S;  3VUZ A;  4DQ2 A;  1YJW A;  2LCL A;  1D3B B;  3L1A A;  3JCM g;  1WJS A;  3CCR T;  4YTL A;  2WSC E;  2K3X A;  3Q1J A;  1WNL A;  3CCS A;  3JCM P;  1NPP A;  3HFO A;  5D6Y A;  3CCU T;  2GFA A;  3S3N A;  3UWN A;  2CS7 A;  2RJE A;  4JJN K;  2Y4Y A;  2GFU A;  4XTX A;  4IUU A;  4M77 G;  1NZ9 A;  5GAN 7;  4EMK C;  2WSE E;  5CKE A;  3MEU A;  2HNI A;  2E41 A;  3PGG A;  5GMK j;  1D3B A;  3QYH B;  1UGR B;  4BB7 A;  5A2Q E;  2KY9 A;  2DZ9 A;  2EIF A;  2E1H A;  4P5N A;  3VYG A;  3CME A;  4DA4 A;  1G5V A;  4M75 E;  3CXC A;  2Y90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...