2FHDA

Crystal structure of crb2 tandem tudor domains
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
150
structure length
150
Chain Sequence
b'HMSRRSFKNRVLAFFKGYPSFYYPATLVAPVHSAVTSSIMYKVQFDDATMSTVNSNQIKRFFLKKGDVVQSTRLGKIKHTVVKTFRSTNEQLSLIAVDALNNDMVILAHGEIEVTVPISTIYVAPVNIRRFQGRDLSFSTLKDMKFEETS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein rhp9/CRB2
publication title Structural basis for the methylation state-specific recognition of histone H4-K20 by 53BP1 and Crb2 in DNA repair.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
total genus 29
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18115 Tudor_3 DNA repair protein Crb2 Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fhdA01
2.30.30.810 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fhdA02
2R58A 3H6ZA 2L89A 2DIGA 2LVMA 4N4GA 1WJSA 3O8VA 3S6WA 4QVZA 3DB3A 3ME9A 3OYKA 3OYIA 3E9FA 2QQRA 4E7HA 4OVAA 5FRNA 2F5KA 3OYLA 3OS0A 5CIUA 1WGSA 2MWOA 2RHXA 2X4XA 2PQWA 3LLRA 5FROA 4C5IA 3OYNA 5C0MA 3ZEHA 3MEWA 3L2QA 4BE0A 3CEYA 3EAEA 3LYIA 3MP6A 1H3ZA 3OYMA 5IAYA 1OZ3A 2E5QA 2XK0A 2O4XA 4BACA 1RI0A 4C5GA 1OYXA 2B8AA 2FHDA 2YRVA 3OMGA 3QJ6A 4IURA 2RHUA 2M1HA 4EDUA 3OYEA 3PFSA 3Q1JA 4FL6A 2LRQA 2GF7A 4N4IA 3OYGA 1OZ2A 3OYJA 3PNWC 3MP1A 3QBYA 2GFUA 3L2RA 2K3XA 2D9TA 5IN1A 2RHYA 3LGLA 2EQMA 3QIIA 3QKJA 3META 5J26A 2EQKA 3DB4A 3FDRA 4IUVA 4E7IA 4ZTJA 4B9WA 2BUDA 2RJFA 3OQ5A 3LGFA 4L59A 3OYBA 3M9QA 3OMCA 4E7JA 3MEUA 5KCOA 2JZ2A 2RI2A 5M9OA 2X4YA 4IUTA 3OYDA 4PLLA 4A4GA 2X35A 3GOXA 4Q5WA 3NTKA 3MEVA 4UC4A 5KE2A 1KHCA 2QQSA 5KCHA 2LCCA 2LDMA 3E9GA 3FEOA 3BDLA 1SSFA 3OYAA 2L8DA 3ASKA 4E7KA 3PMIA 4BDYA 2RI3A 1WJQA 2X4WA 3FC3A 2DIQA 3OS2A 3MO8A 3KUFA 4NS5A 2CKKA 1N27A 2K3YA 3P8DA 4FU6A 3S3MA 2RJEA 1OI1A 2R57A 4QQ6A 5KH6A 3OYHA 2R5MA 2EFIA 4IUQA 4E7LA 4RG2A 3FLGA 5D6XA 2M16A 4HCZA 4PL6A 4BE1A 2M0OA 2VYTA 1MHNA 2RHZA 4X34A 4BE2A 2P0KA 2XDPA 2GFAA 3UWNA 3LX7A 4LD6A 4A4HA 4B9XA 3OA6A 3SD4A 4BDZA 1WJRA 3L2WA 2RO0A 2IG0A 4C5HA 4C5EA 2NLUA 2L3RA 3S3OA 2EKOA 3H8ZA 4A4FA 3C4SA 2RHIA 4II1A 5D6YA 4GY5A 3MP8A 2LTOA 2O4XB 2RI5A 3DLMA 3NTHA 5FRMA 3L2UA 4ZTFA 3PMTA 2RJDA 3MEAA 2E6NA 3OB9A 2RJCA 4QW2A 3OY9A 3L2VA 2BIVA 4QQDA 2EQJA 2EQUA 3UT1A 3NTIA 3P8HA 4IUPA 5C6SA 4BD3A 4CRIA 3S3NA 4QQGA 5J39A 5KE3A 2HQXA 2MWPA 2DAQA 3LH0A 3OYFA 4Z02A 3OYCA 4A4EA 4IKFA 4N4HA 2WACA 2JTFA 4IUUA 3OS1A 3F70A 3L42A 2HQEA 2G3RA 1XNIA 4PLIA 1G5VA 2BKDN 2R5AA 5D6WA
chains in the Genus database with same CATH superfamily
4M75G 1WHMA 4E7HA 4C5IA 2CP7A 4E2FB 1OZ3A 4ESRA 1VYTA 3EGUA 1M9SA 3CCMT 3OMGA 5LJ3d 3AT1B 5EC7A 4DOWA 1PC0A 3KBGA 4L5GA 3A5ZB 2Y90A 4JLGA 2E3HA 4FL6A 2EJFA 1W2BA 2H3EB 1PNJA 2DM1A 3ZFJA 4OP0A 3RIRA 3LGFA 3SWNB 3M55A 3FJ5A 3V8LA 3WXMB 2CUDA 3SB2A 1CKAA 5GANe 2NUTA 3HKSA 4DBQA 1B7TA 3G71A 1TTHB 4PJOA 3VS6A 2KY9A 1OU9A 4V2SA 4CC3A 5A0DA 3OYAA 2KR3A 3ASKA 4JPBW 3JCMJ 2EJ9A 2KXCA 4LNPA 2YUOA 5GJVB 2CH4W 2E6ZA 4M7DE 3JCMX 2NUPB 5IXFA 1X27A 3I55A 1B34B 2QGFB 3JB9H 3UF4A 2XDDA 1G83A 2O01E 4FIBA 4B9XA 2DD4A 1WJRA 3CMET 4O6JA 1Y96A 3TU4K 2D8HA 3H8ZA 1W1FA 4DOVA 3G4SA 3JCMd 1KD1U 5KYUB 2AHJB 3L2UA 4M78F 4JRKA 5KYWA 3CCVA 1WQWA 5LJ3g 3HSBA 1CKBA 2DX1A 4M77C 4QQGA 1VQKQ 3FIFA 1UHCA 1K8AU 3I9QA 3OYCA 4JS5A 2OAUA 4IUUA 4JZ4A 3VV0A 2DL5A 4DBFA 3CMAQ 1D1BA 2HBPA 2D6FA 2ZPHB 4RTUA 9ATCB 3ME9A 2E1HA 2LP5A 4HT8A 2MWOA 1ABQA 1Q7YU 3OYNA 5C0MA 2KE9A 1SPKA 3OS5A 1X2KA 1YCYA 1TUCA 1VQ9Q 2OTJT 1IHVA 3PE0A 1UECA 2D0NA 2LRQA 1M1KR 1JXMA 2KDSA 5GAOm 1Q86C 3LGLA 2BZ8A 1PG5B 5GAN3 4M77F 4M75E 3DKMA 2K5FA 2L2PA 4M78A 2X4YA 4IUTA 3PIPA 1UUEA 1Q95G 1XTDA 4J6YA 3BDLA 5DLQE 3NFCA 4LDVA 1Y7XA 2IPOB 2DXUA 1UDLA 2JUFA 2X4WA 4M7AB 1FXXA 4BY6B 3S3MA 2MF2A 1OI1A 4F7UG 3I35A 1X6GA 3GIBA 5LJ3h 3EG0A 3CMEA 4BI4A 2C0OA 2F2VA 3SD4A 1IRXA 1EZZB 2LCSA 4MDXA 1EFNA 3U23A 4EMKA 1AEYA 2DEQA 2LC4A 1QW1A 4AG1C 3TVTA 1XJWB 3LWHA 1VQ8T 2CT4A 1M90U 4ELZC 2PU9B 3EFOA 4J9EA 4J9GA 4A4EA 1JU5C 4M77A 4M7DC 1YHQT 1UE9A 3RMQA 3C94A 1EX4A 1HSQA 1LPLA 2GGRA 2VV5A 1OX9A 3HFNA 5GMKm 2LVMA 3CD6T 2E4HA 3JB9J 5DY9A 4JRIA 5FRNA 6AT1B 2GQVA 1OEBA 3LH5A 2K5LA 3MP6A 4M7AD 1ZSZB 2FPFA 3M0PA 3V8KA 1KSWA 3G6ET 2X3XD 2J05A 1VQ5T 1CSKA 1M2OA 2CP3A 2J6OA 5CKDA 1YNZA 2A37A 2RK2A 2CZ1B 2HSPA 5KYXA 1UG1A 3QO3A 4F7UB 3OYJA 5HKCA 4F14A 3META 4E7IA 5GJWB 4OF1A 4PJNA 4M7DF 5M9OA 3SWNC 4TVRA 5KE2A 5I11A 5CK9A 4IIOA 5IHKA 2LJ1A 1N27A 3JCMV 4ZGEB 3HRTA 1SRLA 2FO0A 2R5MA 4OMOA 4C0DB 1M8MA 2AK5A 4BE2A 3OW2S 1BKBA 1ZBXA 4C8QG 3L2ZA 3M4GA 1RADB 3HHTB 2IG0A 2PNIA 2KYBA 3E2UA 1G3TA 5FW9A 2NLUA 2L3RA 3URGA 1PRMC 1K9MR 3C4SA 1VQ8A 4M75C 1M5Q1 2VASA 2P0QA 1S1NA 3DLMA 3V7SA 3CCVQ 5LJ5d 2JT4A 2E6NA 3ULRB 4JDSA 4LUEA 3M58A 1YHQA 3M57A 1IXDA 4OB0B 2IIMA 3EGXA 1RAFB 1QWEA 1RAIB 1WX6A 2CP6A 2QQ9A 3T9NA 1M8VA 2HQEA 3TREA 1YCSB 1IB8A 1S72Q 3QG1A 4M7DA 1BU1A 3E9FA 2H8HA 2E70A 3RMSA 2CZ0B 1WA7A 1YFNA 1WGSA 2JS0A 3VS7A 3G6EA 2LQ8A 4QVCA 1VOMA 1VQ5A 5GAMj 1NPPA 1GBRA 2X9HA 2XMFA 4BI3A 3M0QA 4HVWA 1UHFA 3HL8A 2HEQA 1B3QA 2QXFA 4M75F 5KYWB 3FB9A 5GAN5 2FRWA 1AOJA 4XU3A 4MDWA 5LJ3f 2D9TA 1WDXA 4MZMA 2P0PA 1ZSGA 2K79A 1HJDA 2A7YA 2YRCA 5GAMe 3OYDA 1M90R 2X35A 4C92G 1W2BP 2W10A 1BI1A 4XTYA 3L1AA 2EKHA 3VS4A 2C06A 1IO6A 2LDMA 1M1GA 3E9GA 2ATCB 4NOYA 1WNLA 5LJ5g 4ORZA 3INZA 3MO8A 2L0AA 4KH0B 2LX9A 2CP5A 3SDZA 4A63B 2M02A 4PL6A 4BE1A 2M0OA 2VYTA 3QDRB 2L3QA 1MMAA 2K7AA 1QWFA 2EAYA 2PUKB 2DEUA 1KHIA 1SSHA 1AWXA 4M75A 1C6VX 3MJXA 5FRMA 4ZTFA 1U1TA 2NUZA 1QVGA 1VQNQ 2QQBA 2DO3A 2BIVA 4EMHA 1R77A 1WIEA 3ER0A 4P5NA 4JRPA 1JRIA 4FSSA 3UA7A 3EG3A 3L42A 2OTLT 2SEMA 2X3WD 2FPEA 4FYWB 4PJLA 2KI7A 2L89A 3MKDA 3CCJT 4C8QE 1H92A 3CCSQ 2MMPA 5D7UA 2PVGB 2FZGB 4XQ3A 2EGAA 2DXTA 3VUBA 2DFUA 5A2QE 1FMWA 2KNBB 1PSFA 2O4XA 1OYXA 1ZSZC 4XTVA 4RUGA 1FWZA 4Z89A 2WSCE 4LUDA 5HK0A 3OYEA 2M9UA 3CPFA 4J9BA 5LJ5h 1WHHA 3H0IA 1X2QA 3OYGA 3CCLT 1GRIA 3CC7T 2GFUA 4MMKA 3QHSA 5IN1A 5GAN4 3FDRA 1VQPT 3X20B 1VA7A 4M78D 3MEUA 2QEXQ 1FX7A 1NLOC 1K9AA 4C0GA 2EW3A 3A8OB 2A08A 1TWBA 2QQSA 4KH1B 3CCQQ 1KD1C 3EG1A 2DTHA 1SSFA 1LCKA 3CCUT 2YWWA 2CH4A 2GQIA 2YHTA 4NS5A 2CT3A 4FU6A 3BW1A 4AFSC 4D8DA 4E47A 3FLGA 1Q82R 1YIJT 5KYXB 1MGQA 1Y07A 1NEBA 2P0KA 1Z9QA 1GBQA 1NPRA 4MZPA 4LN2A 3EG9B 1Q81R 1RAGB 4GY5A 3VS3A 4C92E 4OB2B 4FYVB 3RR6A 3A8HB 2QA4A 2EBPA 3NHNA 1NBEB 2OTLA 1K9MC 4B6MA 4BD3A 4CRIA 4HA8A 1VQ4T 1WXTA 1M4ZA 3VYHB 1BK2A 4Z02A 2JTFA 1M1KU 3PT9A 1JBMA 1PKTA 4IUQA 1VYUA 1YJWT 2DJQA 1WHGA 2ED0A 1VQ6T 4K11A 2ZPFB 1AVZC 1LJOA 3JV3A 4QKUA 3RDVA 5IAYA 1YBYA 2E64A 1VQLT 2Y4XA 1ZA1B 4X9DA 4RTTA 2ABLA 3CCLA 4PJJA 2KAFA 3CC7A 1V1CA 4JJCA 2JN0A 3HFOA 1VQPA 1QQJA 3EGXB 1YJNQ 2EQKA 1OPLA 3D7SB 3V7CA 3A1PA 1V76A 2QTXA 2FYKA 4CC7A 5GANj 3AHUA 4C8QC 4AG2C 1QLYA 2ROTA 4FW2A 4F04B 1I81A 3CCUA 5FU6C 3V7RA 2EWNA 2QDYB 2A3LA 4E7KA 3EFSA 1M90C 3M4YA 1YIJA 2X51A 2V26A 2HKNA 4E7LA 2ZPEB 2EYXA 3M0SA 2D8JA 2JXBA 3RUXA 2VVKA 1AZGB 2COZA 2AT1B 3X28B 2HDAA 2EVRA 4C5EA 2F69A 3S3OA 2V8IA 5GMKh 3HRSA 4KULA 2DL8A 1BCMA 1VQ4A 2LT4A 3MEAA 2MI6A 4C0ZA 4C8QF 2D1XA 3UT1A 1WHLA 3P8HA 3CC4Q 1PRLC 1KC8R 5J39A 2GTOA 4CC4B 4IKFA 4ATOA 1YJWA 1HYOA 4PLIA 2G6FX 2BKDN 1E7OA 1G3YA 1F1BB 1QVFA 4OVAA 3CC2T 5FU7C 5FROA 1VQLA 5GAN2 1KG1A 3C12A 1R0CB 3CEYA 1K0XA 1H3ZA 1WFWA 2E5QA 4A53A 4M7AG 1M2VB 1SHGA 2LQWA 4C92C 4C5GA 4O5VA 1WYXA 2W0ZA 3X24B 1TSFA 1YI2T 3Q1JA 1VQMQ 3CXCP 3PNWC 1K73R 1MUZA 3V8JA 4RCBA 2K57A 1D0ZA 4ZTJA 4XU0A 1VQ7T 3CCMA 4AFQC 3OMCA 1OX8A 4E7JA 2QAZA 1TXQA 2KYMA 3RESA 1ZQ1A 3QXEB 1K9MU 4C8QA 2HSEB 1U8RA 1KIKA 2JM9A 1ARKA 2L8DA 2RNAA 4BDYA 5HY6A 2LJ3A 4FM4B 1I5LA 3EHQA 3QYGB 1YJ9Q 3JCMc 2R57A 4ME7A 4C92F 5GAN8 2YT6A 2GNCA 3EHRA 2GFAA 2L3SA 2RQUA 2KSSA 1PKSA 1LVKA 2HL5C 3JCMg 4A4FA 4AFUC 1BIAA 5AYFA 1Q82C 3THKA 2QA4Q 5LJ3e 5L23A 5CKBA 3DLLA 1T0JA 3JB9I 1JJ2A 2LNVA 3VKIA 5I2SA 1TS9A 2YXYA 3EGDA 3C95A 3CCEQ 1VIFA 1Q81C 3HTRA 1W2BS 2EPDA 2LX7A 3JB9F 2ZGWA 1ZHIA 2LJ0A 1K1ZA 3CCRT 2RB6A 1NEGA 3CC2A 1QVGP 1WI7A 2FRYA 1JEGA 1UGSB 2LT1A 4XTXA 2DZ9A 1I4K1 3CPWA 2VGMA 2LNHB 3OYIA 2F5KA 3I56T 2C0IA 3VYGA 2XIDA 1W70A 2XK0A 2RMOA 1N9SA 4AFZC 1YI2A 4RMOA 2B8AA 2DILA 2YRVA 1OPKA 1VQOT 4C92A 1BI2A 5I22A 4FYYB 1N5ZA 2XD0A 2DL4A 2M1HA 3CBOA 5J3BA 4DBRA 4GLKA 4KGVB 3JCMW 1VQ7A 2O9SA 3H0HA 2XDBA 2K3XA 1LNXA 4OMNA 4RKUE 3UATA 3A8LB 2NWMA 2FPDA 3EFRA 3TSZA 2OTJA 1D0XA 1PD1A 3EH1A 3VJPA 2J06A 2JS2A 4Q5WA 2QYZA 1AD5A 3JCMh 2MIOA 2DMOA 3JRZA 4J9DA 5CQYA 1YIJQ 3MCAB 4OMMA 5GAMd 5IHIA 2ZAEA 3OYHA 1X69A 4J6XA 5IHNA 1YN8A 3J80E 1QP2A 3WVEB 2MK5A 4HXJA 3G71Q 3EH2A 4C5HA 2RQRA 2HCKA 1U3OA 2XI9A 2JM8A 3TCJA 2LTOA 4OMLA 4AMCA 1XQHA 2MYSA 2YLBA 2YLCA 2FG0A 2OX7A 4FSXA 3I55Q 1WHKA 2DL3A 3OBWA 4FYXB 1V29B 2VUBA 4IUPA 4RTWA 3CCRA 1QVPA 4KBMB 2K5IA 2MCNA 1AWOA 1XNIA 3G4SQ 3I56A 4ELYC 1OV3A 2JOYA 1KC8C 1WJSA 3DB3A 5I2MA 3GP8A 4DEYA 1NE8A 2M51A 2NUTB 2DZCA 3LW5E 4PJOB 1VQOA 3EAEA 1NJIU 4XU2A 2A36A 1ZUYA 1YWPA 1FMKA 2E12A 2KRSA 4F7UE 3CD6A 1VYVA 4FT4A 4KGZB 4HVVA 2GF7A 4JZ3A 2ZPIB 3A8GB 2LCLA 3MP1A 3QKJA 1N9RA 3CCMQ 1Q82U 2QTVA 2KK4A 4PNOA 1PCXA 2BUDA 3OYBA 1Y96B 2CP2A 3TSWA 5KCOA 2NYSA 2ECZA 5A0LA 1K73C 1PM3A 1HXDA 4WCIA 1Q81U 2HL3A 3PVQA 2XHCA 2DETA 2YRDA 1KQSS 2RK1A 2KRMA 3JAME 1UGVA 4A54A 2A28A 1ZUUA 2M16A 1I1JA 2HMAA 1M1KC 2VB6A 4PJOD 1W4SA 3QZ9B 4MMLA 1IREB 1AT1B 2K2MA 3SWNA 1GXIE 1VQKT 2RN8A 4LE9A 2HBWA 3M0UA 4HCCA 2YDLA 4JJNK 2DPPB 2RQTA 3OSSC 1BI3A 3UPUA 3J7AF 1PWTA 2RQVA 3CMAT 4M7AC 3CMEQ 4BY6C 1YWOA 1ZX6A 2F2XA 3HRUA 4FW1A 2HQXA 1SHFA 1ABOA 2NUPA 4J9HA 2E3IA 1M3BA 1OULA 1B34A 2PUOB 1U5SA 1UTIA 3M56A 1VQ9T 4M78B 2K9GA 2OJ2A 4R56A 3PIOA 2V8JA 5FLXE 1GCQC 2BE9B 1KQ2A 3JCMf 1RI0A 4KT0E 3JCMP 2CGHA 1QVFP 3QYHB 2KVQG 1G2BA 4C0FA 1ZLMA 4EMGA 3G7ZA 1VQ7Q 4N4IA 3PGGA 1GCPA 1SRMA 3TQ7P 4J8OA 3QIIA 1PSEA 5J26A 1KJWA 2FVUA 2OTJQ 4RG8A 3OQ5A 4LDYA 1M30A 2Y4YA 2EGEA 2PVDB 3P8BB 4Y28E 2CZ6B 4C8QD 5KYYA 4EMKB 4PLLA 3E1SA 4A4GA 2DXCA 3MEVA 3VS5A 1M1FA 2M0YA 1NG2A 2ZZDA 1N8RR 3EFOB 4XK8E 1KC8U 4M77B 2EYWA 1GFCA 1MHNA 2RHZA 1VQKA 3N5BB 3LX7A 4A4HA 4VUBA 1NJIR 3PTAA 2DTIA 2AKKA 1DJ7B 3CXCS 3FRNA 3CMAA 2XG8D 1UJYA 3NMZC 4XAXB 2RI5A 3NTHA 5GANd 3A98A 2EYYA 3MHXA 2RJCA 3L2VA 3OY9A 2DE0X 2H3JA 5C6SA 3M53A 1HK9A 3EG2A 1G3WA 4C0DC 2HZYA 3OS1A 1OOTA 2L3PA 1VQ9A 1K73U 1VQ8Q 1AZEA 5CO7A 2MPXC 4E7SA 5D6WA 1JJ2P 1NZ9A 1OQKA 4QVZA 3BY7A 4F7UF 4LDUA 4MZTA 2EYZA 1QMCA 4YTLA 3G1JA 1WZOA 1YHQQ 2BTTA 3LYIA 3OYMA 2QK0A 4ZGDB 2VXFA 4C92D 5HK3A 4M77D 1K0SA 3H9NA 3CD6Q 3BFMA 4HKEA 3CPWP 3CCJA 3GNGA 4DQ2A 4EDUA 1LOJA 2CZ7B 1MMNA 2SRCA 1J3TA 1IGUA 3G6EQ 3H0FA 1VQ5Q 4L59A 2ENMA 3I5RA 1TH7A 3QUIA 2A0FB 3PVLA 3JB9D 5KCHA 2DLPA 3HP9A 1ZSZA 3GBQA 4L6V5 4A4KA 3UA6A 3VRZA 2HD0A 1R0BG 5GANg 4OGEA 1UGPB 4NL3A 1WJQA 1AWJA 2RM4A 2Z0WA 5CKEA 2F1LA 2JJ9A 1A0NB 4F7UA 4M7DB 5GMKj 2BZXA 1C1AA 1WXBA 4X34A 4RTVA 2XDPA 1NM7A 1Y71A 1G8XA 1QCOA 2E41A 4J7FA 1Z9ZA 2CP0A 2RHIA 4II1A 4GLMA 2QQAA 3I5SA 4LD9K 4J9FA 4DA4A 3VRYA 1UJ0A 4X1VA 1I8FA 2RJDA 3OB9A 1S72T 4KUDK 4XTZA 1XOVA 1TUDA 2GTJA 2P4RA 2QASA 3NTIA 4ZNXA 2J6FA 5LL6S 4QVDA 2YUNA 2EGCA 3LH0A 2BE7D 5GMKe 4N4HA 3F70A 3A8MB 3RKWA 5KYNA 4Z8AA 3CBMA 4PK4A 2XKOC 3REBB 1D0YA 1UGQB 2JTMA 3S6WA 5GAOq 3WVDB 3OYLA 2X4XA 2PQWA 4IIMA 4M78C 4BE0A 2EIFA 2DF6A 1QKXA 1ZUKA 1UFFA 1X6OA 2RH2A 2RA2A 3GNFB 5LJ5f 3QJ6A 4IURA 4M7DD 5A0GA 4EPCA 3OYYA 1PD0A 1WLPB 2KMTA 4JLIA 5GANh 1VQ6A 2I0NA 2DERA 1IHWA 2DKGA 2RHYA 4X9CA 4IUVA 4B9WA 4F16A 4J6WA 4RTXA 3M9QA 2CDTA 1IGQA 5CCAA 3NTKA 4M75B 2J6KA 2VC8A 1KHCA 2K3BA 4EMKC 2LCCA 4HCBA 2DBKA 5CR2A 3SFMA 4KRTA 4JJBA 1WQ7A 3JCMb 4ZGJB 3FC3A 1Y0MA 4WTOB 1JB0E 4RG2A 5HCKA 4BB7A 1U06A 1U1SA 2DNUA 2OI3A 2WSFE 5GAOl 3M5AA 2MAMA 2COYA 1N8RC 1VQNT 1IZ6A 2LQKA 5CAIA 1BI0A 1KQ1A 5LJ3j 5CKFA 1S72A 5D6YA 4BUGA 3VS1A 1X6BA 1D3BA 1D09B 5KYYB 2O4XB 4ANJA 1E6GA 1NJIC 4D8KA 5FWCA 3R6NA 4KUIA 4QQDA 2EQJA 1RABB 3CCST 4XTWA 1RLQC 1EIFA 1O75A 2FZKB 1YITT 2E5KA 2G3RA 3QWXX 3H6ZA 4M75D 2DIGA 3E19A 4XU1A 2QI2A 3X26B 1SF9A 3OW2A 2RF0A 4XTUA 2HNIA 4J83A 3OS0A 2YUQA 1TG0A 2LQNA 2FEIA 2OTLQ 5GAOp 1JO8A 3JSCA 3ZL7C 2DJZA 4BACA 3CCJQ 4RTZA 1WXUA 4DEXA 1I5OB 3NGPA 4R0KA 1Y57A 2QEXT 5CKHA 1GL5A 1ACMB 3QBYA 2XICA 2V1QA 3CCQT 3RNJA 3OBYA 4HCKA 5GMKl 2RJFA 1C0MA 4DBHA 3LWIA 1T0HA 2RI2A 1KK7A 2DA9A 3CCLQ 1QCNA 3CC7Q 1TU0B 4J5YA 1VQPQ 1MMGA 3IQLA 1BBZA 4RTYA 2K3YA 4QQ6A 2KBTA 1VQNA 1MNEA 3QZ5B 2EYQA 4JS4A 2KGTA 4CC2A 1RAAB 3JCMe 1KQSA 1QVFS 1H641 2V1RA 3CCUQ 2KQWA 5GAN7 1BB9A 3M54A 4PJOG 4NL2A 4FT2A 3RBBB 4M7AE 1MV3A 2ESWA 5ECAA 3CCSA 1I0CA 3PMTA 4J9CA 2K4YA 2DK3A 3QPHA 1YITA 1M3AA 3M0TA 2DAQA 5GANf 3NPFA 2VWFA 2WSEE 2CYZB 4JJDA 2R58A 4PJMA 4JUVA 1FYNA 2VKNA 3QWYA 1VQ4Q 5FWBA 5DM7R 2QQRA 1T3LA 5CIUA 2CSQA 1GFDA 5DLOA 1KD1R 2AIRB 3EG9A 1NYGA 4OB1B 1HD3A 2PZ1A 3VS0A 1NLPC 2DXBA 1K76A 2QEXA 1YJNT 1BCOA 1YJWQ 3J81E 3C0CA 3JCMQ 3FJPA 1VQ6Q 1RAEB 1K8AR 1N8RU 3VUZA 1M3CA 3CCQA 4R55A 1SG5A 4HVUA 1MMDA 1VQLQ 2EQMA 4ZN1A 5GAOr 3BE3A 1Q7YR 2JZ2A 1R8OB 2AZVA 5AT1B 2OAWA 1JJ2S 2JVVA 2CSIA 2V8KA 4OMFB 5GMKi 2LZ6B 2HQHA 2QDLA 3MPUB 3PMIA 5GAMg 1AWWA 2DBMA 2DRKA 3H41A 3KXTA 2RJEA 4ZN3A 1BIBA 4J9IA 2KEAA 1Q86U 5CVIA 2CS7A 2J7IA 4HCZA 4M78G 3CPWS 5IT9E 1RL2A 4LD6A 3QDFA 1UGRB 3ZBDA 3CC4T 1MNDA 1H3HA 3MP8A 2DRMA 2KT1A 2P4TA 2E10A 3CXCA 1SKUB 4RCCA 2X4JA 4GBQA 3GLXA 1H8KA 5KE3A 1VUBA 2JTEA 3QSUA 1UB4A 4E7ZA 5L8RE 2R5AA 8AT1B 2GCXA 1K4US 3SEMA 3OSVA 4PJOE 3O8VA 2L5QA 3LLRA 2QG9B 1YJNA 4C8QB 4KGXB 1VQMT 4LXCA 4OGCA 2DL7A 2FB7A 1X43A 5FU6B 1D3BB 2FHDA 4M77G 3QJYA 3CC2Q 3RKYA 2O2OA 3PFSA 3M59A 5GAMh 2RD1A 1OZ2A 2JNGA 3L2RA 2MOXA 1QP3A 3DB4A 1T3SA 2LMJA 3VU3C 1RACB 1RI9A 5LJ5j 1YI2Q 5KYUA 2DYIA 1YJ9T 2EJGA 2I2LA 1N6AA 2CUBA 1B07A 3JB9G 3FEOA 3GPLA 1AHJB 2COWA 1D1CA 1M2VA 2O31A 3EGDB 4Z88A 4N0AC 2RI3A 2RQWA 3OS2A 1TUGB 3P8DA 4M7AF 7AT1B 2RPNA 3VS2A 2DD5A 2ED1A 4LDXA 1P92A 5D6XA 2QA4T 4PFZA 1UEBA 2FL7A 3CC4A 3R6OA 2K6DA 3SHWA 5LJ5e 3RERA 2JW4A 3L2WA 2KRNA 1OU8A 3CCET 2E65A 2PTKA 3TEEA 2PVOB 2KT8A 3UDCA 4PKCC 5FU7B 4BI8B 3X25B 3HPWA 3M0RA 1TOVA 1KFZA 1X01A 4M4ZA 1YITQ 2JMAA 4C92B 4E6RA 2EQUA 3S3NA 1W6XA 3OYFA 2QGGA 2ZPGB 1PHTA 4CI0C 2AZSA 2O9VA 1SEMA 5IXBA 3BDUA 4M78E 1G5VA 2YUPA 2GBQA 4N4GA 1VQMA 4EIKA 3OYKA 2VGNA 2O88A 2RHXA 4Y92A 4FCYA 3ZEHA 2B86A 3MEWA 3L2QA 3CCRQ 1MV0B 2FZCB 5GAN6 4M7AA 1Q86R 4JRQA 2RHUA 3OW2P 3I56Q 4OMQA 4M7DG 4AT1B 1O9SA 2DTOA 4HT9A 1FMVA 2D0QB 1VQOQ 1YJ9A 4Y91A 1VIEA 1K8AC 1QCFA 1WPYA 4PJOC 2DVJA 2DYBA 1GCQA 1RLPC 3GOXA 3RKXA 3O5ZA 2ROLA 4UC4A 5GAOn 1RUWA 3CQTA 2ZPBB 3REAB 1JXOA 1ZBJA 2VXEA 2AKLA 2K2VA 1BYMA 4M77E 1NYFA 1Q7YC 3G71T 2DIQA 3KUFA 2CKKA 4N0AA 2JMCA 5KH6A 2F5TX 2EFIA 2CREA 1G3SA 3CCEA 4LDWA 4WF2A 2HKQB 3UWNA 3OA6A 4BDZA 2EQIA 4PFOA 1JQQA 3I55T 5IH2A 2HAXA 1QVGS 2RO0A 2ZCFB 2YSQA 1ZA2B 5I21A 2EKOA 4OB3B 4OMPA 4QT7A 1RAHB 4F17A 2KXDA 1KQSP 4J7IA 8ATCB 1WHJA 4QW2A 2XU8A 2P84A 3G4ST 3GF5A 4PFPA 3CBPA 1E6HA 4D6WA 4PJOF 2BZYA 2IVWA 5EG2A 1D1AA 1YP5A 2KROA 2C0TA 2MWPA 3CCVT 1M27C 2F2WA 1X75C 5CQXA 5GAMf 1I07A 2WACA 2DVEA 3KFVA 1QKWA
chains in the Genus database with same CATH topology
4ELYC 3H6ZA 2L89A 2JOYA 4M75D 4C8QE 2DIGA 3CCJT 3E19A 1KC8C 1WJSA 2MMPA 4M75G 2PVGB 3DB3A 2QI2A 4XU1A 5I2MA 3X26B 4XQ3A 3GP8A 1NE8A 4XTUA 2HNIA 3OW2A 4J83A 3OS0A 2DZCA 2DXTA 3LW5E 4C5IA 4PJOB 1VQOA 3EAEA 3VUBA 1NJIU 4XU2A 3JSCA 5GAOp 5A2QE 1OZ3A 2DJZA 1PSFA 2O4XA 4BACA 1OYXA 4XTVA 1M9SA 3CCMT 2E12A 3OMGA 5LJ3d 4DOWA 1FWZA 4F7UE 2WSCE 3CD6A 3KBGA 4L5GA 4FT4A 3A5ZB 5HK0A 2Y90A 3OYEA 2M9UA 3CPFA 4JLGA 4FL6A 5LJ5h 2QEXT 2GF7A 2EJFA 5CKHA 1W2BA 3OYGA 3CCLT 2ZPIB 3A8GB 2LCLA 3MP1A 3QBYA 3CC7T 2GFUA 4MMKA 2XICA 3QHSA 5IN1A 3QKJA 1N9RA 5GAN4 1Q82U 3ZFJA 3CCQT 4OP0A 3FDRA 3OBYA 2KK4A 4PNOA 1VQPT 3X20B 5GMKl 4M78D 2BUDA 3RIRA 2RJFA 3LGFA 3SWNB 3M55A 3OYBA 1Y96B 3LWIA 3MEUA 5KCOA 2RI2A 3V8LA 3WXMB 1FX7A 3SB2A 5GANe 5A0LA 3HKSA 1K73C 4C0GA 3A8OB 1HXDA 1Q81U 3G71A 4PJOA 2QQSA 2KY9A 2XHCA 1KD1C 4J5YA 2DTHA 1SSFA 3OYAA 5A0DA 4V2SA 3ASKA 3JCMJ 2EJ9A 3CCUT 1KQSS 2RK1A 2YHTA 3JAME 4NS5A 2E6ZA 4M7DE 2K3YA 4FU6A 3BW1A 4A54A 4QQ6A 3JCMX 1VQNA 3QZ5B 2EYQA 4JS4A 4E47A 3I55A 3FLGA 1B34B 2M16A 3JCMe 1KQSA 1YIJT 1MGQA 1Y07A 1H641 1M1KC 1QVFS 3JB9H 2XDDA 2KQWA 5GAN7 4PJOD 2P0KA 2O01E 4FIBA 1W4SA 3QZ9B 3M54A 4PJOG 4B9XA 2DD4A 1WJRA 4MMLA 4NL2A 1IREB 4FT2A 3CMET 3SWNA 1GXIE 4O6JA 1Y96A 1NPRA 3TU4K 4M7AE 4MZPA 3H8ZA 1VQKT 4DOVA 3G4SA 4GY5A 4C92E 3JCMd 4HCCA 4OB2B 4JJNK 1KD1U 2DPPB 2AHJB 3OSSC 1BI3A 3CCSA 3UPUA 3L2UA 3A8HB 4M78F 4JRKA 2QA4A 3J7AF 3PMTA 2K4YA 3CCVA 3CMAT 4M7AC 2DK3A 3QPHA 1WQWA 4BY6C 2OTLA 1YITA 1K9MC 3HRUA 4BD3A 4HA8A 4M77C 4QQGA 4CRIA 5LJ3g 1VQ4T 3HSBA 3FIFA 2HQXA 2DAQA 1M4ZA 3VYHB 1K8AU 5GANf 4Z02A 3OYCA 4JS5A 2OAUA 2WSEE 2JTFA 1M1KU 3PT9A 4IUUA 3VV0A 1JBMA 1B34A 2PUOB 2CYZB 4IUQA 3M56A 2R58A 2HBPA 4JUVA 2D6FA 2ZPHB 1VQ9T 1YJWT 3ME9A 5DM7R 2QQRA 4M78B 2E1HA 4R56A 5CIUA 4HT8A 2MWOA 1VQ6T 1Q7YU 5DLOA 2ZPFB 3OYNA 1LJOA 5C0MA 3PIOA 2V8JA 4OB1B 5FLXE 5IAYA 1KQ2A 3OS5A 3JCMf 1RI0A 4KT0E 3JCMP 1YBYA 2DXBA 2E64A 2CGHA 1VQLT 1YCYA 2Y4XA 2QEXA 1YJNT 4X9DA 3CCLA 2KAFA 2OTJT 3J81E 3CC7A 3JCMQ 3FJPA 3QYHB 2KVQG 4C0FA 4EMGA 1N8RU 3G7ZA 3VUZA 2JN0A 3CCQA 2LRQA 4N4IA 3HFOA 2KDSA 3PGGA 4R55A 1VQPA 5GAOm 1Q86C 4J8OA 3LGLA 2EQMA 3QIIA 4ZN1A 1PSEA 2EQKA 5J26A 5GAOr 5GAN3 3V7CA 2FVUA 4M77F 4RG8A 3OQ5A 4LDYA 1JJ2A 2QTXA 2FYKA 2Y4YA 4M75E 2PVDB 3P8BB 3DKMA 2K5FA 5GANj 4Y28E 3AHUA 2JZ2A 2CZ6B 4C8QD 4M78A 4C8QC 4EMKB 2X4YA 4IUTA 4PLLA 1R8OB 3E1SA 4A4GA 3PIPA 1I81A 3CCUA 2DXCA 3MEVA 1JJ2S 2JVVA 1XTDA 5FU6C 3V7RA 4J6YA 2V8KA 4OMFB 3BDLA 1M1FA 5DLQE 3NFCA 5GMKi 4LDVA 2EWNA 1Y7XA 2QDYB 2A3LA 2DXUA 4E7KA 3PMIA 5GAMg 2JUFA 2ZZDA 3EFSA 2X4WA 4M7AB 3KXTA 1M90C 1FXXA 3M4YA 4XK8E 4BY6B 3S3MA 1YIJA 2MF2A 2RJEA 1OI1A 1KC8U 4ZN3A 1BIBA 4M77B 4F7UG 1Q86U 5CVIA 4E7LA 2CS7A 2ZPEB 3GIBA 5LJ3h 3CMEA 4HCZA 4M78G 4BI4A 3G71T 1MHNA 2RHZA 3RUXA 3CPWS 5IT9E 1VQKA 3N5BB 1RL2A 3LX7A 4LD6A 4VUBA 4A4HA 3SD4A 2DTIA 3PTAA 1UGRB 3ZBDA 3X28B 1DJ7B 4C5EA 3CC4T 3CXCS 2F69A 3S3OA 4MDXA 2V8IA 4EMKA 3FRNA 5GMKh 3CMAA 2DEQA 2XG8D 3MP8A 3HRSA 4KULA 4XAXB 2LC4A 2RI5A 1QW1A 3NTHA 2P4TA 1VQ4A 2LT4A 5GANd 3LWHA 2E10A 1VQ8T 3MEAA 2MI6A 3MHXA 2RJCA 4C0ZA 3OY9A 3L2VA 3CXCA 1M90U 4ELZC 4C8QF 2H3JA 4RCCA 3UT1A 3P8HA 5C6SA 2X4JA 3M53A 1HK9A 2PU9B 5J39A 3GLXA 5KE3A 1VUBA 1G3WA 4C0DC 4A4EA 4IKFA 4ATOA 4M77A 3QSUA 4M7DC 1YHQT 3OS1A 3RMQA 1YJWA 3C94A 1VQ9A 1K73U 1UB4A 2VV5A 4PLIA 5CO7A 5L8RE 2BKDN 2R5AA 3HFNA 5D6WA 2GCXA 1G3YA 5GMKm 1NZ9A 2LVMA 3OSVA 3JB9J 1QVFA 3CD6T 3O8VA 5DY9A 4QVZA 4F7UF 3BY7A 4JRIA 2L5QA 4LDUA 4MZTA 4OVAA 3CC2T 4YTLA 2GQVA 5FRNA 3LLRA 5FU7C 5FROA 1VQLA 5GAN2 1YJNA 4C8QB 1KG1A 3C12A 1VQMT 2K5LA 3CEYA 3MP6A 3LYIA 4M7AD 1H3ZA 4OGCA 3OYMA 3V8KA 2FB7A 2E5QA 2VXFA 4A53A 4ZGDB 4M7AG 4C92D 4C92C 5HK3A 4M77D 4C5GA 5FU6B 1D3BB 2FHDA 3BFMA 4M77G 3G6ET 4HKEA 1VQ5T 4O5VA 3QJYA 3CCJA 3GNGA 5CKDA 3X24B 3RKYA 4DQ2A 4EDUA 1YI2T 3PFSA 2RK2A 2CZ1B 3M59A 3Q1JA 5GAMh 1LOJA 2CZ7B 2RD1A 3QO3A 1OZ2A 2JNGA 4F7UB 3OYJA 3PNWC 5HKCA 3L2RA 3V8JA 4RCBA 1QP3A 3META 2K57A 3DB4A 4E7IA 4ZTJA 4XU0A 3VU3C 1VQ7T 3CCMA 4L59A 3OMCA 3QUIA 1TH7A 4OF1A 4E7JA 5LJ5j 4M7DF 3RESA 5M9OA 1ZQ1A 3SWNC 1YJ9T 2EJGA 2I2LA 3QXEB 1K9MU 4TVRA 4C8QA 5KE2A 1N6AA 3JB9D 5KCHA 3HP9A 3JB9G 4L6V5 3FEOA 4A4KA 3GPLA 1AHJB 1U8RA 2HD0A 2L8DA 5CK9A 5GANg 4OGEA 4N0AC 1UGPB 2RI3A 4BDYA 5HY6A 4NL3A 1WJQA 4FM4B 2RM4A 3OS2A 1I5LA 1N27A 3QYGB 3P8DA 5CKEA 3JCMV 3JCMc 2R57A 4ZGEB 3HRTA 4M7AF 4PJOE 2DD5A 2R5MA 4ME7A 4C0DB 4C92F 4LDXA 1P92A 5D6XA 4F7UA 5GAN8 2QA4T 4M7DB 1UEBA 5GMKj 2FL7A 3CC4A 4X34A 4BE2A 3R6OA 3OW2S 5LJ5e 2XDPA 1BKBA 1ZBXA 2GFAA 1Y71A 3L2ZA 4C8QG 3RERA 3M4GA 3L2WA 2E41A 3HHTB 4J7FA 2IG0A 2KSSA 3CCET 1G3TA 2NLUA 2E65A 2L3RA 3TEEA 3JCMg 3URGA 2PVOB 1BIAA 3C4SA 4A4FA 3UDCA 2RHIA 4II1A 4M75C 4PKCC 2QQAA 5FU7B 5AYFA 4BI8B 1Q82C 4LD9K 1M5Q1 5LJ3e 2P0QA 5CKBA 4DA4A 3DLMA 3X25B 3DLLA 3HPWA 3V7SA 5LJ5d 3JB9I 1I8FA 2RJDA 2E6NA 3OB9A 1X01A 2LNVA 4JDSA 3VKIA 4XTZA 4C92B 3M58A 1XOVA 5I2SA 1S72T 4KUDK 3C95A 1YHQA 2EQUA 3NTIA 1VIFA 3M57A 1Q81C 5LL6S 1W2BS 3S3NA 4OB0B 4QVDA 3JB9F 3LH0A 3OYFA 2ZGWA 5GMKe 4N4HA 3T9NA 2QQ9A 2ZPGB 1ZHIA 1M8VA 3F70A 4CI0C 2HQEA 3TREA 3BDUA 3CCRT 2RB6A 4M78E 3CC2A 3QG1A 4M7DA 3A8MB 1G5VA 3E9FA 3RKWA 3CBMA 1UGSB 2LT1A 2XKOC 2DZ9A 4XTXA 2E70A 1I4K1 1UGQB 4N4GA 3CPWA 2VGMA 2JTMA 3S6WA 5GAOq 3RMSA 1VQMA 3OYKA 3OYIA 2CZ0B 3WVDB 2VGNA 2F5KA 3OYLA 1WGSA 2RHXA 2X4XA 3I56T 2PQWA 4M78C 3G6EA 3ZEHA 3MEWA 2EIFA 3L2QA 2LQ8A 3VYGA 4QVCA 2XIDA 4BE0A 1VQ5A 5GAMj 2XK0A 1NPPA 1N9SA 4BI3A 1X6OA 2RH2A 1YI2A 5GAN6 4RMOA 4M7AA 2RA2A 2B8AA 3GNFB 2YRVA 5LJ5f 1VQOT 3QJ6A 4IURA 4C92A 3HL8A 1BI2A 4M7DD 5A0GA 2RHUA 4EPCA 2QXFA 4M75F 4JRQA 2XD0A 3OYYA 4M7DG 2M1HA 4E7HA 3FB9A 5GAN5 4XU3A 2KMTA 3CBOA 4JLIA 5J3BA 5GANh 1VQ6A 4GLKA 3JCMW 1VQ7A 1O9SA 2DKGA 2DTOA 4MDWA 4HT9A 5LJ3f 2XDBA 2K3XA 2D0QB 2D9TA 2RHYA 1LNXA 4MZMA 4X9CA 1VQ8A 2P0PA 1YJ9A 4IUVA 4Y91A 1VIEA 4B9WA 4J6WA 4RKUE 1K8AC 2A7YA 3A8LB 3M9QA 3EFRA 2OTJA 1WPYA 3VJPA 4PJOC 5GAMe 3OYDA 2X35A 4C92G 4Q5WA 3GOXA 3RKXA 1BI1A 4XTYA 5CCAA 3L1AA 3NTKA 2VC8A 4M75B 4UC4A 1KHCA 4EMKC 5GAOn 2LCCA 2LDMA 2C06A 1M1GA 3E9GA 3JCMh 2ZPBB 2VXEA 4NOYA 1BYMA 2K2VA 3JRZA 4HCBA 4M77E 1WNLA 5CQYA 5LJ5g 5CR2A 3INZA 3SFMA 1Q7YC 1WQ7A 3MCAB 3JCMb 4ZGJB 2DIQA 3FC3A 3MO8A 3KUFA 5GAMd 2CKKA 4N0AA 5KH6A 2LX9A 2F5TX 3OYHA 4J6XA 2EFIA 3SDZA 1JB0E 4RG2A 4BB7A 1G3SA 1U1SA 4PL6A 5GAOl 2WSFE 3CCEA 4BE1A 2M0OA 2VYTA 1QP2A 3M5AA 4LDWA 4WF2A 3WVEB 3QDRB 3J80E 2MAMA 1N8RC 1VQNT 3UWNA 3OA6A 1IZ6A 4BDZA 3I55T 2HAXA 2LQKA 5CAIA 1QVGS 2RO0A 1BI0A 2ZCFB 4C5HA 2EAYA 2PUKB 1KQ1A 5I21A 2EKOA 4OB3B 2XI9A 5LJ3j 1KHIA 5CKFA 1S72A 5D6YA 4BUGA 3TCJA 1D3BA 2LTOA 2O4XB 1XQHA 4M75A 2YLBA 5FRMA 4J7IA 4ZTFA 1U1TA 1QVGA 1NJIC 2YLCA 2QQBA 2XU8A 4QW2A 2DO3A 4FSXA 3G4ST 3GF5A 4KUIA 2BIVA 3OBWA 4QQDA 3CBPA 2EQJA 1V29B 4PJOF 2VUBA 4IUPA 4D6WA 4EMHA 2IVWA 3ER0A 4XTWA 4P5NA 5EG2A 3CCRA 1JRIA 3CCST 4JRPA 1EIFA 1QVPA 2MWPA 4KBMB 1O75A 2K5IA 5CQXA 5GAMf 1X75C 3CCVT 2WACA 3L42A 1YITT 2OTLT 2DVEA 2G3RA 1XNIA 3I56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R58 A;  3H6Z A;  2L89 A;  2DIG A;  2LVM A;  4N4G A;  1WJS A;  3O8V A;  3S6W A;  4QVZ A;  3DB3 A;  3ME9 A;  3OYK A;  3OYI A;  3E9F A;  2QQR A;  4E7H A;  4OVA A;  5FRN A;  2F5K A;  3OYL A;  3OS0 A;  5CIU A;  1WGS A;  2MWO A;  2RHX A;  2X4X A;  2PQW A;  3LLR A;  5FRO A;  4C5I A;  3OYN A;  5C0M A;  3ZEH A;  3MEW A;  3L2Q A;  4BE0 A;  3CEY A;  3EAE A;  3LYI A;  3MP6 A;  1H3Z A;  3OYM A;  5IAY A;  1OZ3 A;  2E5Q A;  2XK0 A;  2O4X A;  4BAC A;  1RI0 A;  4C5G A;  1OYX A;  2B8A A;  2FHD A;  2YRV A;  3OMG A;  3QJ6 A;  4IUR A;  2RHU A;  2M1H A;  4EDU A;  3OYE A;  3PFS A;  3Q1J A;  4FL6 A;  2LRQ A;  2GF7 A;  4N4I A;  3OYG A;  1OZ2 A;  3OYJ A;  3PNW C;  3MP1 A;  3QBY A;  2GFU A;  3L2R A;  2K3X A;  2D9T A;  5IN1 A;  2RHY A;  3LGL A;  2EQM A;  3QII A;  3QKJ A;  3MET A;  5J26 A;  2EQK A;  3DB4 A;  3FDR A;  4IUV A;  4E7I A;  4ZTJ A;  4B9W A;  2BUD A;  2RJF A;  3OQ5 A;  3LGF A;  4L59 A;  3OYB A;  3M9Q A;  3OMC A;  4E7J A;  3MEU A;  5KCO A;  2JZ2 A;  2RI2 A;  5M9O A;  2X4Y A;  4IUT A;  3OYD A;  4PLL A;  4A4G A;  2X35 A;  3GOX A;  4Q5W A;  3NTK A;  3MEV A;  4UC4 A;  5KE2 A;  1KHC A;  2QQS A;  5KCH A;  2LCC A;  2LDM A;  3E9G A;  3FEO A;  3BDL A;  1SSF A;  3OYA A;  2L8D A;  3ASK A;  4E7K A;  3PMI A;  4BDY A;  2RI3 A;  1WJQ A;  2X4W A;  3FC3 A;  2DIQ A;  3OS2 A;  3MO8 A;  3KUF A;  4NS5 A;  2CKK A;  1N27 A;  2K3Y A;  3P8D A;  4FU6 A;  3S3M A;  2RJE A;  1OI1 A;  2R57 A;  4QQ6 A;  5KH6 A;  3OYH A;  2R5M A;  2EFI A;  4IUQ A;  4E7L A;  4RG2 A;  3FLG A;  5D6X A;  2M16 A;  4HCZ A;  4PL6 A;  4BE1 A;  2M0O A;  2VYT A;  1MHN A;  2RHZ A;  4X34 A;  4BE2 A;  2P0K A;  2XDP A;  2GFA A;  3UWN A;  3LX7 A;  4LD6 A;  4A4H A;  4B9X A;  3OA6 A;  3SD4 A;  4BDZ A;  1WJR A;  3L2W A;  2RO0 A;  2IG0 A;  4C5H A;  4C5E A;  2NLU A;  2L3R A;  3S3O A;  2EKO A;  3H8Z A;  4A4F A;  3C4S A;  2RHI A;  4II1 A;  5D6Y A;  4GY5 A;  3MP8 A;  2LTO A;  2O4X B;  2RI5 A;  3DLM A;  3NTH A;  5FRM A;  3L2U A;  4ZTF A;  3PMT A;  2RJD A;  3MEA A;  2E6N A;  3OB9 A;  2RJC A;  4QW2 A;  3OY9 A;  3L2V A;  2BIV A;  4QQD A;  2EQJ A;  2EQU A;  3UT1 A;  3NTI A;  3P8H A;  4IUP A;  5C6S A;  4BD3 A;  4CRI A;  3S3N A;  4QQG A;  5J39 A;  5KE3 A;  2HQX A;  2MWP A;  2DAQ A;  3LH0 A;  3OYF A;  4Z02 A;  3OYC A;  4A4E A;  4IKF A;  4N4H A;  2WAC A;  2JTF A;  4IUU A;  3OS1 A;  3F70 A;  3L42 A;  2HQE A;  2G3R A;  1XNI A;  4PLI A;  1G5V A;  2BKD N;  2R5A A;  5D6W A; 
#chains in the Genus database with same CATH topology
 4M75 G;  1WHM A;  4E7H A;  4C5I A;  2CP7 A;  4E2F B;  1OZ3 A;  4ESR A;  1VYT A;  3EGU A;  1M9S A;  3CCM T;  3OMG A;  5LJ3 d;  3AT1 B;  5EC7 A;  4DOW A;  1PC0 A;  3KBG A;  4L5G A;  3A5Z B;  2Y90 A;  4JLG A;  2E3H A;  4FL6 A;  2EJF A;  1W2B A;  2H3E B;  1PNJ A;  2DM1 A;  3ZFJ A;  4OP0 A;  3RIR A;  3LGF A;  3SWN B;  3M55 A;  3FJ5 A;  3V8L A;  3WXM B;  2CUD A;  3SB2 A;  1CKA A;  5GAN e;  2NUT A;  3HKS A;  4DBQ A;  1B7T A;  3G71 A;  1TTH B;  4PJO A;  3VS6 A;  2KY9 A;  1OU9 A;  4V2S A;  4CC3 A;  5A0D A;  3OYA A;  2KR3 A;  3ASK A;  4JPB W;  3JCM J;  2EJ9 A;  2KXC A;  4LNP A;  2YUO A;  5GJV B;  2CH4 W;  2E6Z A;  4M7D E;  3JCM X;  2NUP B;  5IXF A;  1X27 A;  3I55 A;  1B34 B;  2QGF B;  3JB9 H;  3UF4 A;  2XDD A;  1G83 A;  2O01 E;  4FIB A;  4B9X A;  2DD4 A;  1WJR A;  3CME T;  4O6J A;  1Y96 A;  3TU4 K;  2D8H A;  3H8Z A;  1W1F A;  4DOV A;  3G4S A;  3JCM d;  1KD1 U;  5KYU B;  2AHJ B;  3L2U A;  4M78 F;  4JRK A;  5KYW A;  3CCV A;  1WQW A;  5LJ3 g;  3HSB A;  1CKB A;  2DX1 A;  4M77 C;  4QQG A;  1VQK Q;  3FIF A;  1UHC A;  1K8A U;  3I9Q A;  3OYC A;  4JS5 A;  2OAU A;  4IUU A;  4JZ4 A;  3VV0 A;  2DL5 A;  4DBF A;  3CMA Q;  1D1B A;  2HBP A;  2D6F A;  2ZPH B;  4RTU A;  9ATC B;  3ME9 A;  2E1H A;  2LP5 A;  4HT8 A;  2MWO A;  1ABQ A;  1Q7Y U;  3OYN A;  5C0M A;  2KE9 A;  1SPK A;  3OS5 A;  1X2K A;  1YCY A;  1TUC A;  1VQ9 Q;  2OTJ T;  1IHV A;  3PE0 A;  1UEC A;  2D0N A;  2LRQ A;  1M1K R;  1JXM A;  2KDS A;  5GAO m;  1Q86 C;  3LGL A;  2BZ8 A;  1PG5 B;  5GAN 3;  4M77 F;  4M75 E;  3DKM A;  2K5F A;  2L2P A;  4M78 A;  2X4Y A;  4IUT A;  3PIP A;  1UUE A;  1Q95 G;  1XTD A;  4J6Y A;  3BDL A;  5DLQ E;  3NFC A;  4LDV A;  1Y7X A;  2IPO B;  2DXU A;  1UDL A;  2JUF A;  2X4W A;  4M7A B;  1FXX A;  4BY6 B;  3S3M A;  2MF2 A;  1OI1 A;  4F7U G;  3I35 A;  1X6G A;  3GIB A;  5LJ3 h;  3EG0 A;  3CME A;  4BI4 A;  2C0O A;  2F2V A;  3SD4 A;  1IRX A;  1EZZ B;  2LCS A;  4MDX A;  1EFN A;  3U23 A;  4EMK A;  1AEY A;  2DEQ A;  2LC4 A;  1QW1 A;  4AG1 C;  3TVT A;  1XJW B;  3LWH A;  1VQ8 T;  2CT4 A;  1M90 U;  4ELZ C;  2PU9 B;  3EFO A;  4J9E A;  4J9G A;  4A4E A;  1JU5 C;  4M77 A;  4M7D C;  1YHQ T;  1UE9 A;  3RMQ A;  3C94 A;  1EX4 A;  1HSQ A;  1LPL A;  2GGR A;  2VV5 A;  1OX9 A;  3HFN A;  5GMK m;  2LVM A;  3CD6 T;  2E4H A;  3JB9 J;  5DY9 A;  4JRI A;  5FRN A;  6AT1 B;  2GQV A;  1OEB A;  3LH5 A;  2K5L A;  3MP6 A;  4M7A D;  1ZSZ B;  2FPF A;  3M0P A;  3V8K A;  1KSW A;  3G6E T;  2X3X D;  2J05 A;  1VQ5 T;  1CSK A;  1M2O A;  2CP3 A;  2J6O A;  5CKD A;  1YNZ A;  2A37 A;  2RK2 A;  2CZ1 B;  2HSP A;  5KYX A;  1UG1 A;  3QO3 A;  4F7U B;  3OYJ A;  5HKC A;  4F14 A;  3MET A;  4E7I A;  5GJW B;  4OF1 A;  4PJN A;  4M7D F;  5M9O A;  3SWN C;  4TVR A;  5KE2 A;  5I11 A;  5CK9 A;  4IIO A;  5IHK A;  2LJ1 A;  1N27 A;  3JCM V;  4ZGE B;  3HRT A;  1SRL A;  2FO0 A;  2R5M A;  4OMO A;  4C0D B;  1M8M A;  2AK5 A;  4BE2 A;  3OW2 S;  1BKB A;  1ZBX A;  4C8Q G;  3L2Z A;  3M4G A;  1RAD B;  3HHT B;  2IG0 A;  2PNI A;  2KYB A;  3E2U A;  1G3T A;  5FW9 A;  2NLU A;  2L3R A;  3URG A;  1PRM C;  1K9M R;  3C4S A;  1VQ8 A;  4M75 C;  1M5Q 1;  2VAS A;  2P0Q A;  1S1N A;  3DLM A;  3V7S A;  3CCV Q;  5LJ5 d;  2JT4 A;  2E6N A;  3ULR B;  4JDS A;  4LUE A;  3M58 A;  1YHQ A;  3M57 A;  1IXD A;  4OB0 B;  2IIM A;  3EGX A;  1RAF B;  1QWE A;  1RAI B;  1WX6 A;  2CP6 A;  2QQ9 A;  3T9N A;  1M8V A;  2HQE A;  3TRE A;  1YCS B;  1IB8 A;  1S72 Q;  3QG1 A;  4M7D A;  1BU1 A;  3E9F A;  2H8H A;  2E70 A;  3RMS A;  2CZ0 B;  1WA7 A;  1YFN A;  1WGS A;  2JS0 A;  3VS7 A;  3G6E A;  2LQ8 A;  4QVC A;  1VOM A;  1VQ5 A;  5GAM j;  1NPP A;  1GBR A;  2X9H A;  2XMF A;  4BI3 A;  3M0Q A;  4HVW A;  1UHF A;  3HL8 A;  2HEQ A;  1B3Q A;  2QXF A;  4M75 F;  5KYW B;  3FB9 A;  5GAN 5;  2FRW A;  1AOJ A;  4XU3 A;  4MDW A;  5LJ3 f;  2D9T A;  1WDX A;  4MZM A;  2P0P A;  1ZSG A;  2K79 A;  1HJD A;  2A7Y A;  2YRC A;  5GAM e;  3OYD A;  1M90 R;  2X35 A;  4C92 G;  1W2B P;  2W10 A;  1BI1 A;  4XTY A;  3L1A A;  2EKH A;  3VS4 A;  2C06 A;  1IO6 A;  2LDM A;  1M1G A;  3E9G A;  2ATC B;  4NOY A;  1WNL A;  5LJ5 g;  4ORZ A;  3INZ A;  3MO8 A;  2L0A A;  4KH0 B;  2LX9 A;  2CP5 A;  3SDZ A;  4A63 B;  2M02 A;  4PL6 A;  4BE1 A;  2M0O A;  2VYT A;  3QDR B;  2L3Q A;  1MMA A;  2K7A A;  1QWF A;  2EAY A;  2PUK B;  2DEU A;  1KHI A;  1SSH A;  1AWX A;  4M75 A;  1C6V X;  3MJX A;  5FRM A;  4ZTF A;  1U1T A;  2NUZ A;  1QVG A;  1VQN Q;  2QQB A;  2DO3 A;  2BIV A;  4EMH A;  1R77 A;  1WIE A;  3ER0 A;  4P5N A;  4JRP A;  1JRI A;  4FSS A;  3UA7 A;  3EG3 A;  3L42 A;  2OTL T;  2SEM A;  2X3W D;  2FPE A;  4FYW B;  4PJL A;  2KI7 A;  2L89 A;  3MKD A;  3CCJ T;  4C8Q E;  1H92 A;  3CCS Q;  2MMP A;  5D7U A;  2PVG B;  2FZG B;  4XQ3 A;  2EGA A;  2DXT A;  3VUB A;  2DFU A;  5A2Q E;  1FMW A;  2KNB B;  1PSF A;  2O4X A;  1OYX A;  1ZSZ C;  4XTV A;  4RUG A;  1FWZ A;  4Z89 A;  2WSC E;  4LUD A;  5HK0 A;  3OYE A;  2M9U A;  3CPF A;  4J9B A;  5LJ5 h;  1WHH A;  3H0I A;  1X2Q A;  3OYG A;  3CCL T;  1GRI A;  3CC7 T;  2GFU A;  4MMK A;  3QHS A;  5IN1 A;  5GAN 4;  3FDR A;  1VQP T;  3X20 B;  1VA7 A;  4M78 D;  3MEU A;  2QEX Q;  1FX7 A;  1NLO C;  1K9A A;  4C0G A;  2EW3 A;  3A8O B;  2A08 A;  1TWB A;  2QQS A;  4KH1 B;  3CCQ Q;  1KD1 C;  3EG1 A;  2DTH A;  1SSF A;  1LCK A;  3CCU T;  2YWW A;  2CH4 A;  2GQI A;  2YHT A;  4NS5 A;  2CT3 A;  4FU6 A;  3BW1 A;  4AFS C;  4D8D A;  4E47 A;  3FLG A;  1Q82 R;  1YIJ T;  5KYX B;  1MGQ A;  1Y07 A;  1NEB A;  2P0K A;  1Z9Q A;  1GBQ A;  1NPR A;  4MZP A;  4LN2 A;  3EG9 B;  1Q81 R;  1RAG B;  4GY5 A;  3VS3 A;  4C92 E;  4OB2 B;  4FYV B;  3RR6 A;  3A8H B;  2QA4 A;  2EBP A;  3NHN A;  1NBE B;  2OTL A;  1K9M C;  4B6M A;  4BD3 A;  4CRI A;  4HA8 A;  1VQ4 T;  1WXT A;  1M4Z A;  3VYH B;  1BK2 A;  4Z02 A;  2JTF A;  1M1K U;  3PT9 A;  1JBM A;  1PKT A;  4IUQ A;  1VYU A;  1YJW T;  2DJQ A;  1WHG A;  2ED0 A;  1VQ6 T;  4K11 A;  2ZPF B;  1AVZ C;  1LJO A;  3JV3 A;  4QKU A;  3RDV A;  5IAY A;  1YBY A;  2E64 A;  1VQL T;  2Y4X A;  1ZA1 B;  4X9D A;  4RTT A;  2ABL A;  3CCL A;  4PJJ A;  2KAF A;  3CC7 A;  1V1C A;  4JJC A;  2JN0 A;  3HFO A;  1VQP A;  1QQJ A;  3EGX B;  1YJN Q;  2EQK A;  1OPL A;  3D7S B;  3V7C A;  3A1P A;  1V76 A;  2QTX A;  2FYK A;  4CC7 A;  5GAN j;  3AHU A;  4C8Q C;  4AG2 C;  1QLY A;  2ROT A;  4FW2 A;  4F04 B;  1I81 A;  3CCU A;  5FU6 C;  3V7R A;  2EWN A;  2QDY B;  2A3L A;  4E7K A;  3EFS A;  1M90 C;  3M4Y A;  1YIJ A;  2X51 A;  2V26 A;  2HKN A;  4E7L A;  2ZPE B;  2EYX A;  3M0S A;  2D8J A;  2JXB A;  3RUX A;  2VVK A;  1AZG B;  2COZ A;  2AT1 B;  3X28 B;  2HDA A;  2EVR A;  4C5E A;  2F69 A;  3S3O A;  2V8I A;  5GMK h;  3HRS A;  4KUL A;  2DL8 A;  1BCM A;  1VQ4 A;  2LT4 A;  3MEA A;  2MI6 A;  4C0Z A;  4C8Q F;  2D1X A;  3UT1 A;  1WHL A;  3P8H A;  3CC4 Q;  1PRL C;  1KC8 R;  5J39 A;  2GTO A;  4CC4 B;  4IKF A;  4ATO A;  1YJW A;  1HYO A;  4PLI A;  2G6F X;  2BKD N;  1E7O A;  1G3Y A;  1F1B B;  1QVF A;  4OVA A;  3CC2 T;  5FU7 C;  5FRO A;  1VQL A;  5GAN 2;  1KG1 A;  3C12 A;  1R0C B;  3CEY A;  1K0X A;  1H3Z A;  1WFW A;  2E5Q A;  4A53 A;  4M7A G;  1M2V B;  1SHG A;  2LQW A;  4C92 C;  4C5G A;  4O5V A;  1WYX A;  2W0Z A;  3X24 B;  1TSF A;  1YI2 T;  3Q1J A;  1VQM Q;  3CXC P;  3PNW C;  1K73 R;  1MUZ A;  3V8J A;  4RCB A;  2K57 A;  1D0Z A;  4ZTJ A;  4XU0 A;  1VQ7 T;  3CCM A;  4AFQ C;  3OMC A;  1OX8 A;  4E7J A;  2QAZ A;  1TXQ A;  2KYM A;  3RES A;  1ZQ1 A;  3QXE B;  1K9M U;  4C8Q A;  2HSE B;  1U8R A;  1KIK A;  2JM9 A;  1ARK A;  2L8D A;  2RNA A;  4BDY A;  5HY6 A;  2LJ3 A;  4FM4 B;  1I5L A;  3EHQ A;  3QYG B;  1YJ9 Q;  3JCM c;  2R57 A;  4ME7 A;  4C92 F;  5GAN 8;  2YT6 A;  2GNC A;  3EHR A;  2GFA A;  2L3S A;  2RQU A;  2KSS A;  1PKS A;  1LVK A;  2HL5 C;  3JCM g;  4A4F A;  4AFU C;  1BIA A;  5AYF A;  1Q82 C;  3THK A;  2QA4 Q;  5LJ3 e;  5L23 A;  5CKB A;  3DLL A;  1T0J A;  3JB9 I;  1JJ2 A;  2LNV A;  3VKI A;  5I2S A;  1TS9 A;  2YXY A;  3EGD A;  3C95 A;  3CCE Q;  1VIF A;  1Q81 C;  3HTR A;  1W2B S;  2EPD A;  2LX7 A;  3JB9 F;  2ZGW A;  1ZHI A;  2LJ0 A;  1K1Z A;  3CCR T;  2RB6 A;  1NEG A;  3CC2 A;  1QVG P;  1WI7 A;  2FRY A;  1JEG A;  1UGS B;  2LT1 A;  4XTX A;  2DZ9 A;  1I4K 1;  3CPW A;  2VGM A;  2LNH B;  3OYI A;  2F5K A;  3I56 T;  2C0I A;  3VYG A;  2XID A;  1W70 A;  2XK0 A;  2RMO A;  1N9S A;  4AFZ C;  1YI2 A;  4RMO A;  2B8A A;  2DIL A;  2YRV A;  1OPK A;  1VQO T;  4C92 A;  1BI2 A;  5I22 A;  4FYY B;  1N5Z A;  2XD0 A;  2DL4 A;  2M1H A;  3CBO A;  5J3B A;  4DBR A;  4GLK A;  4KGV B;  3JCM W;  1VQ7 A;  2O9S A;  3H0H A;  2XDB A;  2K3X A;  1LNX A;  4OMN A;  4RKU E;  3UAT A;  3A8L B;  2NWM A;  2FPD A;  3EFR A;  3TSZ A;  2OTJ A;  1D0X A;  1PD1 A;  3EH1 A;  3VJP A;  2J06 A;  2JS2 A;  4Q5W A;  2QYZ A;  1AD5 A;  3JCM h;  2MIO A;  2DMO A;  3JRZ A;  4J9D A;  5CQY A;  1YIJ Q;  3MCA B;  4OMM A;  5GAM d;  5IHI A;  2ZAE A;  3OYH A;  1X69 A;  4J6X A;  5IHN A;  1YN8 A;  3J80 E;  1QP2 A;  3WVE B;  2MK5 A;  4HXJ A;  3G71 Q;  3EH2 A;  4C5H A;  2RQR A;  2HCK A;  1U3O A;  2XI9 A;  2JM8 A;  3TCJ A;  2LTO A;  4OML A;  4AMC A;  1XQH A;  2MYS A;  2YLB A;  2YLC A;  2FG0 A;  2OX7 A;  4FSX A;  3I55 Q;  1WHK A;  2DL3 A;  3OBW A;  4FYX B;  1V29 B;  2VUB A;  4IUP A;  4RTW A;  3CCR A;  1QVP A;  4KBM B;  2K5I A;  2MCN A;  1AWO A;  1XNI A;  3G4S Q;  3I56 A;  4ELY C;  1OV3 A;  2JOY A;  1KC8 C;  1WJS A;  3DB3 A;  5I2M A;  3GP8 A;  4DEY A;  1NE8 A;  2M51 A;  2NUT B;  2DZC A;  3LW5 E;  4PJO B;  1VQO A;  3EAE A;  1NJI U;  4XU2 A;  2A36 A;  1ZUY A;  1YWP A;  1FMK A;  2E12 A;  2KRS A;  4F7U E;  3CD6 A;  1VYV A;  4FT4 A;  4KGZ B;  4HVV A;  2GF7 A;  4JZ3 A;  2ZPI B;  3A8G B;  2LCL A;  3MP1 A;  3QKJ A;  1N9R A;  3CCM Q;  1Q82 U;  2QTV A;  2KK4 A;  4PNO A;  1PCX A;  2BUD A;  3OYB A;  1Y96 B;  2CP2 A;  3TSW A;  5KCO A;  2NYS A;  2ECZ A;  5A0L A;  1K73 C;  1PM3 A;  1HXD A;  4WCI A;  1Q81 U;  2HL3 A;  3PVQ A;  2XHC A;  2DET A;  2YRD A;  1KQS S;  2RK1 A;  2KRM A;  3JAM E;  1UGV A;  4A54 A;  2A28 A;  1ZUU A;  2M16 A;  1I1J A;  2HMA A;  1M1K C;  2VB6 A;  4PJO D;  1W4S A;  3QZ9 B;  4MML A;  1IRE B;  1AT1 B;  2K2M A;  3SWN A;  1GXI E;  1VQK T;  2RN8 A;  4LE9 A;  2HBW A;  3M0U A;  4HCC A;  2YDL A;  4JJN K;  2DPP B;  2RQT A;  3OSS C;  1BI3 A;  3UPU A;  3J7A F;  1PWT A;  2RQV A;  3CMA T;  4M7A C;  3CME Q;  4BY6 C;  1YWO A;  1ZX6 A;  2F2X A;  3HRU A;  4FW1 A;  2HQX A;  1SHF A;  1ABO A;  2NUP A;  4J9H A;  2E3I A;  1M3B A;  1OUL A;  1B34 A;  2PUO B;  1U5S A;  1UTI A;  3M56 A;  1VQ9 T;  4M78 B;  2K9G A;  2OJ2 A;  4R56 A;  3PIO A;  2V8J A;  5FLX E;  1GCQ C;  2BE9 B;  1KQ2 A;  3JCM f;  1RI0 A;  4KT0 E;  3JCM P;  2CGH A;  1QVF P;  3QYH B;  2KVQ G;  1G2B A;  4C0F A;  1ZLM A;  4EMG A;  3G7Z A;  1VQ7 Q;  4N4I A;  3PGG A;  1GCP A;  1SRM A;  3TQ7 P;  4J8O A;  3QII A;  1PSE A;  5J26 A;  1KJW A;  2FVU A;  2OTJ Q;  4RG8 A;  3OQ5 A;  4LDY A;  1M30 A;  2Y4Y A;  2EGE A;  2PVD B;  3P8B B;  4Y28 E;  2CZ6 B;  4C8Q D;  5KYY A;  4EMK B;  4PLL A;  3E1S A;  4A4G A;  2DXC A;  3MEV A;  3VS5 A;  1M1F A;  2M0Y A;  1NG2 A;  2ZZD A;  1N8R R;  3EFO B;  4XK8 E;  1KC8 U;  4M77 B;  2EYW A;  1GFC A;  1MHN A;  2RHZ A;  1VQK A;  3N5B B;  3LX7 A;  4A4H A;  4VUB A;  1NJI R;  3PTA A;  2DTI A;  2AKK A;  1DJ7 B;  3CXC S;  3FRN A;  3CMA A;  2XG8 D;  1UJY A;  3NMZ C;  4XAX B;  2RI5 A;  3NTH A;  5GAN d;  3A98 A;  2EYY A;  3MHX A;  2RJC A;  3L2V A;  3OY9 A;  2DE0 X;  2H3J A;  5C6S A;  3M53 A;  1HK9 A;  3EG2 A;  1G3W A;  4C0D C;  2HZY A;  3OS1 A;  1OOT A;  2L3P A;  1VQ9 A;  1K73 U;  1VQ8 Q;  1AZE A;  5CO7 A;  2MPX C;  4E7S A;  5D6W A;  1JJ2 P;  1NZ9 A;  1OQK A;  4QVZ A;  3BY7 A;  4F7U F;  4LDU A;  4MZT A;  2EYZ A;  1QMC A;  4YTL A;  3G1J A;  1WZO A;  1YHQ Q;  2BTT A;  3LYI A;  3OYM A;  2QK0 A;  4ZGD B;  2VXF A;  4C92 D;  5HK3 A;  4M77 D;  1K0S A;  3H9N A;  3CD6 Q;  3BFM A;  4HKE A;  3CPW P;  3CCJ A;  3GNG A;  4DQ2 A;  4EDU A;  1LOJ A;  2CZ7 B;  1MMN A;  2SRC A;  1J3T A;  1IGU A;  3G6E Q;  3H0F A;  1VQ5 Q;  4L59 A;  2ENM A;  3I5R A;  1TH7 A;  3QUI A;  2A0F B;  3PVL A;  3JB9 D;  5KCH A;  2DLP A;  3HP9 A;  1ZSZ A;  3GBQ A;  4L6V 5;  4A4K A;  3UA6 A;  3VRZ A;  2HD0 A;  1R0B G;  5GAN g;  4OGE A;  1UGP B;  4NL3 A;  1WJQ A;  1AWJ A;  2RM4 A;  2Z0W A;  5CKE A;  2F1L A;  2JJ9 A;  1A0N B;  4F7U A;  4M7D B;  5GMK j;  2BZX A;  1C1A A;  1WXB A;  4X34 A;  4RTV A;  2XDP A;  1NM7 A;  1Y71 A;  1G8X A;  1QCO A;  2E41 A;  4J7F A;  1Z9Z A;  2CP0 A;  2RHI A;  4II1 A;  4GLM A;  2QQA A;  3I5S A;  4LD9 K;  4J9F A;  4DA4 A;  3VRY A;  1UJ0 A;  4X1V A;  1I8F A;  2RJD A;  3OB9 A;  1S72 T;  4KUD K;  4XTZ A;  1XOV A;  1TUD A;  2GTJ A;  2P4R A;  2QAS A;  3NTI A;  4ZNX A;  2J6F A;  5LL6 S;  4QVD A;  2YUN A;  2EGC A;  3LH0 A;  2BE7 D;  5GMK e;  4N4H A;  3F70 A;  3A8M B;  3RKW A;  5KYN A;  4Z8A A;  3CBM A;  4PK4 A;  2XKO C;  3REB B;  1D0Y A;  1UGQ B;  2JTM A;  3S6W A;  5GAO q;  3WVD B;  3OYL A;  2X4X A;  2PQW A;  4IIM A;  4M78 C;  4BE0 A;  2EIF A;  2DF6 A;  1QKX A;  1ZUK A;  1UFF A;  1X6O A;  2RH2 A;  2RA2 A;  3GNF B;  5LJ5 f;  3QJ6 A;  4IUR A;  4M7D D;  5A0G A;  4EPC A;  3OYY A;  1PD0 A;  1WLP B;  2KMT A;  4JLI A;  5GAN h;  1VQ6 A;  2I0N A;  2DER A;  1IHW A;  2DKG A;  2RHY A;  4X9C A;  4IUV A;  4B9W A;  4F16 A;  4J6W A;  4RTX A;  3M9Q A;  2CDT A;  1IGQ A;  5CCA A;  3NTK A;  4M75 B;  2J6K A;  2VC8 A;  1KHC A;  2K3B A;  4EMK C;  2LCC A;  4HCB A;  2DBK A;  5CR2 A;  3SFM A;  4KRT A;  4JJB A;  1WQ7 A;  3JCM b;  4ZGJ B;  3FC3 A;  1Y0M A;  4WTO B;  1JB0 E;  4RG2 A;  5HCK A;  4BB7 A;  1U06 A;  1U1S A;  2DNU A;  2OI3 A;  2WSF E;  5GAO l;  3M5A A;  2MAM A;  2COY A;  1N8R C;  1VQN T;  1IZ6 A;  2LQK A;  5CAI A;  1BI0 A;  1KQ1 A;  5LJ3 j;  5CKF A;  1S72 A;  5D6Y A;  4BUG A;  3VS1 A;  1X6B A;  1D3B A;  1D09 B;  5KYY B;  2O4X B;  4ANJ A;  1E6G A;  1NJI C;  4D8K A;  5FWC A;  3R6N A;  4KUI A;  4QQD A;  2EQJ A;  1RAB B;  3CCS T;  4XTW A;  1RLQ C;  1EIF A;  1O75 A;  2FZK B;  1YIT T;  2E5K A;  2G3R A;  3QWX X;  3H6Z A;  4M75 D;  2DIG A;  3E19 A;  4XU1 A;  2QI2 A;  3X26 B;  1SF9 A;  3OW2 A;  2RF0 A;  4XTU A;  2HNI A;  4J83 A;  3OS0 A;  2YUQ A;  1TG0 A;  2LQN A;  2FEI A;  2OTL Q;  5GAO p;  1JO8 A;  3JSC A;  3ZL7 C;  2DJZ A;  4BAC A;  3CCJ Q;  4RTZ A;  1WXU A;  4DEX A;  1I5O B;  3NGP A;  4R0K A;  1Y57 A;  2QEX T;  5CKH A;  1GL5 A;  1ACM B;  3QBY A;  2XIC A;  2V1Q A;  3CCQ T;  3RNJ A;  3OBY A;  4HCK A;  5GMK l;  2RJF A;  1C0M A;  4DBH A;  3LWI A;  1T0H A;  2RI2 A;  1KK7 A;  2DA9 A;  3CCL Q;  1QCN A;  3CC7 Q;  1TU0 B;  4J5Y A;  1VQP Q;  1MMG A;  3IQL A;  1BBZ A;  4RTY A;  2K3Y A;  4QQ6 A;  2KBT A;  1VQN A;  1MNE A;  3QZ5 B;  2EYQ A;  4JS4 A;  2KGT A;  4CC2 A;  1RAA B;  3JCM e;  1KQS A;  1QVF S;  1H64 1;  2V1R A;  3CCU Q;  2KQW A;  5GAN 7;  1BB9 A;  3M54 A;  4PJO G;  4NL2 A;  4FT2 A;  3RBB B;  4M7A E;  1MV3 A;  2ESW A;  5ECA A;  3CCS A;  1I0C A;  3PMT A;  4J9C A;  2K4Y A;  2DK3 A;  3QPH A;  1YIT A;  1M3A A;  3M0T A;  2DAQ A;  5GAN f;  3NPF A;  2VWF A;  2WSE E;  2CYZ B;  4JJD A;  2R58 A;  4PJM A;  4JUV A;  1FYN A;  2VKN A;  3QWY A;  1VQ4 Q;  5FWB A;  5DM7 R;  2QQR A;  1T3L A;  5CIU A;  2CSQ A;  1GFD A;  5DLO A;  1KD1 R;  2AIR B;  3EG9 A;  1NYG A;  4OB1 B;  1HD3 A;  2PZ1 A;  3VS0 A;  1NLP C;  2DXB A;  1K76 A;  2QEX A;  1YJN T;  1BCO A;  1YJW Q;  3J81 E;  3C0C A;  3JCM Q;  3FJP A;  1VQ6 Q;  1RAE B;  1K8A R;  1N8R U;  3VUZ A;  1M3C A;  3CCQ A;  4R55 A;  1SG5 A;  4HVU A;  1MMD A;  1VQL Q;  2EQM A;  4ZN1 A;  5GAO r;  3BE3 A;  1Q7Y R;  2JZ2 A;  1R8O B;  2AZV A;  5AT1 B;  2OAW A;  1JJ2 S;  2JVV A;  2CSI A;  2V8K A;  4OMF B;  5GMK i;  2LZ6 B;  2HQH A;  2QDL A;  3MPU B;  3PMI A;  5GAM g;  1AWW A;  2DBM A;  2DRK A;  3H41 A;  3KXT A;  2RJE A;  4ZN3 A;  1BIB A;  4J9I A;  2KEA A;  1Q86 U;  5CVI A;  2CS7 A;  2J7I A;  4HCZ A;  4M78 G;  3CPW S;  5IT9 E;  1RL2 A;  4LD6 A;  3QDF A;  1UGR B;  3ZBD A;  3CC4 T;  1MND A;  1H3H A;  3MP8 A;  2DRM A;  2KT1 A;  2P4T A;  2E10 A;  3CXC A;  1SKU B;  4RCC A;  2X4J A;  4GBQ A;  3GLX A;  1H8K A;  5KE3 A;  1VUB A;  2JTE A;  3QSU A;  1UB4 A;  4E7Z A;  5L8R E;  2R5A A;  8AT1 B;  2GCX A;  1K4U S;  3SEM A;  3OSV A;  4PJO E;  3O8V A;  2L5Q A;  3LLR A;  2QG9 B;  1YJN A;  4C8Q B;  4KGX B;  1VQM T;  4LXC A;  4OGC A;  2DL7 A;  2FB7 A;  1X43 A;  5FU6 B;  1D3B B;  2FHD A;  4M77 G;  3QJY A;  3CC2 Q;  3RKY A;  2O2O A;  3PFS A;  3M59 A;  5GAM h;  2RD1 A;  1OZ2 A;  2JNG A;  3L2R A;  2MOX A;  1QP3 A;  3DB4 A;  1T3S A;  2LMJ A;  3VU3 C;  1RAC B;  1RI9 A;  5LJ5 j;  1YI2 Q;  5KYU A;  2DYI A;  1YJ9 T;  2EJG A;  2I2L A;  1N6A A;  2CUB A;  1B07 A;  3JB9 G;  3FEO A;  3GPL A;  1AHJ B;  2COW A;  1D1C A;  1M2V A;  2O31 A;  3EGD B;  4Z88 A;  4N0A C;  2RI3 A;  2RQW A;  3OS2 A;  1TUG B;  3P8D A;  4M7A F;  7AT1 B;  2RPN A;  3VS2 A;  2DD5 A;  2ED1 A;  4LDX A;  1P92 A;  5D6X A;  2QA4 T;  4PFZ A;  1UEB A;  2FL7 A;  3CC4 A;  3R6O A;  2K6D A;  3SHW A;  5LJ5 e;  3RER A;  2JW4 A;  3L2W A;  2KRN A;  1OU8 A;  3CCE T;  2E65 A;  2PTK A;  3TEE A;  2PVO B;  2KT8 A;  3UDC A;  4PKC C;  5FU7 B;  4BI8 B;  3X25 B;  3HPW A;  3M0R A;  1TOV A;  1KFZ A;  1X01 A;  4M4Z A;  1YIT Q;  2JMA A;  4C92 B;  4E6R A;  2EQU A;  3S3N A;  1W6X A;  3OYF A;  2QGG A;  2ZPG B;  1PHT A;  4CI0 C;  2AZS A;  2O9V A;  1SEM A;  5IXB A;  3BDU A;  4M78 E;  1G5V A;  2YUP A;  2GBQ A;  4N4G A;  1VQM A;  4EIK A;  3OYK A;  2VGN A;  2O88 A;  2RHX A;  4Y92 A;  4FCY A;  3ZEH A;  2B86 A;  3MEW A;  3L2Q A;  3CCR Q;  1MV0 B;  2FZC B;  5GAN 6;  4M7A A;  1Q86 R;  4JRQ A;  2RHU A;  3OW2 P;  3I56 Q;  4OMQ A;  4M7D G;  4AT1 B;  1O9S A;  2DTO A;  4HT9 A;  1FMV A;  2D0Q B;  1VQO Q;  1YJ9 A;  4Y91 A;  1VIE A;  1K8A C;  1QCF A;  1WPY A;  4PJO C;  2DVJ A;  2DYB A;  1GCQ A;  1RLP C;  3GOX A;  3RKX A;  3O5Z A;  2ROL A;  4UC4 A;  5GAO n;  1RUW A;  3CQT A;  2ZPB B;  3REA B;  1JXO A;  1ZBJ A;  2VXE A;  2AKL A;  2K2V A;  1BYM A;  4M77 E;  1NYF A;  1Q7Y C;  3G71 T;  2DIQ A;  3KUF A;  2CKK A;  4N0A A;  2JMC A;  5KH6 A;  2F5T X;  2EFI A;  2CRE A;  1G3S A;  3CCE A;  4LDW A;  4WF2 A;  2HKQ B;  3UWN A;  3OA6 A;  4BDZ A;  2EQI A;  4PFO A;  1JQQ A;  3I55 T;  5IH2 A;  2HAX A;  1QVG S;  2RO0 A;  2ZCF B;  2YSQ A;  1ZA2 B;  5I21 A;  2EKO A;  4OB3 B;  4OMP A;  4QT7 A;  1RAH B;  4F17 A;  2KXD A;  1KQS P;  4J7I A;  8ATC B;  1WHJ A;  4QW2 A;  2XU8 A;  2P84 A;  3G4S T;  3GF5 A;  4PFP A;  3CBP A;  1E6H A;  4D6W A;  4PJO F;  2BZY A;  2IVW A;  5EG2 A;  1D1A A;  1YP5 A;  2KRO A;  2C0T A;  2MWP A;  3CCV T;  1M27 C;  2F2W A;  1X75 C;  5CQX A;  5GAM f;  1I07 A;  2WAC A;  2DVE A;  3KFV A;  1QKW A; 
#chains in the Genus database with same CATH homology
 4ELY C;  3H6Z A;  2L89 A;  2JOY A;  4M75 D;  4C8Q E;  2DIG A;  3CCJ T;  3E19 A;  1KC8 C;  1WJS A;  2MMP A;  4M75 G;  2PVG B;  3DB3 A;  2QI2 A;  4XU1 A;  5I2M A;  3X26 B;  4XQ3 A;  3GP8 A;  1NE8 A;  4XTU A;  2HNI A;  3OW2 A;  4J83 A;  3OS0 A;  2DZC A;  2DXT A;  3LW5 E;  4C5I A;  4PJO B;  1VQO A;  3EAE A;  3VUB A;  1NJI U;  4XU2 A;  3JSC A;  5GAO p;  5A2Q E;  1OZ3 A;  2DJZ A;  1PSF A;  2O4X A;  4BAC A;  1OYX A;  4XTV A;  1M9S A;  3CCM T;  2E12 A;  3OMG A;  5LJ3 d;  4DOW A;  1FWZ A;  4F7U E;  2WSC E;  3CD6 A;  3KBG A;  4L5G A;  4FT4 A;  3A5Z B;  5HK0 A;  2Y90 A;  3OYE A;  2M9U A;  3CPF A;  4JLG A;  4FL6 A;  5LJ5 h;  2QEX T;  2GF7 A;  2EJF A;  5CKH A;  1W2B A;  3OYG A;  3CCL T;  2ZPI B;  3A8G B;  2LCL A;  3MP1 A;  3QBY A;  3CC7 T;  2GFU A;  4MMK A;  2XIC A;  3QHS A;  5IN1 A;  3QKJ A;  1N9R A;  5GAN 4;  1Q82 U;  3ZFJ A;  3CCQ T;  4OP0 A;  3FDR A;  3OBY A;  2KK4 A;  4PNO A;  1VQP T;  3X20 B;  5GMK l;  4M78 D;  2BUD A;  3RIR A;  2RJF A;  3LGF A;  3SWN B;  3M55 A;  3OYB A;  1Y96 B;  3LWI A;  3MEU A;  5KCO A;  2RI2 A;  3V8L A;  3WXM B;  1FX7 A;  3SB2 A;  5GAN e;  5A0L A;  3HKS A;  1K73 C;  4C0G A;  3A8O B;  1HXD A;  1Q81 U;  3G71 A;  4PJO A;  2QQS A;  2KY9 A;  2XHC A;  1KD1 C;  4J5Y A;  2DTH A;  1SSF A;  3OYA A;  5A0D A;  4V2S A;  3ASK A;  3JCM J;  2EJ9 A;  3CCU T;  1KQS S;  2RK1 A;  2YHT A;  3JAM E;  4NS5 A;  2E6Z A;  4M7D E;  2K3Y A;  4FU6 A;  3BW1 A;  4A54 A;  4QQ6 A;  3JCM X;  1VQN A;  3QZ5 B;  2EYQ A;  4JS4 A;  4E47 A;  3I55 A;  3FLG A;  1B34 B;  2M16 A;  3JCM e;  1KQS A;  1YIJ T;  1MGQ A;  1Y07 A;  1H64 1;  1M1K C;  1QVF S;  3JB9 H;  2XDD A;  2KQW A;  5GAN 7;  4PJO D;  2P0K A;  2O01 E;  4FIB A;  1W4S A;  3QZ9 B;  3M54 A;  4PJO G;  4B9X A;  2DD4 A;  1WJR A;  4MML A;  4NL2 A;  1IRE B;  4FT2 A;  3CME T;  3SWN A;  1GXI E;  4O6J A;  1Y96 A;  1NPR A;  3TU4 K;  4M7A E;  4MZP A;  3H8Z A;  1VQK T;  4DOV A;  3G4S A;  4GY5 A;  4C92 E;  3JCM d;  4HCC A;  4OB2 B;  4JJN K;  1KD1 U;  2DPP B;  2AHJ B;  3OSS C;  1BI3 A;  3CCS A;  3UPU A;  3L2U A;  3A8H B;  4M78 F;  4JRK A;  2QA4 A;  3J7A F;  3PMT A;  2K4Y A;  3CCV A;  3CMA T;  4M7A C;  2DK3 A;  3QPH A;  1WQW A;  4BY6 C;  2OTL A;  1YIT A;  1K9M C;  3HRU A;  4BD3 A;  4HA8 A;  4M77 C;  4QQG A;  4CRI A;  5LJ3 g;  1VQ4 T;  3HSB A;  3FIF A;  2HQX A;  2DAQ A;  1M4Z A;  3VYH B;  1K8A U;  5GAN f;  4Z02 A;  3OYC A;  4JS5 A;  2OAU A;  2WSE E;  2JTF A;  1M1K U;  3PT9 A;  4IUU A;  3VV0 A;  1JBM A;  1B34 A;  2PUO B;  2CYZ B;  4IUQ A;  3M56 A;  2R58 A;  2HBP A;  4JUV A;  2D6F A;  2ZPH B;  1VQ9 T;  1YJW T;  3ME9 A;  5DM7 R;  2QQR A;  4M78 B;  2E1H A;  4R56 A;  5CIU A;  4HT8 A;  2MWO A;  1VQ6 T;  1Q7Y U;  5DLO A;  2ZPF B;  3OYN A;  1LJO A;  5C0M A;  3PIO A;  2V8J A;  4OB1 B;  5FLX E;  5IAY A;  1KQ2 A;  3OS5 A;  3JCM f;  1RI0 A;  4KT0 E;  3JCM P;  1YBY A;  2DXB A;  2E64 A;  2CGH A;  1VQL T;  1YCY A;  2Y4X A;  2QEX A;  1YJN T;  4X9D A;  3CCL A;  2KAF A;  2OTJ T;  3J81 E;  3CC7 A;  3JCM Q;  3FJP A;  3QYH B;  2KVQ G;  4C0F A;  4EMG A;  1N8R U;  3G7Z A;  3VUZ A;  2JN0 A;  3CCQ A;  2LRQ A;  4N4I A;  3HFO A;  2KDS A;  3PGG A;  4R55 A;  1VQP A;  5GAO m;  1Q86 C;  4J8O A;  3LGL A;  2EQM A;  3QII A;  4ZN1 A;  1PSE A;  2EQK A;  5J26 A;  5GAO r;  5GAN 3;  3V7C A;  2FVU A;  4M77 F;  4RG8 A;  3OQ5 A;  4LDY A;  1JJ2 A;  2QTX A;  2FYK A;  2Y4Y A;  4M75 E;  2PVD B;  3P8B B;  3DKM A;  2K5F A;  5GAN j;  4Y28 E;  3AHU A;  2JZ2 A;  2CZ6 B;  4C8Q D;  4M78 A;  4C8Q C;  4EMK B;  2X4Y A;  4IUT A;  4PLL A;  1R8O B;  3E1S A;  4A4G A;  3PIP A;  1I81 A;  3CCU A;  2DXC A;  3MEV A;  1JJ2 S;  2JVV A;  1XTD A;  5FU6 C;  3V7R A;  4J6Y A;  2V8K A;  4OMF B;  3BDL A;  1M1F A;  5DLQ E;  3NFC A;  5GMK i;  4LDV A;  2EWN A;  1Y7X A;  2QDY B;  2A3L A;  2DXU A;  4E7K A;  3PMI A;  5GAM g;  2JUF A;  2ZZD A;  3EFS A;  2X4W A;  4M7A B;  3KXT A;  1M90 C;  1FXX A;  3M4Y A;  4XK8 E;  4BY6 B;  3S3M A;  1YIJ A;  2MF2 A;  2RJE A;  1OI1 A;  1KC8 U;  4ZN3 A;  1BIB A;  4M77 B;  4F7U G;  1Q86 U;  5CVI A;  4E7L A;  2CS7 A;  2ZPE B;  3GIB A;  5LJ3 h;  3CME A;  4HCZ A;  4M78 G;  4BI4 A;  3G71 T;  1MHN A;  2RHZ A;  3RUX A;  3CPW S;  5IT9 E;  1VQK A;  3N5B B;  1RL2 A;  3LX7 A;  4LD6 A;  4VUB A;  4A4H A;  3SD4 A;  2DTI A;  3PTA A;  1UGR B;  3ZBD A;  3X28 B;  1DJ7 B;  4C5E A;  3CC4 T;  3CXC S;  2F69 A;  3S3O A;  4MDX A;  2V8I A;  4EMK A;  3FRN A;  5GMK h;  3CMA A;  2DEQ A;  2XG8 D;  3MP8 A;  3HRS A;  4KUL A;  4XAX B;  2LC4 A;  2RI5 A;  1QW1 A;  3NTH A;  2P4T A;  1VQ4 A;  2LT4 A;  5GAN d;  3LWH A;  2E10 A;  1VQ8 T;  3MEA A;  2MI6 A;  3MHX A;  2RJC A;  4C0Z A;  3OY9 A;  3L2V A;  3CXC A;  1M90 U;  4ELZ C;  4C8Q F;  2H3J A;  4RCC A;  3UT1 A;  3P8H A;  5C6S A;  2X4J A;  3M53 A;  1HK9 A;  2PU9 B;  5J39 A;  3GLX A;  5KE3 A;  1VUB A;  1G3W A;  4C0D C;  4A4E A;  4IKF A;  4ATO A;  4M77 A;  3QSU A;  4M7D C;  1YHQ T;  3OS1 A;  3RMQ A;  1YJW A;  3C94 A;  1VQ9 A;  1K73 U;  1UB4 A;  2VV5 A;  4PLI A;  5CO7 A;  5L8R E;  2BKD N;  2R5A A;  3HFN A;  5D6W A;  2GCX A;  1G3Y A;  5GMK m;  1NZ9 A;  2LVM A;  3OSV A;  3JB9 J;  1QVF A;  3CD6 T;  3O8V A;  5DY9 A;  4QVZ A;  4F7U F;  3BY7 A;  4JRI A;  2L5Q A;  4LDU A;  4MZT A;  4OVA A;  3CC2 T;  4YTL A;  2GQV A;  5FRN A;  3LLR A;  5FU7 C;  5FRO A;  1VQL A;  5GAN 2;  1YJN A;  4C8Q B;  1KG1 A;  3C12 A;  1VQM T;  2K5L A;  3CEY A;  3MP6 A;  3LYI A;  4M7A D;  1H3Z A;  4OGC A;  3OYM A;  3V8K A;  2FB7 A;  2E5Q A;  2VXF A;  4A53 A;  4ZGD B;  4M7A G;  4C92 D;  4C92 C;  5HK3 A;  4M77 D;  4C5G A;  5FU6 B;  1D3B B;  2FHD A;  3BFM A;  4M77 G;  3G6E T;  4HKE A;  1VQ5 T;  4O5V A;  3QJY A;  3CCJ A;  3GNG A;  5CKD A;  3X24 B;  3RKY A;  4DQ2 A;  4EDU A;  1YI2 T;  3PFS A;  2RK2 A;  2CZ1 B;  3M59 A;  3Q1J A;  5GAM h;  1LOJ A;  2CZ7 B;  2RD1 A;  3QO3 A;  1OZ2 A;  2JNG A;  4F7U B;  3OYJ A;  3PNW C;  5HKC A;  3L2R A;  3V8J A;  4RCB A;  1QP3 A;  3MET A;  2K57 A;  3DB4 A;  4E7I A;  4ZTJ A;  4XU0 A;  3VU3 C;  1VQ7 T;  3CCM A;  4L59 A;  3OMC A;  3QUI A;  1TH7 A;  4OF1 A;  4E7J A;  5LJ5 j;  4M7D F;  3RES A;  5M9O A;  1ZQ1 A;  3SWN C;  1YJ9 T;  2EJG A;  2I2L A;  3QXE B;  1K9M U;  4TVR A;  4C8Q A;  5KE2 A;  1N6A A;  3JB9 D;  5KCH A;  3HP9 A;  3JB9 G;  4L6V 5;  3FEO A;  4A4K A;  3GPL A;  1AHJ B;  1U8R A;  2HD0 A;  2L8D A;  5CK9 A;  5GAN g;  4OGE A;  4N0A C;  1UGP B;  2RI3 A;  4BDY A;  5HY6 A;  4NL3 A;  1WJQ A;  4FM4 B;  2RM4 A;  3OS2 A;  1I5L A;  1N27 A;  3QYG B;  3P8D A;  5CKE A;  3JCM V;  3JCM c;  2R57 A;  4ZGE B;  3HRT A;  4M7A F;  4PJO E;  2DD5 A;  2R5M A;  4ME7 A;  4C0D B;  4C92 F;  4LDX A;  1P92 A;  5D6X A;  4F7U A;  5GAN 8;  2QA4 T;  4M7D B;  1UEB A;  5GMK j;  2FL7 A;  3CC4 A;  4X34 A;  4BE2 A;  3R6O A;  3OW2 S;  5LJ5 e;  2XDP A;  1BKB A;  1ZBX A;  2GFA A;  1Y71 A;  3L2Z A;  4C8Q G;  3RER A;  3M4G A;  3L2W A;  2E41 A;  3HHT B;  4J7F A;  2IG0 A;  2KSS A;  3CCE T;  1G3T A;  2NLU A;  2E65 A;  2L3R A;  3TEE A;  3JCM g;  3URG A;  2PVO B;  1BIA A;  3C4S A;  4A4F A;  3UDC A;  2RHI A;  4II1 A;  4M75 C;  4PKC C;  2QQA A;  5FU7 B;  5AYF A;  4BI8 B;  1Q82 C;  4LD9 K;  1M5Q 1;  5LJ3 e;  2P0Q A;  5CKB A;  4DA4 A;  3DLM A;  3X25 B;  3DLL A;  3HPW A;  3V7S A;  5LJ5 d;  3JB9 I;  1I8F A;  2RJD A;  2E6N A;  3OB9 A;  1X01 A;  2LNV A;  4JDS A;  3VKI A;  4XTZ A;  4C92 B;  3M58 A;  1XOV A;  5I2S A;  1S72 T;  4KUD K;  3C95 A;  1YHQ A;  2EQU A;  3NTI A;  1VIF A;  3M57 A;  1Q81 C;  5LL6 S;  1W2B S;  3S3N A;  4OB0 B;  4QVD A;  3JB9 F;  3LH0 A;  3OYF A;  2ZGW A;  5GMK e;  4N4H A;  3T9N A;  2QQ9 A;  2ZPG B;  1ZHI A;  1M8V A;  3F70 A;  4CI0 C;  2HQE A;  3TRE A;  3BDU A;  3CCR T;  2RB6 A;  4M78 E;  3CC2 A;  3QG1 A;  4M7D A;  3A8M B;  1G5V A;  3E9F A;  3RKW A;  3CBM A;  1UGS B;  2LT1 A;  2XKO C;  2DZ9 A;  4XTX A;  2E70 A;  1I4K 1;  1UGQ B;  4N4G A;  3CPW A;  2VGM A;  2JTM A;  3S6W A;  5GAO q;  3RMS A;  1VQM A;  3OYK A;  3OYI A;  2CZ0 B;  3WVD B;  2VGN A;  2F5K A;  3OYL A;  1WGS A;  2RHX A;  2X4X A;  3I56 T;  2PQW A;  4M78 C;  3G6E A;  3ZEH A;  3MEW A;  2EIF A;  3L2Q A;  2LQ8 A;  3VYG A;  4QVC A;  2XID A;  4BE0 A;  1VQ5 A;  5GAM j;  2XK0 A;  1NPP A;  1N9S A;  4BI3 A;  1X6O A;  2RH2 A;  1YI2 A;  5GAN 6;  4RMO A;  4M7A A;  2RA2 A;  2B8A A;  3GNF B;  2YRV A;  5LJ5 f;  1VQO T;  3QJ6 A;  4IUR A;  4C92 A;  3HL8 A;  1BI2 A;  4M7D D;  5A0G A;  2RHU A;  4EPC A;  2QXF A;  4M75 F;  4JRQ A;  2XD0 A;  3OYY A;  4M7D G;  2M1H A;  4E7H A;  3FB9 A;  5GAN 5;  4XU3 A;  2KMT A;  3CBO A;  4JLI A;  5J3B A;  5GAN h;  1VQ6 A;  4GLK A;  3JCM W;  1VQ7 A;  1O9S A;  2DKG A;  2DTO A;  4MDW A;  4HT9 A;  5LJ3 f;  2XDB A;  2K3X A;  2D0Q B;  2D9T A;  2RHY A;  1LNX A;  4MZM A;  4X9C A;  1VQ8 A;  2P0P A;  1YJ9 A;  4IUV A;  4Y91 A;  1VIE A;  4B9W A;  4J6W A;  4RKU E;  1K8A C;  2A7Y A;  3A8L B;  3M9Q A;  3EFR A;  2OTJ A;  1WPY A;  3VJP A;  4PJO C;  5GAM e;  3OYD A;  2X35 A;  4C92 G;  4Q5W A;  3GOX A;  3RKX A;  1BI1 A;  4XTY A;  5CCA A;  3L1A A;  3NTK A;  2VC8 A;  4M75 B;  4UC4 A;  1KHC A;  4EMK C;  5GAO n;  2LCC A;  2LDM A;  2C06 A;  1M1G A;  3E9G A;  3JCM h;  2ZPB B;  2VXE A;  4NOY A;  1BYM A;  2K2V A;  3JRZ A;  4HCB A;  4M77 E;  1WNL A;  5CQY A;  5LJ5 g;  5CR2 A;  3INZ A;  3SFM A;  1Q7Y C;  1WQ7 A;  3MCA B;  3JCM b;  4ZGJ B;  2DIQ A;  3FC3 A;  3MO8 A;  3KUF A;  5GAM d;  2CKK A;  4N0A A;  5KH6 A;  2LX9 A;  2F5T X;  3OYH A;  4J6X A;  2EFI A;  3SDZ A;  1JB0 E;  4RG2 A;  4BB7 A;  1G3S A;  1U1S A;  4PL6 A;  5GAO l;  2WSF E;  3CCE A;  4BE1 A;  2M0O A;  2VYT A;  1QP2 A;  3M5A A;  4LDW A;  4WF2 A;  3WVE B;  3QDR B;  3J80 E;  2MAM A;  1N8R C;  1VQN T;  3UWN A;  3OA6 A;  1IZ6 A;  4BDZ A;  3I55 T;  2HAX A;  2LQK A;  5CAI A;  1QVG S;  2RO0 A;  1BI0 A;  2ZCF B;  4C5H A;  2EAY A;  2PUK B;  1KQ1 A;  5I21 A;  2EKO A;  4OB3 B;  2XI9 A;  5LJ3 j;  1KHI A;  5CKF A;  1S72 A;  5D6Y A;  4BUG A;  3TCJ A;  1D3B A;  2LTO A;  2O4X B;  1XQH A;  4M75 A;  2YLB A;  5FRM A;  4J7I A;  4ZTF A;  1U1T A;  1QVG A;  1NJI C;  2YLC A;  2QQB A;  2XU8 A;  4QW2 A;  2DO3 A;  4FSX A;  3G4S T;  3GF5 A;  4KUI A;  2BIV A;  3OBW A;  4QQD A;  3CBP A;  2EQJ A;  1V29 B;  4PJO F;  2VUB A;  4IUP A;  4D6W A;  4EMH A;  2IVW A;  3ER0 A;  4XTW A;  4P5N A;  5EG2 A;  3CCR A;  1JRI A;  3CCS T;  4JRP A;  1EIF A;  1QVP A;  2MWP A;  4KBM B;  1O75 A;  2K5I A;  5CQX A;  5GAM f;  1X75 C;  3CCV T;  2WAC A;  3L42 A;  1YIT T;  2OTL T;  2DVE A;  2G3R A;  1XNI A;  3I56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...