2FHDA

Crystal structure of crb2 tandem tudor domains
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
150
structure length
150
Chain Sequence
HMSRRSFKNRVLAFFKGYPSFYYPATLVAPVHSAVTSSIMYKVQFDDATMSTVNSNQIKRFFLKKGDVVQSTRLGKIKHTVVKTFRSTNEQLSLIAVDALNNDMVILAHGEIEVTVPISTIYVAPVNIRRFQGRDLSFSTLKDMKFEETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the methylation state-specific recognition of histone H4-K20 by 53BP1 and Crb2 in DNA repair.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
molecule keywords DNA repair protein rhp9/CRB2
total genus 29
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18115 Tudor_3 DNA repair protein Crb2 Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fhdA01
2.30.30.810 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fhdA02
3MP6A 3OYJA 1XNIA 4PL6A 1WJQA 4QW2A 3KUFA 2RI3A 1MHNA 1OZ2A 4ZTFA 4E7KA 5J39A 4Z02A 1N27A 2EQJA 4B9WA 2RHUA 4A4EA 3L2RA 3S3NA 3NTKA 3S3OA 1H3ZA 2GFAA 2LCCA 3ASKA 3O8VA 3OYGA 2QQRA 1SSFA 3OYIA 3S3MA 3MEUA 2X4WA 3OYEA 2HQXA 3OYNA 4UC4A 2K3XA 2JTFA 3OS2A 2RHZA 3OS1A 4EDUA 1WJSA 4C5GA 3ME9A 3H6ZA 4II1A 2M1HA 3OYKA 5D6WA 3S6WA 3NTIA 2R57A 2FHDA 2EQMA 2RHXA 1KHCA 2X35A 3OMCA 4QVZA 4A4HA 3OYMA 3UT1A 4GY5A 2GFUA 3P8HA 2R5AA 1RI0A 4BDZA 4NS5A 1WJRA 3MP8A 3Q1JA 4Q5WA 5KCHA 2CKKA 2LDMA 2RJFA 3PFSA 2YRVA 3DLMA 4IURA 3FEOA 4L59A 4A4FA 2LRQA 2P0KA 5M9OA 4BACA 2D9TA 5IAYA 4ZTJA 2EFIA 5FROA 4QQGA 3OYHA 4N4GA 2PQWA 2XK0A 4N4IA 3OA6A 3OQ5A 4IUQA 4FL6A 4BD3A 3H8ZA 4C5HA 2RHIA 3EAEA 3E9FA 3PMIA 3QJ6A 5D6XA 5KE2A 2L89A 3CEYA 4LD6A 1OYXA 3LX7A 3BDLA 2WACA 5FRNA 3LLRA 4RG2A 3M9QA 3L2WA 2EQUA 3OS0A 3LGFA 5D6YA 3MO8A 2IG0A 3GOXA 3OYDA 1WGSA 3PNWC 3F70A 3MEAA 3UWNA 5C6SA 5KE3A 4IUUA 4BE1A 3OB9A 4FU6A 3QIIA 3L42A 2XDPA 2RO0A 2X4YA 2EKOA 2GF7A 5J26A 2M16A 2QQSA 2MWOA 3SD4A 5FRMA 5CIUA 3FC3A 4OVAA 4PLLA 2DIQA 2BIVA 3MEWA 4IKFA 4HCZA 2R58A 2LVMA 2RJEA 4IUTA 4IUVA 4A4GA 4E7HA 3FLGA 4E7IA 3PMTA 3MEVA 3DB3A 3OYFA 2DAQA 2RHYA 2RI2A 3LYIA 3OYCA 2L8DA 2VYTA 5C0MA 5KH6A 3OYAA 4BE2A 2EQKA 4CRIA 3META 2DIGA 3QKJA 3DB4A 3L2UA 3QBYA 4BDYA 3ZEHA 2E5QA 4C5IA 2RJCA 4B9XA 2RJDA 2X4XA 2MWPA 2L3RA 2LTOA 3OYBA 3LGLA 4X34A 4N4HA 4PLIA 2O4XB 3MP1A 3C4SA 2NLUA 3FDRA 1OZ3A 3L2QA 2BKDN 4C5EA 4QQDA 2G3RA 3E9GA 2K3YA 5KCOA 4BE0A 1G5VA 3OY9A 2BUDA 2HQEA 3NTHA 4QQ6A 2F5KA 2E6NA 4E7LA 3LH0A 1OI1A 4E7JA 4IUPA 2R5MA 2O4XA 3OMGA 3L2VA 3OYLA 2M0OA 5IN1A 3P8DA 2B8AA 2JZ2A 2RI5A
chains in the Genus database with same CATH superfamily
1UGPB 4QW2A 1R0BG 4OB3B 4Z02A 3PIOA 2DETA 2RHUA 2FPEA 3L2RA 1HD3A 2GFAA 3J7AF 2ROLA 2LCLA 1WHMA 3G1JA 3NGPA 4P5NA 1D1CA 1UGVA 3H9NA 1WJSA 4C92C 3QZ5B 3L2ZA 4R56A 2VASA 5GAOl 4LXCA 2R57A 4OMFB 2EQMA 3CCLQ 1KHCA 3OYMA 4JJDA 1MNDA 2K2VA 1VQ6Q 3C95A 1IB8A 4HKEA 1WYXA 2JVVA 4E7IA 2F5TX 3FEOA 3U23A 2ENMA 3TVTA 3DLLA 1X6GA 4WCIA 1G2BA 2ESWA 4FM4B 2LMJA 4RG2A 5LJ5h 3CMEQ 3OS0A 1VQ7A 1WQ7A 4JLGA 2MYSA 2CZ7B 4M7AD 4E2FB 1Q95G 1TTHB 1PNJA 2QYZA 1U3OA 1I5OB 4DBQA 2DERA 2LJ3A 3L1AA 2CZ0B 4B6MA 1H3HA 1D1BA 2EKOA 2RM4A 1YJWT 1K73R 1VYVA 2A28A 2DIQA 1FYNA 2VC8A 1NYGA 1RAIB 5D7UA 2AIRB 2EQKA 2RB6A 4ANJA 3G4ST 1NG2A 2LX7A 2I0NA 2ROTA 1MMGA 2C0IA 2I2LA 4LN2A 3LGLA 3HRTA 2A36A 2FL7A 1KC8C 2YT6A 1Y96B 5HKCA 1QVPA 2K3YA 2QQ9A 4OMPA 5KCOA 2BUDA 4J9HA 3ER0A 2X9HA 3G7ZA 1SRMA 4C0FA 1OI1A 4FT2A 1A0NB 1UGRB 2DJZA 5DLOA 2MOXA 2LC4A 2JZ2A 3QYGB 5CQYA 3EG3A 1YITQ 1GCQA 1N6AA 4HCKA 2E12A 1RUWA 2BE7D 2ZAEA 2EQJA 5GAN7 3NTKA 1M3CA 2GGRA 2CUDA 2AK5A 3OYIA 1VQ8A 1SF9A 2PTKA 4F7UA 2JTFA 1PCXA 1FMKA 2DL8A 2RN8A 4X1VA 2FPFA 5I2MA 1AEYA 4F04B 2NUPB 5D6WA 5LJ5g 1VA7A 3UF4A 2D8HA 2OX7A 2JOYA 2X4JA 4C92F 3R6OA 8AT1B 4JJCA 1G8XA 2FYKA 1U1SA 3QYHB 1NPRA 1B34A 2ZPBB 4M75B 1TH7A 1AHJB 1YI2A 1Y0MA 1BKBA 4M7AA 4QKUA 3PGGA 3CMAA 2CZ1B 2WACA 5FRNA 4QVDA 2LZ6B 3SDZA 3L2WA 1VQOA 5GAOq 1BCOA 2YHTA 3OBWA 4M78C 3GOXA 3OW2P 1VYTA 2F1LA 8ATCB 4JRPA 5GAMf 3CCJA 4R0KA 4C8QD 4C0DC 2QQSA 1XQHA 1VQ8T 3LYIA 1OU9A 1X2QA 4J9GA 1VIFA 1S72T 4PJOD 4F14A 1JJ2A 1SHFA 1Y07A 1VQPT 3G4SA 2KI7A 3D7SB 2L5QA 4PNOA 1QCFA 2DK3A 2QQAA 2GTJA 4LDUA 2DZ9A 2M0YA 3EGDB 1X01A 2WSEE 4EPCA 1KD1C 2E6NA 1TOVA 2HKQB 2PUOB 4J9FA 5GANj 1M30A 2Z0WA 1Y7XA 3OYJA 2EYWA 1LVKA 5DLQE 2HSEB 4A4EA 5KYXB 1YJ9Q 1H3ZA 4JUVA 4OMQA 2HKNA 4OGEA 2MCNA 2OI3A 3BY7A 1PD1A 2DEUA 4F7UF 3ZL7C 2YRCA 5CQXA 4OGCA 2GNCA 5CKBA 1BB9A 2M1HA 3OYKA 2V8IA 3UA7A 4HA8A 3UT1A 1YBYA 2CGHA 2RK2A 4KRTA 1HSQA 5LJ5e 3MJXA 4M78G 1AD5A 2F2XA 4HCCA 1RADB 3JB9G 3REBB 5GAMd 2K9GA 1ZQ1A 4IUQA 1C0MA 3NPFA 1I5LA 2EYZA 3SWNC 2KYBA 3CCUA 2EQUA 3CC2A 1LNXA 1M90R 1O9SA 1K8AU 3OYDA 1B07A 2OAWA 2JS0A 2BE9B 3UWNA 4AFUC 2XD0A 2LT4A 2K5IA 2O9SA 3OB9A 2QEXQ 3JCMe 1I8FA 3ULRB 1CKAA 5L8RE 1HJDA 2YWWA 4HCZA 2J6FA 2XKOC 2DF6A 4QT7A 2DIGA 2DJQA 1FX7A 4BDYA 1R0CB 2ED0A 4ELYC 2X4XA 4PKCC 2ECZA 2EJ9A 3LH5A 4AT1B 3C4SA 5FLXE 5GMKm 1OZ3A 4JRIA 2L3SA 1RAHB 4BE0A 1MUZA 1N5ZA 2F5KA 4NOYA 2QI2A 1GXIE 1VQ4T 3NMZC 3LWIA 4KH1B 4MDXA 3EH1A 3X25B 2O31A 1T3LA 1XNIA 2EJGA 1RL2A 1UFFA 3S3NA 1G3YA 4FW2A 1KD1R 2GQVA 1EFNA 4J6XA 2ZZDA 5GAMj 1M1GA 3ME9A 1M1KC 4II1A 4F7UE 4M75G 3CC4A 2QASA 3VRZA 2R5AA 3VS5A 1RAGB 2CKKA 2YRVA 1Q82R 3EG2A 4BACA 5HCKA 3CCEQ 3M55A 2X3WD 2MMPA 5KYUA 2SRCA 3G6EA 2MAMA 3VRYA 1WI7A 4FCYA 2RHIA 3BE3A 5D6XA 3ZFJA 1Z9ZA 4IIMA 2H3EB 4M7AG 1LPLA 2FRYA 4MZMA 1BYMA 4FSXA 4AG2C 5CK9A 1TXQA 1K73U 3CBMA 2K6DA 2OTLA 1PG5B 2EYQA 4PK4A 5FU6C 4D8KA 4DBRA 2DKGA 3LW5E 3MEWA 2LVMA 2COYA 4IUVA 3RKXA 2ED1A 5IHKA 3BW1A 2ZPEB 1MMDA 2QA4T 4Y92A 3META 3QKJA 2C06A 4TVRA 2JUFA 1OOTA 3OW2S 2H3JA 1PKTA 5EG2A 4X34A 5AYFA 3I55Q 2G6FX 1TSFA 3JB9D 2BKDN 4C5EA 2D6FA 4N0AC 2RF0A 3OY9A 1UUEA 1PSEA 4QQ6A 1Q81R 1S72Q 1N8RC 4E7JA 2RA2A 2VWFA 3FJPA 2O4XA 1K9MR 1IHVA 3CD6T 1K76A 5IN1A 2FB7A 1I07A 2KT1A 2RI3A 2LCSA 2A3LA 4DA4A 1PHTA 1NLOC 3CCUQ 2MF2A 4E7ZA 1OQKA 1D0XA 1E7OA 5GAN2 1NPPA 3MEUA 2ABLA 4JRKA 1AVZC 2FVUA 2HQXA 2K3XA 2L0AA 1M3BA 1WHJA 3C0CA 3S6WA 2FHDA 1OX9A 3URGA 4DQ2A 5CVIA 4GY5A 2DTIA 1BU1A 1BI2A 1WHGA 3P8HA 4LUDA 4RTXA 5GANf 1AZGB 2KT8A 1KJWA 2MK5A 4A53A 1M1KR 4XTUA 2B86A 2F2VA 1EX4A 1UB4A 2J6KA 5CAIA 2RQUA 3PVLA 1QVGA 4XAXB 3JSCA 4PJOC 1QMCA 4Y91A 2YUQA 4XTXA 3I56A 2E64A 4Z8AA 5KYYA 3CCJT 1TUGB 4C8QG 3I5SA 4LNPA 2M16A 4ME7A 4OF1A 4DBHA 3TEEA 4IKFA 2KBTA 3G6EQ 5AT1B 1VQ6A 3GNGA 4CRIA 1IXDA 4J9DA 2KR3A 5IT9E 1GL5A 3H0IA 4ELZC 2O88A 1WX6A 1VYUA 3VS4A 4C0GA 4RTUA 2L2PA 3M4GA 3R6NA 2COWA 7AT1B 1Q86R 4M7DD 4QQDA 4A4KA 3SWNA 1W2BA 1P92A 3LH0A 3V8JA 1GRIA 1E6GA 3M53A 2CP6A 2XI9A 1S1NA 3X20B 1D0ZA 3TU4K 3BDUA 3JB9J 4PL6A 1AOJA 3KUFA 1YJ9A 1G3TA 2BZYA 4Y28E 3V7SA 1RACB 4RTVA 4BY6C 3ASKA 5HK0A 3OYGA 1Q81C 1N8RR 1X6OA 1YP5A 2CT4A 2CH4A 2FZGB 4RUGA 2DPPB 2RK1A 1WHHA 2YUOA 5A0GA 2DMOA 2KMTA 2LP5A 3VV0A 4EMKB 3CCQT 5GAN8 2EWNA 4HXJA 1RAEB 2COZA 3EGXB 4NS5A 4BDZA 3JCMX 3MP8A 3PFSA 4C8QF 2LRQA 2EFIA 3VJPA 2XDBA 4N4GA 2YUPA 5IHNA 3HFOA 3JCMd 4E47A 1K73C 4M7DE 1NJIC 1NZ9A 3M59A 2RQRA 3G71A 3LGFA 5LJ3d 2CSIA 1AT1B 2EIFA 1WIEA 1VQMT 1KSWA 3MEAA 4LD9K 1M2VA 1YWPA 1U5SA 1QVFS 2MWOA 1K4US 3FC3A 2JMCA 3V7RA 1KC8R 3H41A 3MEVA 3E2UA 4KBMB 1XJWB 1AWOA 4BE2A 2VXFA 3V8KA 1AWXA 2L3RA 2DVJA 1M3AA 3CXCS 1GCQC 2QXFA 1PRLC 4WF2A 3JV3A 1M9SA 2IVWA 2MI6A 3HKSA 1MV0B 6AT1B 5GMKj 1CKBA 3CCRQ 1IGQA 5GMKl 5GANg 2ZPIB 1IREB 3CCLA 4PFPA 1KD1U 1Q86C 3JB9F 1JXMA 4PJJA 5GAOp 1NYFA 1W1FA 3UDCA 1ACMB 4MZPA 4F16A 4CC7A 3I9QA 3VKIA 3EGXA 3M5AA 2AZVA 3CC4T 2V8JA 3CCUT 1Q7YR 2NUZA 2HCKA 2LQWA 3RUXA 1PKSA 2NWMA 4J6YA 2E3HA 3EFRA 4L59A 3UATA 2D9TA 4QQGA 3PT9A 3M0TA 4RTTA 1BBZA 2BZ8A 3J80E 4FL6A 3CCSA 3CCVT 1SG5A 3CEYA 2EQIA 1K9MU 2HL5C 3BDLA 2GBQA 1K8AC 2RH2A 4C8QB 5D6YA 4D8DA 4DBFA 3CXCP 1PD0A 2P4RA 1YJNA 2C0OA 2ZPGB 3OSSC 4PJOB 3QIIA 5FWBA 2NUTB 5FRMA 4PFOA 2DXBA 4PJOE 2QGFB 1MGQA 5LJ3e 2L8DA 1WQWA 3OYAA 3A8OB 4DEYA 3QBYA 2GCXA 2KVQG 4C5IA 3CCJQ 2EGEA 3CCRA 1GCPA 2V8KA 4M77D 2K57A 4J83A 3RKYA 5LJ3g 4E6RA 1VQLQ 3G6ET 3PE0A 3L2QA 1JU5C 1WXUA 3OBYA 4KGZB 2OTJQ 3WVEB 3CD6A 5IXFA 3JCMc 3OMGA 1SEMA 1C6VX 2A37A 3L2VA 3CXCA 2JN0A 3M0PA 2JJ9A 3P8DA 4M75D 1QWEA 1PWTA 1YCYA 4M7DC 1CSKA 3FLGA 4J7IA 4AFQC 1W6XA 3JCMP 3M0SA 2BZXA 2PUKB 3QWXX 3CCLT 4EMGA 1HXDA 2LCCA 1X43A 1VQOQ 3JCMg 2XU8A 3S3MA 2RQTA 2K3BA 4C92G 4C5GA 3NFCA 1SHGA 2EYXA 1GBQA 2F69A 5IHIA 5GJVB 3OMCA 4QVZA 1QWFA 2DILA 3H0FA 2KQWA 2ZPHB 3UA6A 3QJYA 3X28B 4DEXA 5GAN4 3HSBA 3Q1JA 1M90C 1HK9A 3VS1A 5KYXA 3CC7Q 2PQWA 2XK0A 2EGAA 4N4IA 1WXTA 1YHQQ 1VQLA 1YCSB 2QGGA 2RQWA 3KXTA 4M77E 1WA7A 3GIBA 4CC3A 3RIRA 3LX7A 1H8KA 1D09B 4M7AC 1VQPA 2EAYA 3C94A 2IG0A 2NUTA 1VQNA 2XMFA 2RPNA 4IUUA 1BIBA 5L23A 2BTTA 3RMSA 3SWNB 4Z88A 2VVKA 1K8AR 1YHQA 5GAMg 4FW1A 2RHYA 2WSFE 1M2OA 4XK8E 3OYCA 2CT3A 3QO3A 2K7AA 3ZEHA 2EGCA 2J6OA 3CCEA 4AG1C 2D0NA 3X24B 2RJDA 1YITT 3M54A 2W0ZA 1W2BS 1PC0A 2LJ0A 3FDRA 3VYHB 2K4YA 3JCMb 1M1FA 5GAOn 4J9CA 3EHRA 4IUPA 5GJWB 4EMKA 2FO0A 3FB9A 3JCMV 1QVGS 5GAN5 2O9VA 1FWZA 1FMWA 1N27A 1LCKA 2ATCB 4LDYA 4OB2B 5IXBA 1NLPC 2DFUA 2LT1A 3CBOA 4GLMA 4UC4A 3OS1A 1JB0E 2CREA 1YHQT 2JMAA 4RCCA 2FPDA 2L3PA 2AZSA 1HYOA 2AHJB 3CC2T 1F1BB 2GFUA 2HNIA 2AT1B 5GANd 5HY6A 3QXEB 1EIFA 3QHSA 2VUBA 5IH2A 4Q5WA 1M2VB 1ZSZB 2LNHB 5IAYA 2KRMA 2HMAA 2L3QA 4M7AF 4JZ3A 3TCJA 1ZHIA 2FEIA 3KBGA 2L89A 4KGXB 2P0QA 4MMLA 3MKDA 1KG1A 4PJOG 1QKWA 3FRNA 1SRLA 3MO8A 2JT4A 1K0SA 3RBBB 3HP9A 1U06A 5CCAA 2RQVA 4FYVB 4J9EA 1VQPQ 3AT1B 3F70A 4V2SA 3E1SA 2OJ2A 2YLCA 1WXBA 1WHKA 2GF7A 1IRXA 2DLPA 1KIKA 1JJ2P 2PNIA 2KE9A 4O5VA 1NEGA 4J8OA 1X75C 4BI3A 1JXOA 1K9MC 1J3TA 4D6WA 2CYZB 5I21A 4VUBA 1VQNQ 4N4HA 1LOJA 3HTRA 3VS2A 2CH4W 2DTOA 1JJ2S 2A7YA 1VQ9T 2CZ6B 3NTHA 5GAOr 3UPUA 1KQSA 1M4ZA 3JCMf 3G71T 4FYXB 3HFNA 3RNJA 1YFNA 2P0PA 4IIOA 2DX1A 4JDSA 3VU3C 3WVDB 3CCQQ 2JXBA 1VIEA 3EFOB 2OTJT 4M7AE 4OB0B 2QQRA 3OS2A 4BY6B 2HSPA 1LJOA 2PZ1A 2KDSA 3TQ7P 4M77G 3M0UA 2AKLA 2RHXA 1WZOA 2X35A 2EBPA 4A4HA 5GAN3 1JEGA 4AFZC 1VQOT 5LJ5j 3QWYA 2CP5A 1RI0A 1VQMA 2EVRA 3QPHA 1ZA1B 3CCVA 1D3BB 1M8MA 4JLIA 4LD6A 3CCMQ 5GANe 3LWHA 1YIJA 5LL6S 4ZN3A 1OULA 1EZZB 1XTDA 1UHFA 1PRMC 4RTZA 1G83A 3QG1A 3A5ZB 3M0QA 2E4HA 1MMAA 2MIOA 2QDYB 2WSCE 1VQ7Q 2QK0A 5C0MA 1ZUYA 1QCOA 2KSSA 3CCRT 1YI2Q 1Y96A 5FU7C 4B9XA 2FZKB 1V29B 4Z89A 2ZCFB 4OMLA 1QQJA 2DYIA 1N9RA 5KYYB 1I81A 1RI9A 1IHWA 1TUDA 1VQ9A 2J7IA 5A2QE 3CPWS 1E6HA 3G4SQ 4J7FA 2QA4A 2P84A 2X3XD 2B8AA 2CP7A 3EFOA 4XTVA 3CC4Q 4ORZA 3EHQA 4F7UB 1Z9QA 1KQSS 3EFSA 2H8HA 4FSSA 3OSVA 3DKMA 2VV5A 4ZGDB 4C92D 2JM8A 5ECAA 2LQ8A 2HD0A 4LUEA 3P8BB 3M57A 3VUBA 3JRZA 3H6ZA 2DXUA 1UJYA 2OAUA 3NTIA 5GANh 3MHXA 1UEBA 5GMKh 4HT8A 3NHNA 4M7DG 3CCVQ 1NJIR 1UGQB 3BFMA 4KUDK 1UGSB 1WFWA 2RJFA 3DLMA 4A4FA 3IQLA 2E70A 3CPFA 1VQ5Q 2HAXA 1YJNT 4EMKC 4AFSC 2HL3A 1TU0B 4M75E 2HQHA 5I22A 1T0HA 2CUBA 1ZSZC 4PJLA 3QJ6A 3E9FA 2RNAA 1G3SA 3QDFA 1OYXA 3CQTA 2J05A 4J9BA 2KROA 2JTEA 3VS3A 1IGUA 2KY9A 5KYNA 2GQIA 1WGSA 2DE0X 4JJBA 5C6SA 1X6BA 2DRMA 2PU9B 4C92A 1RABB 3L42A 2KAFA 2DRKA 3SFMA 1K1ZA 4OVAA 4IUTA 1SPKA 2HBPA 4PJOF 1X69A 1U8RA 2DVEA 1GFCA 1KC8U 3CD6Q 2HEQA 3DB4A 3L2UA 2FRWA 2RJCA 4MDWA 3OS5A 1W4SA 2EJFA 1RLQC 2VXEA 4M77A 3MP1A 3RDVA 5LJ3h 1OEBA 3OW2A 1Y71A 2EKHA 2DNUA 1K0XA 2DL7A 1UG1A 1XOVA 3VS6A 1VQNT 3CPWP 4RCBA 2VB6A 3CBPA 4B9WA 2V26A 1VQ9Q 2HZYA 4JRQA 1Q7YC 2GTOA 1TS9A 4ESRA 2QG9B 3GF5A 1M5Q1 2EPDA 4C8QC 3GLXA 1DJ7B 1ZBJA 1PM3A 1ZBXA 1YJ9T 2M51A 2LJ1A 1QW1A 4JS4A 1QP2A 1QP3A 5KCHA 1BIAA 2LDMA 1VQKT 1KFZA 1YWOA 2E5KA 4CC2A 1WLPB 5FROA 5FW9A 2LQKA 1VUBA 3OQ5A 1QLYA 5I2SA 1AWWA 3A8MB 2K79A 1YIJQ 3EG9A 3EG0A 1QKXA 3M9QA 4J5YA 4C92B 3I56Q 3A8GB 2D8JA 3WXMB 1ZA2B 5KE3A 3H0HA 2X4YA 1UDLA 4PLLA 2BIVA 3CCMT 2CP2A 4A4GA 4M78F 4O6JA 1WHLA 2E5QA 2RMOA 4BUGA 2QEXT 2EW3A 1UHCA 4XTWA 3CMAQ 1I1JA 3MPUB 4EIKA 4K11A 2XG8D 2JW4A 5CKFA 1KK7A 2XHCA 2DM1A 2QQBA 4EMHA 5GMKi 2NUPA 1KQ1A 5CR2A 3HPWA 2IPOB 1SKUB 2M0OA 3VS0A 3SHWA 1D0YA 4MZTA 1TWBA 1WJQA 2CDTA 3A8HB 1N8RU 3M56A 4ZTFA 2DXTA 4OMOA 3CC2Q 4PJMA 1B34B 1R8OB 4M75A 1RAAB 3SB2A 4M7DF 3I35A 2A08A 2O2OA 4HT9A 3N5BB 1QVGP 1SSFA 4JS5A 1OV3A 5FWCA 4M7DB 3SEMA 2DTHA 2QAZA 4M7AB 5GAMe 1FXXA 2K5LA 2ZPFB 1TUCA 1UE9A 4CI0C 2PVDB 4HVWA 2CS7A 3V7CA 4OP0A 1G3WA 1NBEB 2VGMA 2CP0A 3I56T 3HHTB 5M9OA 1VQKA 5LJ5f 3OYHA 4OMNA 3OA6A 1K9AA 3X26B 3E19A 3M0RA 1JRIA 3RESA 2KK4A 1V1CA 1VQ6T 4C0DB 4JPBW 2IIMA 5CO7A 2KRNA 1JQQA 2DL3A 2KRSA 1NM7A 2CSQA 1VQ5T 3C12A 2OTJA 4C92E 2QDLA 3QSUA 3EGDA 4M77F 3A8LB 5HK3A 2XDPA 2RO0A 5DM7R 1AWJA 5CIUA 3V8LA 3CCST 4E7HA 4X9DA 2XIDA 4L6V5 2KYMA 3JCMJ 5KH6A 1MV3A 1V76A 2PVGB 1PSFA 3CPWA 4OMMA 1YJWQ 4FIBA 1YJWA 2O4XB 2V1QA 1Q7YU 1N9SA 1U1TA 2G3RA 1OPLA 4JJNK 1Y57A 2R5MA 5J3BA 4X9CA 4FT4A 3GBQA 4QVCA 1T3SA 4RG8A 3I55T 5J39A 4M7DA 1Q82U 2K2MA 2E41A 3GP8A 4A63B 4N0AA 3T9NA 4HVVA 1QVFA 1BK2A 4LE9A 1WPYA 2NYSA 2X51A 4J9IA 2FG0A 3MCAB 1BI1A 1W70A 2KGTA 4BB7A 2D0QB 4RMOA 3VS7A 1I4K1 1MNEA 1OX8A 2OTLT 3HL8A 2DBKA 4BD3A 3RR6A 3H8ZA 3JCMQ 4RTWA 4ZNXA 3PMIA 4M78B 1VOMA 3JB9I 2JS2A 4A54A 3LLRA 3QZ9B 1VQ7T 5DY9A 1VQKQ 4CC4B 4M77B 1YITA 2E1HA 1WDXA 4C8QA 1YI2T 2K5FA 2Y4YA 1ZSZA 2YXYA 2DL5A 4DOWA 1VQLT 2C0TA 5LJ3j 2D1XA 2DAQA 4M78D 1KQ2A 4PJOA 4OB1B 2YUNA 2VYTA 4KT0E 4HVUA 1UECA 3CMEA 1BI0A 2M02A 2E10A 3OYBA 1QVFP 4L5GA 3TSWA 2AKKA 2NLUA 3VYGA 1B7TA 2HQEA 2XICA 1H641 4XTYA 4M4ZA 3JCMW 5KYWB 4LDXA 3RMQA 3OYLA 3QDRB 4E7SA 3MP6A 2HBWA 1I0CA 1TG0A 5GAMh 3CMAT 1AZEA 1MHNA 1OZ2A 3HRUA 3I55A 2VKNA 1GBRA 1T0JA 2HDAA 5GAN6 3THKA 9ATCB 2O01E 4C0ZA 3VUZA 5KYUB 1UJ0A 1ABQA 2X4WA 5CKDA 4BI8B 3OYEA 4KUIA 3OYNA 2M9UA 2RHZA 1YJNQ 4EDUA 3CC7T 2JM9A 3EG9B 1ZUKA 2DD4A 1ARKA 1BCMA 2DXCA 5EC7A 4RTYA 3KFVA 1S72A 2ZGWA 3A1PA 1Q86U 1MMNA 3EGUA 3CMET 1M8VA 1WJRA 4M78E 2QTXA 1C1AA 4IURA 4ZTJA 4M78A 4RKUE 2DZCA 4F7UG 5GMKe 5FU7B 4J6WA 3INZA 2P4TA 2VGNA 4BI4A 4HCBA 1OU8A 3I5RA 1B3QA 1Q82C 1GFDA 4GBQA 4XTZA 2DL4A 3FIFA 3HRSA 1M1KU 1H92A 2DYBA 5J26A 3RERA 4NL2A 1FMVA 3OYYA 4XU1A 4XU2A 2KNBB 2LNVA 5A0LA 4XU0A 2RI2A 2E6ZA 3RKWA 1D3BA 4KH0B 2W10A 1VQMQ 5LJ3f 3QUIA 2LQNA 1W2BP 3FJ5A 1ABOA 1IZ6A 4PLIA 5KYWA 1O75A 4GLKA 5GAOm 4MMKA 3CCSQ 2KXDA 1KQSP 2E65A 3M4YA 1YNZA 3M58A 1YN8A 2YLBA 4XU3A 1X2KA 1ZLMA 3A98A 1M27C 2KEAA 4LDVA 2RI5A 3CCQA 4JZ4A 5A0DA 2DEQA 1ZX6A 4E7KA 3PIPA 4ZGEB 2DO3A 2EYYA 1IO6A 3EH2A 3S3OA 1JO8A 4YTLA 3O8VA 1X27A 4FYWB 1ZUUA 2DA9A 4R55A 3CCMA 1VQ4Q 2MPXC 2RD1A 2SEMA 2YSQA 2Y90A 3CC7A 3AHUA 4NL3A 3REAB 4KGVB 1JBMA 4XQ3A 1Q81U 4LDWA 4M75C 4ZGJB 5I11A 2QEXA 1YIJT 4PJNA 1D1AA 1NEBA 2LX9A 1KHIA 2F2WA 2Y4XA 2QTVA 2XDDA 3GPLA 4KULA 2P0KA 4M75F 2A0FB 3EG1A 4C5HA 3EAEA 3JB9H 5KE2A 4PFZA 1VQ8Q 4ATOA 1UTIA 4ZN1A 1R77A 1NE8A 2V1RA 1OPKA 1RLPC 4WTOB 1VQ5A 2J06A 2YDLA 3JCMh 3PNWC 5FU6B 2OTLQ 5CKEA 3CCET 2JTMA 3PTAA 4BE1A 4FU6A 2KXCA 3GNFB 3SD4A 3TSZA 3PVQA 2R58A 2RJEA 4M77C 3PMTA 3DB3A 3OYFA 2E3IA 5CKHA 1QCNA 2YRDA 2DBMA 4DOVA 3G71Q 1WNLA 2MWPA 1SSHA 2LTOA 2FZCB 4FYYB 2DD5A 1ZSGA 2JNGA 1BI3A 4AMCA 2CP3A 3O5ZA 1M90U 3E9GA 5LJ5d 2PVOB 1G5VA 4F17A 2QA4Q 4E7LA 3JAME 1NJIU 1VQ4A 3TREA 3J81E 3ZBDA 1RAFB 4C8QE
chains in the Genus database with same CATH topology
1UGPB 2FB7A 4MZTA 1WJQA 4QW2A 1FWZA 3A8HB 2RI3A 1N8RU 3M56A 4OB3B 4ZTFA 2A3LA 2DXTA 1N27A 4Z02A 3PIOA 4DA4A 2RHUA 3L2RA 1B34B 1R8OB 4M75A 3SB2A 4LDYA 4M7DF 2GFAA 2MF2A 4OB2B 3J7AF 4HT9A 3N5BB 2LCLA 1SSFA 4JS5A 5GAN2 1NPPA 3MEUA 4M7DB 2LT1A 3CBOA 4JRKA 2FVUA 2HQXA 4UC4A 2K3XA 4P5NA 2DTHA 4M7AB 3OS1A 1WJSA 5GAMe 4C92C 3QZ5B 1FXXA 1JB0E 2K5LA 2ZPFB 3L2ZA 3S6WA 4CI0C 4R56A 5GAOl 1YHQT 2PVDB 2FHDA 2EQMA 2R57A 4OMFB 4RCCA 1KHCA 3URGA 5CVIA 4DQ2A 3OYMA 2AHJB 4GY5A 2DTIA 3CC2T 2CS7A 3V7CA 2K2VA 1BI2A 2GFUA 3P8HA 2HNIA 4OP0A 5GANf 5GANd 5HY6A 1G3WA 3C95A 3QXEB 1EIFA 3QHSA 2VUBA 4HKEA 2VGMA 4Q5WA 3I56T 2JVVA 4E7IA 2F5TX 3HHTB 3FEOA 5M9OA 1VQKA 4A53A 5IAYA 5LJ5f 3OYHA 4XTUA 3DLLA 3OA6A 3X26B 4M7AF 3E19A 1JRIA 3TCJA 1ZHIA 3KBGA 3RESA 2KK4A 2L89A 1UB4A 5CAIA 2P0QA 1VQ6T 4C0DB 4MMLA 1QVGA 1KG1A 4XAXB 3JSCA 4FM4B 4RG2A 4PJOG 5LJ5h 3FRNA 5CO7A 3OS0A 1WQ7A 4JLGA 1VQ7A 4PJOC 3MO8A 4Y91A 3HP9A 2CZ7B 4M7AD 4XTXA 5CCAA 3I56A 1VQ5T 3F70A 2E64A 3C12A 2OTJA 4C92E 4V2SA 3QSUA 3E1SA 2YLCA 4M77F 3A8LB 3CCJT 4C8QG 5HK3A 3L1AA 2CZ0B 2XDPA 2RO0A 1YJWT 2EKOA 2GF7A 2RM4A 2M16A 5DM7R 4ME7A 4OF1A 5CIUA 3TEEA 2DIQA 3V8LA 2VC8A 4IKFA 3CCST 4E7HA 4O5VA 1VQ6A 4X9DA 3GNGA 2XIDA 4L6V5 3JCMJ 4J8OA 5KH6A 1X75C 2EQKA 4BI3A 4CRIA 2RB6A 3G4ST 5IT9E 1K9MC 4ELZC 2PVGB 1PSFA 4D6WA 2CYZB 3CPWA 2I2LA 5I21A 4C0GA 3LGLA 3HRTA 4VUBA 4N4HA 1LOJA 4FIBA 2FL7A 1YJWA 1KC8C 3M4GA 2O4XB 2DTOA 1JJ2S 2A7YA 1Q7YU 4M7DD 1Y96B 1N9SA 4QQDA 1U1TA 2G3RA 5HKCA 1VQ9T 1QVPA 2K3YA 2QQ9A 4A4KA 5KCOA 4JJNK 2BUDA 2CZ6B 3NTHA 3SWNA 3ER0A 5GAOr 4C0FA 3G7ZA 1P92A 3LH0A 1OI1A 4FT2A 3V8JA 2R5MA 3UPUA 1W2BA 5J3BA 1UGRB 2DJZA 3M53A 5DLOA 1M4ZA 2XI9A 3JCMf 3X20B 1KQSA 2LC4A 4X9CA 3G71T 2JZ2A 4FT4A 3BDUA 3QYGB 5CQYA 4QVCA 3TU4K 3HFNA 1N6AA 4PL6A 4RG8A 3JB9J 2P0PA 2E12A 3KUFA 1YJ9A 3I55T 4JDSA 5J39A 3VU3C 1Q82U 4M7DA 1G3TA 3WVDB 4Y28E 2EQJA 2E41A 3V7SA 5GAN7 3GP8A 1VIEA 3NTKA 4BY6C 3ASKA 5HK0A 4N0AA 2OTJT 3OYGA 1Q81C 4M7AE 4OB0B 2QQRA 3T9NA 1X6OA 1QVFA 3OYIA 1VQ8A 4F7UA 3OS2A 2JTFA 4BY6B 1LJOA 2KDSA 5I2MA 2DPPB 2RK1A 1WPYA 5D6WA 5A0GA 5LJ5g 2KMTA 4M77G 2RHXA 2JOYA 3VV0A 2X35A 4EMKB 4A4HA 3CCQT 2X4JA 3MCAB 5GAN3 5GAN8 4C92F 3R6OA 2EWNA 3CD6T 1BI1A 1VQOT 5LJ5j 1RI0A 4BB7A 4BDZA 4NS5A 2D0QB 3MP8A 3JCMX 4RMOA 2FYKA 1I4K1 1VQMA 1U1SA 3PFSA 3QYHB 4C8QF 1NPRA 1B34A 2LRQA 2ZPBB 4M75B 1TH7A 2OTLT 1AHJB 2EFIA 3QPHA 3VJPA 1YI2A 2XDBA 4N4GA 3HL8A 1BKBA 3HFOA 4BD3A 3JCMd 3H8ZA 3JCMQ 3CCVA 4E47A 3PMIA 4M7AA 1D3BB 1K73C 4M78B 1NJIC 4M7DE 1NZ9A 4JLIA 4LD6A 3M59A 3PGGA 3CMAA 2CZ1B 2WACA 3JB9I 5FRNA 4A54A 5GANe 3LWHA 3LLRA 3QZ9B 4QVDA 3SDZA 3L2WA 1VQOA 1VQ7T 3G71A 3LGFA 5LJ3d 1YIJA 5DY9A 5LL6S 5GAOq 2YHTA 3OBWA 2EIFA 4M78C 4ZN3A 3GOXA 1VQMT 4M77B 3MEAA 4JRPA 2E1HA 1YITA 1XTDA 4LD9K 4C8QA 5GAMf 1YI2T 3CCJA 2K5FA 2Y4YA 4C8QD 4C0DC 1QVFS 2QQSA 2MWOA 1XQHA 4DOWA 3FC3A 1VQLT 3QG1A 3V7RA 3A5ZB 1VQ8T 5LJ3j 3MEVA 2DAQA 2QDYB 2WSCE 4KBMB 4M78D 1KQ2A 3LYIA 4PJOA 4OB1B 2VYTA 5C0MA 4BE2A 4PJOD 1VIFA 2VXFA 4KT0E 1S72T 1JJ2A 3V8KA 1Y07A 1VQPT 3G4SA 2KSSA 3CMEA 3CCRT 1BI0A 1Y96A 5FU7C 4B9XA 2L5QA 1V29B 2E10A 2ZCFB 4PNOA 2L3RA 3OYBA 2DK3A 2QQAA 4L5GA 3CXCS 4LDUA 2QXFA 2DZ9A 1N9RA 2NLUA 4WF2A 1I81A 1M9SA 2WSEE 1X01A 2IVWA 3VYGA 4EPCA 2MI6A 1VQ9A 5A2QE 1KD1C 3HKSA 2HQEA 2XICA 1H641 4XTYA 3CPWS 2E6NA 3JCMW 4LDXA 2PUOB 5GMKj 3RMQA 4J7FA 3OYLA 2QA4A 5GANj 5GMKl 5GANg 1Y7XA 2B8AA 3QDRB 2ZPIB 3MP6A 4XTVA 3OYJA 3CMAT 5GAMh 1IREB 3CCLA 1MHNA 1OZ2A 3HRUA 3I55A 5DLQE 1KD1U 1Q86C 4F7UB 4A4EA 1H3ZA 1KQSS 3EFSA 4JUVA 5GAN6 3JB9F 2O01E 4C0ZA 4OGEA 5GAOp 3BY7A 3VUZA 3OSVA 3DKMA 2VV5A 4F7UF 4ZGDB 4C92D 3UDCA 2X4WA 5CKDA 4MZPA 4BI8B 3OYEA 4KUIA 3OYNA 5CQXA 2LQ8A 2HD0A 3P8BB 2M9UA 2RHZA 3M57A 4OGCA 3VKIA 3JRZA 3VUBA 4EDUA 3CC7T 3H6ZA 5CKBA 2DXUA 2M1HA 2DD4A 2V8IA 3OYKA 3M5AA 2DXCA 4HA8A 2OAUA 3NTIA 5GANh 3MHXA 1UEBA 3CC4T 5GMKh 4HT8A 4M7DG 3UT1A 1YBYA 2V8JA 1S72A 2ZGWA 1UGQB 3CCUT 1Q86U 2CGHA 2RK2A 3BFMA 4KUDK 1UGSB 3RUXA 3CMET 1M8VA 1WJRA 4J6YA 4M78E 5LJ5e 2RJFA 2QTXA 4M78G 3DLMA 4IURA 3EFRA 4L59A 4A4FA 2E70A 3CPFA 4ZTJA 4M78A 3JB9G 2D9TA 2HAXA 1YJNT 4QQGA 4RKUE 5GAMd 2DZCA 3PT9A 4EMKC 1ZQ1A 4F7UG 4M75E 5GMKe 4IUQA 3J80E 4FL6A 3CCSA 3QJ6A 3E9FA 3CCVT 1I5LA 1G3SA 3CEYA 4J6WA 3INZA 2P4TA 5FU7B 1OYXA 1K9MU 3BDLA 2VGNA 1K8AC 2RH2A 3SWNC 4BI4A 3CCUA 4HCBA 4C8QB 2EQUA 3CC2A 1LNXA 5D6YA 1O9SA 2KY9A 1Q82C 1K8AU 3OYDA 4XTZA 1WGSA 3FIFA 3HRSA 3UWNA 5C6SA 2LT4A 1YJNA 1M1KU 2K5IA 2PU9B 2ZPGB 2XD0A 3OSSC 3OB9A 4PJOB 3QIIA 4C92A 3L42A 3JCMe 1I8FA 5J26A 5FRMA 2DXBA 2KAFA 3SFMA 3RERA 4NL2A 3OYYA 4OVAA 4XU1A 5L8RE 4XU2A 4PJOE 4HCZA 4IUTA 2HBPA 4PJOF 2XKOC 1U8RA 2LNVA 5A0LA 1MGQA 2DVEA 2RI2A 4XU0A 2E6ZA 5LJ3e 2L8DA 1WQWA 3OYAA 3RKWA 1D3BA 2DIGA 1KC8U 3A8OB 3DB4A 5LJ3f 1FX7A 3L2UA 3QBYA 2GCXA 4BDYA 3QUIA 2KVQG 4C5IA 2RJCA 4MDWA 4ELYC 3CCRA 3OS5A 1W4SA 4HCCA 2X4XA 2EJFA 2V8KA 4M77D 2K57A 4J83A 4PKCC 2VXEA 3RKYA 5LJ3g 1IZ6A 4PLIA 4M77A 1O75A 4GLKA 3MP1A 5GAOm 2EJ9A 4MMKA 3C4SA 5FLXE 5GMKm 1OZ3A 3L2QA 4JRIA 3G6ET 5LJ3h 3OBYA 4BE0A 2E65A 3M4YA 3WVEB 1Y71A 2F5KA 3OW2A 3CD6A 4NOYA 3JCMc 2QI2A 3M58A 2YLBA 3OMGA 3CXCA 4XU3A 3L2VA 1VQ4T 1GXIE 2JN0A 3LWIA 4MDXA 3P8DA 4LDVA 4M75D 1YCYA 4M7DC 2RI5A 3FLGA 4J7IA 3X25B 3CCQA 1XNIA 3JCMP 5A0DA 1XOVA 1VQNT 2DEQA 2PUKB 4E7KA 3CCLT 4RCBA 2EJGA 4ZGEB 1RL2A 2DO3A 3CBPA 3PIPA 4EMGA 4B9WA 3S3NA 1G3YA 3S3OA 1HXDA 2LCCA 4YTLA 3O8VA 4JRQA 1Q7YC 2GQVA 3JCMg 4R55A 2XU8A 3CCMA 3S3MA 4J6XA 2ZZDA 3GF5A 5GAMj 1M5Q1 4C8QC 2RD1A 1M1GA 4C92G 4C5GA 3ME9A 3NFCA 1M1KC 2Y90A 3CC7A 4II1A 4F7UE 3GLXA 3AHUA 4NL3A 1JBMA 1DJ7B 2F69A 4XQ3A 1Q81U 3OMCA 4LDWA 4M75G 4QVZA 4M75C 3CC4A 4ZGJB 1ZBXA 1YJ9T 2QEXA 1YIJT 2KQWA 2ZPHB 2LX9A 3QJYA 3X28B 2R5AA 1QW1A 4JS4A 1QP2A 5GAN4 1KHIA 1QP3A 3Q1JA 3HSBA 1M90C 5KCHA 2Y4XA 1BIAA 1HK9A 2CKKA 2LDMA 2XDDA 2YRVA 1VQKT 3GPLA 4KULA 4BACA 2P0KA 5FROA 3M55A 2LQKA 1VUBA 2MMPA 2PQWA 3G6EA 2XK0A 4N4IA 2MAMA 1VQLA 3OQ5A 4M75F 3KXTA 4M77E 5I2SA 4C5HA 2RHIA 3EAEA 3GIBA 3A8MB 5D6XA 3JB9H 5KE2A 3RIRA 3LX7A 3ZFJA 4ATOA 3M9QA 4J5YA 4ZN1A 4M7AC 4M7AG 1NE8A 1VQPA 2EAYA 3C94A 4C92B 4MZMA 1BYMA 2IG0A 3A8GB 1VQ5A 4FSXA 5CK9A 3JCMh 3PNWC 1VQNA 5FU6B 3WXMB 5CKEA 1K73U 3CCET 3CBMA 2JTMA 3PTAA 5KE3A 4IUUA 4BE1A 1BIBA 2OTLA 4FU6A 3GNFB 2EYQA 2X4YA 3RMSA 3SD4A 3SWNB 5FU6C 2DKGA 3LW5E 4PLLA 2BIVA 3MEWA 3CCMT 2R58A 2LVMA 2RJEA 4IUVA 4M77C 3RKXA 4A4GA 3PMTA 1YHQA 3DB3A 5GAMg 3OYFA 2RHYA 3BW1A 2WSFE 4M78F 4O6JA 2ZPEB 4XK8E 5CKHA 3OYCA 2QA4T 3QO3A 3META 3QKJA 4DOVA 2C06A 4TVRA 2JUFA 3ZEHA 2E5QA 3CCEA 3X24B 2RJDA 4BUGA 1WNLA 2H3JA 3OW2S 2MWPA 2QEXT 3M54A 1YITT 4XTWA 2LTOA 1W2BS 5EG2A 4X34A 5AYFA 2DD5A 2XG8D 2JNGA 5CKFA 1BI3A 3FDRA 3JB9D 3VYHB 2XHCA 2BKDN 2K4YA 4C5EA 3JCMb 1M90U 2D6FA 1M1FA 2QQBA 3E9GA 4N0AC 5LJ5d 2PVOB 1G5VA 3OY9A 4QQ6A 1PSEA 4EMHA 5GMKi 5GAOn 4E7LA 1N8RC 4E7JA 1KQ1A 2RA2A 3FJPA 2O4XA 4IUPA 3HPWA 5CR2A 3JAME 1NJIU 1VQ4A 3TREA 4EMKA 2M0OA 3FB9A 3J81E 5IN1A 3JCMV 1QVGS 3ZBDA 5GAN5 4C8QE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP6 A;  3OYJ A;  1XNI A;  4PL6 A;  1WJQ A;  4QW2 A;  3KUF A;  2RI3 A;  1MHN A;  1OZ2 A;  4ZTF A;  4E7K A;  5J39 A;  4Z02 A;  1N27 A;  2EQJ A;  4B9W A;  2RHU A;  4A4E A;  3L2R A;  3S3N A;  3NTK A;  3S3O A;  1H3Z A;  2GFA A;  2LCC A;  3ASK A;  3O8V A;  3OYG A;  2QQR A;  1SSF A;  3OYI A;  3S3M A;  3MEU A;  2X4W A;  3OYE A;  2HQX A;  3OYN A;  4UC4 A;  2K3X A;  2JTF A;  3OS2 A;  2RHZ A;  3OS1 A;  4EDU A;  1WJS A;  4C5G A;  3ME9 A;  3H6Z A;  4II1 A;  2M1H A;  3OYK A;  5D6W A;  3S6W A;  3NTI A;  2R57 A;  2FHD A;  2EQM A;  2RHX A;  1KHC A;  2X35 A;  3OMC A;  4QVZ A;  4A4H A;  3OYM A;  3UT1 A;  4GY5 A;  2GFU A;  3P8H A;  2R5A A;  1RI0 A;  4BDZ A;  4NS5 A;  1WJR A;  3MP8 A;  3Q1J A;  4Q5W A;  5KCH A;  2CKK A;  2LDM A;  2RJF A;  3PFS A;  2YRV A;  3DLM A;  4IUR A;  3FEO A;  4L59 A;  4A4F A;  2LRQ A;  2P0K A;  5M9O A;  4BAC A;  2D9T A;  5IAY A;  4ZTJ A;  2EFI A;  5FRO A;  4QQG A;  3OYH A;  4N4G A;  2PQW A;  2XK0 A;  4N4I A;  3OA6 A;  3OQ5 A;  4IUQ A;  4FL6 A;  4BD3 A;  3H8Z A;  4C5H A;  2RHI A;  3EAE A;  3E9F A;  3PMI A;  3QJ6 A;  5D6X A;  5KE2 A;  2L89 A;  3CEY A;  4LD6 A;  1OYX A;  3LX7 A;  3BDL A;  2WAC A;  5FRN A;  3LLR A;  4RG2 A;  3M9Q A;  3L2W A;  2EQU A;  3OS0 A;  3LGF A;  5D6Y A;  3MO8 A;  2IG0 A;  3GOX A;  3OYD A;  1WGS A;  3PNW C;  3F70 A;  3MEA A;  3UWN A;  5C6S A;  5KE3 A;  4IUU A;  4BE1 A;  3OB9 A;  4FU6 A;  3QII A;  3L42 A;  2XDP A;  2RO0 A;  2X4Y A;  2EKO A;  2GF7 A;  5J26 A;  2M16 A;  2QQS A;  2MWO A;  3SD4 A;  5FRM A;  5CIU A;  3FC3 A;  4OVA A;  4PLL A;  2DIQ A;  2BIV A;  3MEW A;  4IKF A;  4HCZ A;  2R58 A;  2LVM A;  2RJE A;  4IUT A;  4IUV A;  4A4G A;  4E7H A;  3FLG A;  4E7I A;  3PMT A;  3MEV A;  3DB3 A;  3OYF A;  2DAQ A;  2RHY A;  2RI2 A;  3LYI A;  3OYC A;  2L8D A;  2VYT A;  5C0M A;  5KH6 A;  3OYA A;  4BE2 A;  2EQK A;  4CRI A;  3MET A;  2DIG A;  3QKJ A;  3DB4 A;  3L2U A;  3QBY A;  4BDY A;  3ZEH A;  2E5Q A;  4C5I A;  2RJC A;  4B9X A;  2RJD A;  2X4X A;  2MWP A;  2L3R A;  2LTO A;  3OYB A;  3LGL A;  4X34 A;  4N4H A;  4PLI A;  2O4X B;  3MP1 A;  3C4S A;  2NLU A;  3FDR A;  1OZ3 A;  3L2Q A;  2BKD N;  4C5E A;  4QQD A;  2G3R A;  3E9G A;  2K3Y A;  5KCO A;  4BE0 A;  1G5V A;  3OY9 A;  2BUD A;  2HQE A;  3NTH A;  4QQ6 A;  2F5K A;  2E6N A;  4E7L A;  3LH0 A;  1OI1 A;  4E7J A;  4IUP A;  2R5M A;  2O4X A;  3OMG A;  3L2V A;  3OYL A;  2M0O A;  5IN1 A;  3P8D A;  2B8A A;  2JZ2 A;  2RI5 A; 
#chains in the Genus database with same CATH topology
 1UGP B;  4QW2 A;  1R0B G;  4OB3 B;  4Z02 A;  3PIO A;  2DET A;  2RHU A;  2FPE A;  3L2R A;  1HD3 A;  2GFA A;  3J7A F;  2ROL A;  2LCL A;  1WHM A;  3G1J A;  3NGP A;  4P5N A;  1D1C A;  1UGV A;  3H9N A;  1WJS A;  4C92 C;  3QZ5 B;  3L2Z A;  4R56 A;  2VAS A;  5GAO l;  4LXC A;  2R57 A;  4OMF B;  2EQM A;  3CCL Q;  1KHC A;  3OYM A;  4JJD A;  1MND A;  2K2V A;  1VQ6 Q;  3C95 A;  1IB8 A;  4HKE A;  1WYX A;  2JVV A;  4E7I A;  2F5T X;  3FEO A;  3U23 A;  2ENM A;  3TVT A;  3DLL A;  1X6G A;  4WCI A;  1G2B A;  2ESW A;  4FM4 B;  2LMJ A;  4RG2 A;  5LJ5 h;  3CME Q;  3OS0 A;  1VQ7 A;  1WQ7 A;  4JLG A;  2MYS A;  2CZ7 B;  4M7A D;  4E2F B;  1Q95 G;  1TTH B;  1PNJ A;  2QYZ A;  1U3O A;  1I5O B;  4DBQ A;  2DER A;  2LJ3 A;  3L1A A;  2CZ0 B;  4B6M A;  1H3H A;  1D1B A;  2EKO A;  2RM4 A;  1YJW T;  1K73 R;  1VYV A;  2A28 A;  2DIQ A;  1FYN A;  2VC8 A;  1NYG A;  1RAI B;  5D7U A;  2AIR B;  2EQK A;  2RB6 A;  4ANJ A;  3G4S T;  1NG2 A;  2LX7 A;  2I0N A;  2ROT A;  1MMG A;  2C0I A;  2I2L A;  4LN2 A;  3LGL A;  3HRT A;  2A36 A;  2FL7 A;  1KC8 C;  2YT6 A;  1Y96 B;  5HKC A;  1QVP A;  2K3Y A;  2QQ9 A;  4OMP A;  5KCO A;  2BUD A;  4J9H A;  3ER0 A;  2X9H A;  3G7Z A;  1SRM A;  4C0F A;  1OI1 A;  4FT2 A;  1A0N B;  1UGR B;  2DJZ A;  5DLO A;  2MOX A;  2LC4 A;  2JZ2 A;  3QYG B;  5CQY A;  3EG3 A;  1YIT Q;  1GCQ A;  1N6A A;  4HCK A;  2E12 A;  1RUW A;  2BE7 D;  2ZAE A;  2EQJ A;  5GAN 7;  3NTK A;  1M3C A;  2GGR A;  2CUD A;  2AK5 A;  3OYI A;  1VQ8 A;  1SF9 A;  2PTK A;  4F7U A;  2JTF A;  1PCX A;  1FMK A;  2DL8 A;  2RN8 A;  4X1V A;  2FPF A;  5I2M A;  1AEY A;  4F04 B;  2NUP B;  5D6W A;  5LJ5 g;  1VA7 A;  3UF4 A;  2D8H A;  2OX7 A;  2JOY A;  2X4J A;  4C92 F;  3R6O A;  8AT1 B;  4JJC A;  1G8X A;  2FYK A;  1U1S A;  3QYH B;  1NPR A;  1B34 A;  2ZPB B;  4M75 B;  1TH7 A;  1AHJ B;  1YI2 A;  1Y0M A;  1BKB A;  4M7A A;  4QKU A;  3PGG A;  3CMA A;  2CZ1 B;  2WAC A;  5FRN A;  4QVD A;  2LZ6 B;  3SDZ A;  3L2W A;  1VQO A;  5GAO q;  1BCO A;  2YHT A;  3OBW A;  4M78 C;  3GOX A;  3OW2 P;  1VYT A;  2F1L A;  8ATC B;  4JRP A;  5GAM f;  3CCJ A;  4R0K A;  4C8Q D;  4C0D C;  2QQS A;  1XQH A;  1VQ8 T;  3LYI A;  1OU9 A;  1X2Q A;  4J9G A;  1VIF A;  1S72 T;  4PJO D;  4F14 A;  1JJ2 A;  1SHF A;  1Y07 A;  1VQP T;  3G4S A;  2KI7 A;  3D7S B;  2L5Q A;  4PNO A;  1QCF A;  2DK3 A;  2QQA A;  2GTJ A;  4LDU A;  2DZ9 A;  2M0Y A;  3EGD B;  1X01 A;  2WSE E;  4EPC A;  1KD1 C;  2E6N A;  1TOV A;  2HKQ B;  2PUO B;  4J9F A;  5GAN j;  1M30 A;  2Z0W A;  1Y7X A;  3OYJ A;  2EYW A;  1LVK A;  5DLQ E;  2HSE B;  4A4E A;  5KYX B;  1YJ9 Q;  1H3Z A;  4JUV A;  4OMQ A;  2HKN A;  4OGE A;  2MCN A;  2OI3 A;  3BY7 A;  1PD1 A;  2DEU A;  4F7U F;  3ZL7 C;  2YRC A;  5CQX A;  4OGC A;  2GNC A;  5CKB A;  1BB9 A;  2M1H A;  3OYK A;  2V8I A;  3UA7 A;  4HA8 A;  3UT1 A;  1YBY A;  2CGH A;  2RK2 A;  4KRT A;  1HSQ A;  5LJ5 e;  3MJX A;  4M78 G;  1AD5 A;  2F2X A;  4HCC A;  1RAD B;  3JB9 G;  3REB B;  5GAM d;  2K9G A;  1ZQ1 A;  4IUQ A;  1C0M A;  3NPF A;  1I5L A;  2EYZ A;  3SWN C;  2KYB A;  3CCU A;  2EQU A;  3CC2 A;  1LNX A;  1M90 R;  1O9S A;  1K8A U;  3OYD A;  1B07 A;  2OAW A;  2JS0 A;  2BE9 B;  3UWN A;  4AFU C;  2XD0 A;  2LT4 A;  2K5I A;  2O9S A;  3OB9 A;  2QEX Q;  3JCM e;  1I8F A;  3ULR B;  1CKA A;  5L8R E;  1HJD A;  2YWW A;  4HCZ A;  2J6F A;  2XKO C;  2DF6 A;  4QT7 A;  2DIG A;  2DJQ A;  1FX7 A;  4BDY A;  1R0C B;  2ED0 A;  4ELY C;  2X4X A;  4PKC C;  2ECZ A;  2EJ9 A;  3LH5 A;  4AT1 B;  3C4S A;  5FLX E;  5GMK m;  1OZ3 A;  4JRI A;  2L3S A;  1RAH B;  4BE0 A;  1MUZ A;  1N5Z A;  2F5K A;  4NOY A;  2QI2 A;  1GXI E;  1VQ4 T;  3NMZ C;  3LWI A;  4KH1 B;  4MDX A;  3EH1 A;  3X25 B;  2O31 A;  1T3L A;  1XNI A;  2EJG A;  1RL2 A;  1UFF A;  3S3N A;  1G3Y A;  4FW2 A;  1KD1 R;  2GQV A;  1EFN A;  4J6X A;  2ZZD A;  5GAM j;  1M1G A;  3ME9 A;  1M1K C;  4II1 A;  4F7U E;  4M75 G;  3CC4 A;  2QAS A;  3VRZ A;  2R5A A;  3VS5 A;  1RAG B;  2CKK A;  2YRV A;  1Q82 R;  3EG2 A;  4BAC A;  5HCK A;  3CCE Q;  3M55 A;  2X3W D;  2MMP A;  5KYU A;  2SRC A;  3G6E A;  2MAM A;  3VRY A;  1WI7 A;  4FCY A;  2RHI A;  3BE3 A;  5D6X A;  3ZFJ A;  1Z9Z A;  4IIM A;  2H3E B;  4M7A G;  1LPL A;  2FRY A;  4MZM A;  1BYM A;  4FSX A;  4AG2 C;  5CK9 A;  1TXQ A;  1K73 U;  3CBM A;  2K6D A;  2OTL A;  1PG5 B;  2EYQ A;  4PK4 A;  5FU6 C;  4D8K A;  4DBR A;  2DKG A;  3LW5 E;  3MEW A;  2LVM A;  2COY A;  4IUV A;  3RKX A;  2ED1 A;  5IHK A;  3BW1 A;  2ZPE B;  1MMD A;  2QA4 T;  4Y92 A;  3MET A;  3QKJ A;  2C06 A;  4TVR A;  2JUF A;  1OOT A;  3OW2 S;  2H3J A;  1PKT A;  5EG2 A;  4X34 A;  5AYF A;  3I55 Q;  2G6F X;  1TSF A;  3JB9 D;  2BKD N;  4C5E A;  2D6F A;  4N0A C;  2RF0 A;  3OY9 A;  1UUE A;  1PSE A;  4QQ6 A;  1Q81 R;  1S72 Q;  1N8R C;  4E7J A;  2RA2 A;  2VWF A;  3FJP A;  2O4X A;  1K9M R;  1IHV A;  3CD6 T;  1K76 A;  5IN1 A;  2FB7 A;  1I07 A;  2KT1 A;  2RI3 A;  2LCS A;  2A3L A;  4DA4 A;  1PHT A;  1NLO C;  3CCU Q;  2MF2 A;  4E7Z A;  1OQK A;  1D0X A;  1E7O A;  5GAN 2;  1NPP A;  3MEU A;  2ABL A;  4JRK A;  1AVZ C;  2FVU A;  2HQX A;  2K3X A;  2L0A A;  1M3B A;  1WHJ A;  3C0C A;  3S6W A;  2FHD A;  1OX9 A;  3URG A;  4DQ2 A;  5CVI A;  4GY5 A;  2DTI A;  1BU1 A;  1BI2 A;  1WHG A;  3P8H A;  4LUD A;  4RTX A;  5GAN f;  1AZG B;  2KT8 A;  1KJW A;  2MK5 A;  4A53 A;  1M1K R;  4XTU A;  2B86 A;  2F2V A;  1EX4 A;  1UB4 A;  2J6K A;  5CAI A;  2RQU A;  3PVL A;  1QVG A;  4XAX B;  3JSC A;  4PJO C;  1QMC A;  4Y91 A;  2YUQ A;  4XTX A;  3I56 A;  2E64 A;  4Z8A A;  5KYY A;  3CCJ T;  1TUG B;  4C8Q G;  3I5S A;  4LNP A;  2M16 A;  4ME7 A;  4OF1 A;  4DBH A;  3TEE A;  4IKF A;  2KBT A;  3G6E Q;  5AT1 B;  1VQ6 A;  3GNG A;  4CRI A;  1IXD A;  4J9D A;  2KR3 A;  5IT9 E;  1GL5 A;  3H0I A;  4ELZ C;  2O88 A;  1WX6 A;  1VYU A;  3VS4 A;  4C0G A;  4RTU A;  2L2P A;  3M4G A;  3R6N A;  2COW A;  7AT1 B;  1Q86 R;  4M7D D;  4QQD A;  4A4K A;  3SWN A;  1W2B A;  1P92 A;  3LH0 A;  3V8J A;  1GRI A;  1E6G A;  3M53 A;  2CP6 A;  2XI9 A;  1S1N A;  3X20 B;  1D0Z A;  3TU4 K;  3BDU A;  3JB9 J;  4PL6 A;  1AOJ A;  3KUF A;  1YJ9 A;  1G3T A;  2BZY A;  4Y28 E;  3V7S A;  1RAC B;  4RTV A;  4BY6 C;  3ASK A;  5HK0 A;  3OYG A;  1Q81 C;  1N8R R;  1X6O A;  1YP5 A;  2CT4 A;  2CH4 A;  2FZG B;  4RUG A;  2DPP B;  2RK1 A;  1WHH A;  2YUO A;  5A0G A;  2DMO A;  2KMT A;  2LP5 A;  3VV0 A;  4EMK B;  3CCQ T;  5GAN 8;  2EWN A;  4HXJ A;  1RAE B;  2COZ A;  3EGX B;  4NS5 A;  4BDZ A;  3JCM X;  3MP8 A;  3PFS A;  4C8Q F;  2LRQ A;  2EFI A;  3VJP A;  2XDB A;  4N4G A;  2YUP A;  5IHN A;  3HFO A;  3JCM d;  4E47 A;  1K73 C;  4M7D E;  1NJI C;  1NZ9 A;  3M59 A;  2RQR A;  3G71 A;  3LGF A;  5LJ3 d;  2CSI A;  1AT1 B;  2EIF A;  1WIE A;  1VQM T;  1KSW A;  3MEA A;  4LD9 K;  1M2V A;  1YWP A;  1U5S A;  1QVF S;  2MWO A;  1K4U S;  3FC3 A;  2JMC A;  3V7R A;  1KC8 R;  3H41 A;  3MEV A;  3E2U A;  4KBM B;  1XJW B;  1AWO A;  4BE2 A;  2VXF A;  3V8K A;  1AWX A;  2L3R A;  2DVJ A;  1M3A A;  3CXC S;  1GCQ C;  2QXF A;  1PRL C;  4WF2 A;  3JV3 A;  1M9S A;  2IVW A;  2MI6 A;  3HKS A;  1MV0 B;  6AT1 B;  5GMK j;  1CKB A;  3CCR Q;  1IGQ A;  5GMK l;  5GAN g;  2ZPI B;  1IRE B;  3CCL A;  4PFP A;  1KD1 U;  1Q86 C;  3JB9 F;  1JXM A;  4PJJ A;  5GAO p;  1NYF A;  1W1F A;  3UDC A;  1ACM B;  4MZP A;  4F16 A;  4CC7 A;  3I9Q A;  3VKI A;  3EGX A;  3M5A A;  2AZV A;  3CC4 T;  2V8J A;  3CCU T;  1Q7Y R;  2NUZ A;  2HCK A;  2LQW A;  3RUX A;  1PKS A;  2NWM A;  4J6Y A;  2E3H A;  3EFR A;  4L59 A;  3UAT A;  2D9T A;  4QQG A;  3PT9 A;  3M0T A;  4RTT A;  1BBZ A;  2BZ8 A;  3J80 E;  4FL6 A;  3CCS A;  3CCV T;  1SG5 A;  3CEY A;  2EQI A;  1K9M U;  2HL5 C;  3BDL A;  2GBQ A;  1K8A C;  2RH2 A;  4C8Q B;  5D6Y A;  4D8D A;  4DBF A;  3CXC P;  1PD0 A;  2P4R A;  1YJN A;  2C0O A;  2ZPG B;  3OSS C;  4PJO B;  3QII A;  5FWB A;  2NUT B;  5FRM A;  4PFO A;  2DXB A;  4PJO E;  2QGF B;  1MGQ A;  5LJ3 e;  2L8D A;  1WQW A;  3OYA A;  3A8O B;  4DEY A;  3QBY A;  2GCX A;  2KVQ G;  4C5I A;  3CCJ Q;  2EGE A;  3CCR A;  1GCP A;  2V8K A;  4M77 D;  2K57 A;  4J83 A;  3RKY A;  5LJ3 g;  4E6R A;  1VQL Q;  3G6E T;  3PE0 A;  3L2Q A;  1JU5 C;  1WXU A;  3OBY A;  4KGZ B;  2OTJ Q;  3WVE B;  3CD6 A;  5IXF A;  3JCM c;  3OMG A;  1SEM A;  1C6V X;  2A37 A;  3L2V A;  3CXC A;  2JN0 A;  3M0P A;  2JJ9 A;  3P8D A;  4M75 D;  1QWE A;  1PWT A;  1YCY A;  4M7D C;  1CSK A;  3FLG A;  4J7I A;  4AFQ C;  1W6X A;  3JCM P;  3M0S A;  2BZX A;  2PUK B;  3QWX X;  3CCL T;  4EMG A;  1HXD A;  2LCC A;  1X43 A;  1VQO Q;  3JCM g;  2XU8 A;  3S3M A;  2RQT A;  2K3B A;  4C92 G;  4C5G A;  3NFC A;  1SHG A;  2EYX A;  1GBQ A;  2F69 A;  5IHI A;  5GJV B;  3OMC A;  4QVZ A;  1QWF A;  2DIL A;  3H0F A;  2KQW A;  2ZPH B;  3UA6 A;  3QJY A;  3X28 B;  4DEX A;  5GAN 4;  3HSB A;  3Q1J A;  1M90 C;  1HK9 A;  3VS1 A;  5KYX A;  3CC7 Q;  2PQW A;  2XK0 A;  2EGA A;  4N4I A;  1WXT A;  1YHQ Q;  1VQL A;  1YCS B;  2QGG A;  2RQW A;  3KXT A;  4M77 E;  1WA7 A;  3GIB A;  4CC3 A;  3RIR A;  3LX7 A;  1H8K A;  1D09 B;  4M7A C;  1VQP A;  2EAY A;  3C94 A;  2IG0 A;  2NUT A;  1VQN A;  2XMF A;  2RPN A;  4IUU A;  1BIB A;  5L23 A;  2BTT A;  3RMS A;  3SWN B;  4Z88 A;  2VVK A;  1K8A R;  1YHQ A;  5GAM g;  4FW1 A;  2RHY A;  2WSF E;  1M2O A;  4XK8 E;  3OYC A;  2CT3 A;  3QO3 A;  2K7A A;  3ZEH A;  2EGC A;  2J6O A;  3CCE A;  4AG1 C;  2D0N A;  3X24 B;  2RJD A;  1YIT T;  3M54 A;  2W0Z A;  1W2B S;  1PC0 A;  2LJ0 A;  3FDR A;  3VYH B;  2K4Y A;  3JCM b;  1M1F A;  5GAO n;  4J9C A;  3EHR A;  4IUP A;  5GJW B;  4EMK A;  2FO0 A;  3FB9 A;  3JCM V;  1QVG S;  5GAN 5;  2O9V A;  1FWZ A;  1FMW A;  1N27 A;  1LCK A;  2ATC B;  4LDY A;  4OB2 B;  5IXB A;  1NLP C;  2DFU A;  2LT1 A;  3CBO A;  4GLM A;  4UC4 A;  3OS1 A;  1JB0 E;  2CRE A;  1YHQ T;  2JMA A;  4RCC A;  2FPD A;  2L3P A;  2AZS A;  1HYO A;  2AHJ B;  3CC2 T;  1F1B B;  2GFU A;  2HNI A;  2AT1 B;  5GAN d;  5HY6 A;  3QXE B;  1EIF A;  3QHS A;  2VUB A;  5IH2 A;  4Q5W A;  1M2V B;  1ZSZ B;  2LNH B;  5IAY A;  2KRM A;  2HMA A;  2L3Q A;  4M7A F;  4JZ3 A;  3TCJ A;  1ZHI A;  2FEI A;  3KBG A;  2L89 A;  4KGX B;  2P0Q A;  4MML A;  3MKD A;  1KG1 A;  4PJO G;  1QKW A;  3FRN A;  1SRL A;  3MO8 A;  2JT4 A;  1K0S A;  3RBB B;  3HP9 A;  1U06 A;  5CCA A;  2RQV A;  4FYV B;  4J9E A;  1VQP Q;  3AT1 B;  3F70 A;  4V2S A;  3E1S A;  2OJ2 A;  2YLC A;  1WXB A;  1WHK A;  2GF7 A;  1IRX A;  2DLP A;  1KIK A;  1JJ2 P;  2PNI A;  2KE9 A;  4O5V A;  1NEG A;  4J8O A;  1X75 C;  4BI3 A;  1JXO A;  1K9M C;  1J3T A;  4D6W A;  2CYZ B;  5I21 A;  4VUB A;  1VQN Q;  4N4H A;  1LOJ A;  3HTR A;  3VS2 A;  2CH4 W;  2DTO A;  1JJ2 S;  2A7Y A;  1VQ9 T;  2CZ6 B;  3NTH A;  5GAO r;  3UPU A;  1KQS A;  1M4Z A;  3JCM f;  3G71 T;  4FYX B;  3HFN A;  3RNJ A;  1YFN A;  2P0P A;  4IIO A;  2DX1 A;  4JDS A;  3VU3 C;  3WVD B;  3CCQ Q;  2JXB A;  1VIE A;  3EFO B;  2OTJ T;  4M7A E;  4OB0 B;  2QQR A;  3OS2 A;  4BY6 B;  2HSP A;  1LJO A;  2PZ1 A;  2KDS A;  3TQ7 P;  4M77 G;  3M0U A;  2AKL A;  2RHX A;  1WZO A;  2X35 A;  2EBP A;  4A4H A;  5GAN 3;  1JEG A;  4AFZ C;  1VQO T;  5LJ5 j;  3QWY A;  2CP5 A;  1RI0 A;  1VQM A;  2EVR A;  3QPH A;  1ZA1 B;  3CCV A;  1D3B B;  1M8M A;  4JLI A;  4LD6 A;  3CCM Q;  5GAN e;  3LWH A;  1YIJ A;  5LL6 S;  4ZN3 A;  1OUL A;  1EZZ B;  1XTD A;  1UHF A;  1PRM C;  4RTZ A;  1G83 A;  3QG1 A;  3A5Z B;  3M0Q A;  2E4H A;  1MMA A;  2MIO A;  2QDY B;  2WSC E;  1VQ7 Q;  2QK0 A;  5C0M A;  1ZUY A;  1QCO A;  2KSS A;  3CCR T;  1YI2 Q;  1Y96 A;  5FU7 C;  4B9X A;  2FZK B;  1V29 B;  4Z89 A;  2ZCF B;  4OML A;  1QQJ A;  2DYI A;  1N9R A;  5KYY B;  1I81 A;  1RI9 A;  1IHW A;  1TUD A;  1VQ9 A;  2J7I A;  5A2Q E;  3CPW S;  1E6H A;  3G4S Q;  4J7F A;  2QA4 A;  2P84 A;  2X3X D;  2B8A A;  2CP7 A;  3EFO A;  4XTV A;  3CC4 Q;  4ORZ A;  3EHQ A;  4F7U B;  1Z9Q A;  1KQS S;  3EFS A;  2H8H A;  4FSS A;  3OSV A;  3DKM A;  2VV5 A;  4ZGD B;  4C92 D;  2JM8 A;  5ECA A;  2LQ8 A;  2HD0 A;  4LUE A;  3P8B B;  3M57 A;  3VUB A;  3JRZ A;  3H6Z A;  2DXU A;  1UJY A;  2OAU A;  3NTI A;  5GAN h;  3MHX A;  1UEB A;  5GMK h;  4HT8 A;  3NHN A;  4M7D G;  3CCV Q;  1NJI R;  1UGQ B;  3BFM A;  4KUD K;  1UGS B;  1WFW A;  2RJF A;  3DLM A;  4A4F A;  3IQL A;  2E70 A;  3CPF A;  1VQ5 Q;  2HAX A;  1YJN T;  4EMK C;  4AFS C;  2HL3 A;  1TU0 B;  4M75 E;  2HQH A;  5I22 A;  1T0H A;  2CUB A;  1ZSZ C;  4PJL A;  3QJ6 A;  3E9F A;  2RNA A;  1G3S A;  3QDF A;  1OYX A;  3CQT A;  2J05 A;  4J9B A;  2KRO A;  2JTE A;  3VS3 A;  1IGU A;  2KY9 A;  5KYN A;  2GQI A;  1WGS A;  2DE0 X;  4JJB A;  5C6S A;  1X6B A;  2DRM A;  2PU9 B;  4C92 A;  1RAB B;  3L42 A;  2KAF A;  2DRK A;  3SFM A;  1K1Z A;  4OVA A;  4IUT A;  1SPK A;  2HBP A;  4PJO F;  1X69 A;  1U8R A;  2DVE A;  1GFC A;  1KC8 U;  3CD6 Q;  2HEQ A;  3DB4 A;  3L2U A;  2FRW A;  2RJC A;  4MDW A;  3OS5 A;  1W4S A;  2EJF A;  1RLQ C;  2VXE A;  4M77 A;  3MP1 A;  3RDV A;  5LJ3 h;  1OEB A;  3OW2 A;  1Y71 A;  2EKH A;  2DNU A;  1K0X A;  2DL7 A;  1UG1 A;  1XOV A;  3VS6 A;  1VQN T;  3CPW P;  4RCB A;  2VB6 A;  3CBP A;  4B9W A;  2V26 A;  1VQ9 Q;  2HZY A;  4JRQ A;  1Q7Y C;  2GTO A;  1TS9 A;  4ESR A;  2QG9 B;  3GF5 A;  1M5Q 1;  2EPD A;  4C8Q C;  3GLX A;  1DJ7 B;  1ZBJ A;  1PM3 A;  1ZBX A;  1YJ9 T;  2M51 A;  2LJ1 A;  1QW1 A;  4JS4 A;  1QP2 A;  1QP3 A;  5KCH A;  1BIA A;  2LDM A;  1VQK T;  1KFZ A;  1YWO A;  2E5K A;  4CC2 A;  1WLP B;  5FRO A;  5FW9 A;  2LQK A;  1VUB A;  3OQ5 A;  1QLY A;  5I2S A;  1AWW A;  3A8M B;  2K79 A;  1YIJ Q;  3EG9 A;  3EG0 A;  1QKX A;  3M9Q A;  4J5Y A;  4C92 B;  3I56 Q;  3A8G B;  2D8J A;  3WXM B;  1ZA2 B;  5KE3 A;  3H0H A;  2X4Y A;  1UDL A;  4PLL A;  2BIV A;  3CCM T;  2CP2 A;  4A4G A;  4M78 F;  4O6J A;  1WHL A;  2E5Q A;  2RMO A;  4BUG A;  2QEX T;  2EW3 A;  1UHC A;  4XTW A;  3CMA Q;  1I1J A;  3MPU B;  4EIK A;  4K11 A;  2XG8 D;  2JW4 A;  5CKF A;  1KK7 A;  2XHC A;  2DM1 A;  2QQB A;  4EMH A;  5GMK i;  2NUP A;  1KQ1 A;  5CR2 A;  3HPW A;  2IPO B;  1SKU B;  2M0O A;  3VS0 A;  3SHW A;  1D0Y A;  4MZT A;  1TWB A;  1WJQ A;  2CDT A;  3A8H B;  1N8R U;  3M56 A;  4ZTF A;  2DXT A;  4OMO A;  3CC2 Q;  4PJM A;  1B34 B;  1R8O B;  4M75 A;  1RAA B;  3SB2 A;  4M7D F;  3I35 A;  2A08 A;  2O2O A;  4HT9 A;  3N5B B;  1QVG P;  1SSF A;  4JS5 A;  1OV3 A;  5FWC A;  4M7D B;  3SEM A;  2DTH A;  2QAZ A;  4M7A B;  5GAM e;  1FXX A;  2K5L A;  2ZPF B;  1TUC A;  1UE9 A;  4CI0 C;  2PVD B;  4HVW A;  2CS7 A;  3V7C A;  4OP0 A;  1G3W A;  1NBE B;  2VGM A;  2CP0 A;  3I56 T;  3HHT B;  5M9O A;  1VQK A;  5LJ5 f;  3OYH A;  4OMN A;  3OA6 A;  1K9A A;  3X26 B;  3E19 A;  3M0R A;  1JRI A;  3RES A;  2KK4 A;  1V1C A;  1VQ6 T;  4C0D B;  4JPB W;  2IIM A;  5CO7 A;  2KRN A;  1JQQ A;  2DL3 A;  2KRS A;  1NM7 A;  2CSQ A;  1VQ5 T;  3C12 A;  2OTJ A;  4C92 E;  2QDL A;  3QSU A;  3EGD A;  4M77 F;  3A8L B;  5HK3 A;  2XDP A;  2RO0 A;  5DM7 R;  1AWJ A;  5CIU A;  3V8L A;  3CCS T;  4E7H A;  4X9D A;  2XID A;  4L6V 5;  2KYM A;  3JCM J;  5KH6 A;  1MV3 A;  1V76 A;  2PVG B;  1PSF A;  3CPW A;  4OMM A;  1YJW Q;  4FIB A;  1YJW A;  2O4X B;  2V1Q A;  1Q7Y U;  1N9S A;  1U1T A;  2G3R A;  1OPL A;  4JJN K;  1Y57 A;  2R5M A;  5J3B A;  4X9C A;  4FT4 A;  3GBQ A;  4QVC A;  1T3S A;  4RG8 A;  3I55 T;  5J39 A;  4M7D A;  1Q82 U;  2K2M A;  2E41 A;  3GP8 A;  4A63 B;  4N0A A;  3T9N A;  4HVV A;  1QVF A;  1BK2 A;  4LE9 A;  1WPY A;  2NYS A;  2X51 A;  4J9I A;  2FG0 A;  3MCA B;  1BI1 A;  1W70 A;  2KGT A;  4BB7 A;  2D0Q B;  4RMO A;  3VS7 A;  1I4K 1;  1MNE A;  1OX8 A;  2OTL T;  3HL8 A;  2DBK A;  4BD3 A;  3RR6 A;  3H8Z A;  3JCM Q;  4RTW A;  4ZNX A;  3PMI A;  4M78 B;  1VOM A;  3JB9 I;  2JS2 A;  4A54 A;  3LLR A;  3QZ9 B;  1VQ7 T;  5DY9 A;  1VQK Q;  4CC4 B;  4M77 B;  1YIT A;  2E1H A;  1WDX A;  4C8Q A;  1YI2 T;  2K5F A;  2Y4Y A;  1ZSZ A;  2YXY A;  2DL5 A;  4DOW A;  1VQL T;  2C0T A;  5LJ3 j;  2D1X A;  2DAQ A;  4M78 D;  1KQ2 A;  4PJO A;  4OB1 B;  2YUN A;  2VYT A;  4KT0 E;  4HVU A;  1UEC A;  3CME A;  1BI0 A;  2M02 A;  2E10 A;  3OYB A;  1QVF P;  4L5G A;  3TSW A;  2AKK A;  2NLU A;  3VYG A;  1B7T A;  2HQE A;  2XIC A;  1H64 1;  4XTY A;  4M4Z A;  3JCM W;  5KYW B;  4LDX A;  3RMQ A;  3OYL A;  3QDR B;  4E7S A;  3MP6 A;  2HBW A;  1I0C A;  1TG0 A;  5GAM h;  3CMA T;  1AZE A;  1MHN A;  1OZ2 A;  3HRU A;  3I55 A;  2VKN A;  1GBR A;  1T0J A;  2HDA A;  5GAN 6;  3THK A;  9ATC B;  2O01 E;  4C0Z A;  3VUZ A;  5KYU B;  1UJ0 A;  1ABQ A;  2X4W A;  5CKD A;  4BI8 B;  3OYE A;  4KUI A;  3OYN A;  2M9U A;  2RHZ A;  1YJN Q;  4EDU A;  3CC7 T;  2JM9 A;  3EG9 B;  1ZUK A;  2DD4 A;  1ARK A;  1BCM A;  2DXC A;  5EC7 A;  4RTY A;  3KFV A;  1S72 A;  2ZGW A;  3A1P A;  1Q86 U;  1MMN A;  3EGU A;  3CME T;  1M8V A;  1WJR A;  4M78 E;  2QTX A;  1C1A A;  4IUR A;  4ZTJ A;  4M78 A;  4RKU E;  2DZC A;  4F7U G;  5GMK e;  5FU7 B;  4J6W A;  3INZ A;  2P4T A;  2VGN A;  4BI4 A;  4HCB A;  1OU8 A;  3I5R A;  1B3Q A;  1Q82 C;  1GFD A;  4GBQ A;  4XTZ A;  2DL4 A;  3FIF A;  3HRS A;  1M1K U;  1H92 A;  2DYB A;  5J26 A;  3RER A;  4NL2 A;  1FMV A;  3OYY A;  4XU1 A;  4XU2 A;  2KNB B;  2LNV A;  5A0L A;  4XU0 A;  2RI2 A;  2E6Z A;  3RKW A;  1D3B A;  4KH0 B;  2W10 A;  1VQM Q;  5LJ3 f;  3QUI A;  2LQN A;  1W2B P;  3FJ5 A;  1ABO A;  1IZ6 A;  4PLI A;  5KYW A;  1O75 A;  4GLK A;  5GAO m;  4MMK A;  3CCS Q;  2KXD A;  1KQS P;  2E65 A;  3M4Y A;  1YNZ A;  3M58 A;  1YN8 A;  2YLB A;  4XU3 A;  1X2K A;  1ZLM A;  3A98 A;  1M27 C;  2KEA A;  4LDV A;  2RI5 A;  3CCQ A;  4JZ4 A;  5A0D A;  2DEQ A;  1ZX6 A;  4E7K A;  3PIP A;  4ZGE B;  2DO3 A;  2EYY A;  1IO6 A;  3EH2 A;  3S3O A;  1JO8 A;  4YTL A;  3O8V A;  1X27 A;  4FYW B;  1ZUU A;  2DA9 A;  4R55 A;  3CCM A;  1VQ4 Q;  2MPX C;  2RD1 A;  2SEM A;  2YSQ A;  2Y90 A;  3CC7 A;  3AHU A;  4NL3 A;  3REA B;  4KGV B;  1JBM A;  4XQ3 A;  1Q81 U;  4LDW A;  4M75 C;  4ZGJ B;  5I11 A;  2QEX A;  1YIJ T;  4PJN A;  1D1A A;  1NEB A;  2LX9 A;  1KHI A;  2F2W A;  2Y4X A;  2QTV A;  2XDD A;  3GPL A;  4KUL A;  2P0K A;  4M75 F;  2A0F B;  3EG1 A;  4C5H A;  3EAE A;  3JB9 H;  5KE2 A;  4PFZ A;  1VQ8 Q;  4ATO A;  1UTI A;  4ZN1 A;  1R77 A;  1NE8 A;  2V1R A;  1OPK A;  1RLP C;  4WTO B;  1VQ5 A;  2J06 A;  2YDL A;  3JCM h;  3PNW C;  5FU6 B;  2OTL Q;  5CKE A;  3CCE T;  2JTM A;  3PTA A;  4BE1 A;  4FU6 A;  2KXC A;  3GNF B;  3SD4 A;  3TSZ A;  3PVQ A;  2R58 A;  2RJE A;  4M77 C;  3PMT A;  3DB3 A;  3OYF A;  2E3I A;  5CKH A;  1QCN A;  2YRD A;  2DBM A;  4DOV A;  3G71 Q;  1WNL A;  2MWP A;  1SSH A;  2LTO A;  2FZC B;  4FYY B;  2DD5 A;  1ZSG A;  2JNG A;  1BI3 A;  4AMC A;  2CP3 A;  3O5Z A;  1M90 U;  3E9G A;  5LJ5 d;  2PVO B;  1G5V A;  4F17 A;  2QA4 Q;  4E7L A;  3JAM E;  1NJI U;  1VQ4 A;  3TRE A;  3J81 E;  3ZBD A;  1RAF B;  4C8Q E; 
#chains in the Genus database with same CATH homology
 1UGP B;  2FB7 A;  4MZT A;  1WJQ A;  4QW2 A;  1FWZ A;  3A8H B;  2RI3 A;  1N8R U;  3M56 A;  4OB3 B;  4ZTF A;  2A3L A;  2DXT A;  1N27 A;  4Z02 A;  3PIO A;  4DA4 A;  2RHU A;  3L2R A;  1B34 B;  1R8O B;  4M75 A;  3SB2 A;  4LDY A;  4M7D F;  2GFA A;  2MF2 A;  4OB2 B;  3J7A F;  4HT9 A;  3N5B B;  2LCL A;  1SSF A;  4JS5 A;  5GAN 2;  1NPP A;  3MEU A;  4M7D B;  2LT1 A;  3CBO A;  4JRK A;  2FVU A;  2HQX A;  4UC4 A;  2K3X A;  4P5N A;  2DTH A;  4M7A B;  3OS1 A;  1WJS A;  5GAM e;  4C92 C;  3QZ5 B;  1FXX A;  1JB0 E;  2K5L A;  2ZPF B;  3L2Z A;  3S6W A;  4CI0 C;  4R56 A;  5GAO l;  1YHQ T;  2PVD B;  2FHD A;  2EQM A;  2R57 A;  4OMF B;  4RCC A;  1KHC A;  3URG A;  5CVI A;  4DQ2 A;  3OYM A;  2AHJ B;  4GY5 A;  2DTI A;  3CC2 T;  2CS7 A;  3V7C A;  2K2V A;  1BI2 A;  2GFU A;  3P8H A;  2HNI A;  4OP0 A;  5GAN f;  5GAN d;  5HY6 A;  1G3W A;  3C95 A;  3QXE B;  1EIF A;  3QHS A;  2VUB A;  4HKE A;  2VGM A;  4Q5W A;  3I56 T;  2JVV A;  4E7I A;  2F5T X;  3HHT B;  3FEO A;  5M9O A;  1VQK A;  4A53 A;  5IAY A;  5LJ5 f;  3OYH A;  4XTU A;  3DLL A;  3OA6 A;  3X26 B;  4M7A F;  3E19 A;  1JRI A;  3TCJ A;  1ZHI A;  3KBG A;  3RES A;  2KK4 A;  2L89 A;  1UB4 A;  5CAI A;  2P0Q A;  1VQ6 T;  4C0D B;  4MML A;  1QVG A;  1KG1 A;  4XAX B;  3JSC A;  4FM4 B;  4RG2 A;  4PJO G;  5LJ5 h;  3FRN A;  5CO7 A;  3OS0 A;  1WQ7 A;  4JLG A;  1VQ7 A;  4PJO C;  3MO8 A;  4Y91 A;  3HP9 A;  2CZ7 B;  4M7A D;  4XTX A;  5CCA A;  3I56 A;  1VQ5 T;  3F70 A;  2E64 A;  3C12 A;  2OTJ A;  4C92 E;  4V2S A;  3QSU A;  3E1S A;  2YLC A;  4M77 F;  3A8L B;  3CCJ T;  4C8Q G;  5HK3 A;  3L1A A;  2CZ0 B;  2XDP A;  2RO0 A;  1YJW T;  2EKO A;  2GF7 A;  2RM4 A;  2M16 A;  5DM7 R;  4ME7 A;  4OF1 A;  5CIU A;  3TEE A;  2DIQ A;  3V8L A;  2VC8 A;  4IKF A;  3CCS T;  4E7H A;  4O5V A;  1VQ6 A;  4X9D A;  3GNG A;  2XID A;  4L6V 5;  3JCM J;  4J8O A;  5KH6 A;  1X75 C;  2EQK A;  4BI3 A;  4CRI A;  2RB6 A;  3G4S T;  5IT9 E;  1K9M C;  4ELZ C;  2PVG B;  1PSF A;  4D6W A;  2CYZ B;  3CPW A;  2I2L A;  5I21 A;  4C0G A;  3LGL A;  3HRT A;  4VUB A;  4N4H A;  1LOJ A;  4FIB A;  2FL7 A;  1YJW A;  1KC8 C;  3M4G A;  2O4X B;  2DTO A;  1JJ2 S;  2A7Y A;  1Q7Y U;  4M7D D;  1Y96 B;  1N9S A;  4QQD A;  1U1T A;  2G3R A;  5HKC A;  1VQ9 T;  1QVP A;  2K3Y A;  2QQ9 A;  4A4K A;  5KCO A;  4JJN K;  2BUD A;  2CZ6 B;  3NTH A;  3SWN A;  3ER0 A;  5GAO r;  4C0F A;  3G7Z A;  1P92 A;  3LH0 A;  1OI1 A;  4FT2 A;  3V8J A;  2R5M A;  3UPU A;  1W2B A;  5J3B A;  1UGR B;  2DJZ A;  3M53 A;  5DLO A;  1M4Z A;  2XI9 A;  3JCM f;  3X20 B;  1KQS A;  2LC4 A;  4X9C A;  3G71 T;  2JZ2 A;  4FT4 A;  3BDU A;  3QYG B;  5CQY A;  4QVC A;  3TU4 K;  3HFN A;  1N6A A;  4PL6 A;  4RG8 A;  3JB9 J;  2P0P A;  2E12 A;  3KUF A;  1YJ9 A;  3I55 T;  4JDS A;  5J39 A;  3VU3 C;  1Q82 U;  4M7D A;  1G3T A;  3WVD B;  4Y28 E;  2EQJ A;  2E41 A;  3V7S A;  5GAN 7;  3GP8 A;  1VIE A;  3NTK A;  4BY6 C;  3ASK A;  5HK0 A;  4N0A A;  2OTJ T;  3OYG A;  1Q81 C;  4M7A E;  4OB0 B;  2QQR A;  3T9N A;  1X6O A;  1QVF A;  3OYI A;  1VQ8 A;  4F7U A;  3OS2 A;  2JTF A;  4BY6 B;  1LJO A;  2KDS A;  5I2M A;  2DPP B;  2RK1 A;  1WPY A;  5D6W A;  5A0G A;  5LJ5 g;  2KMT A;  4M77 G;  2RHX A;  2JOY A;  3VV0 A;  2X35 A;  4EMK B;  4A4H A;  3CCQ T;  2X4J A;  3MCA B;  5GAN 3;  5GAN 8;  4C92 F;  3R6O A;  2EWN A;  3CD6 T;  1BI1 A;  1VQO T;  5LJ5 j;  1RI0 A;  4BB7 A;  4BDZ A;  4NS5 A;  2D0Q B;  3MP8 A;  3JCM X;  4RMO A;  2FYK A;  1I4K 1;  1VQM A;  1U1S A;  3PFS A;  3QYH B;  4C8Q F;  1NPR A;  1B34 A;  2LRQ A;  2ZPB B;  4M75 B;  1TH7 A;  2OTL T;  1AHJ B;  2EFI A;  3QPH A;  3VJP A;  1YI2 A;  2XDB A;  4N4G A;  3HL8 A;  1BKB A;  3HFO A;  4BD3 A;  3JCM d;  3H8Z A;  3JCM Q;  3CCV A;  4E47 A;  3PMI A;  4M7A A;  1D3B B;  1K73 C;  4M78 B;  1NJI C;  4M7D E;  1NZ9 A;  4JLI A;  4LD6 A;  3M59 A;  3PGG A;  3CMA A;  2CZ1 B;  2WAC A;  3JB9 I;  5FRN A;  4A54 A;  5GAN e;  3LWH A;  3LLR A;  3QZ9 B;  4QVD A;  3SDZ A;  3L2W A;  1VQO A;  1VQ7 T;  3G71 A;  3LGF A;  5LJ3 d;  1YIJ A;  5DY9 A;  5LL6 S;  5GAO q;  2YHT A;  3OBW A;  2EIF A;  4M78 C;  4ZN3 A;  3GOX A;  1VQM T;  4M77 B;  3MEA A;  4JRP A;  2E1H A;  1YIT A;  1XTD A;  4LD9 K;  4C8Q A;  5GAM f;  1YI2 T;  3CCJ A;  2K5F A;  2Y4Y A;  4C8Q D;  4C0D C;  1QVF S;  2QQS A;  2MWO A;  1XQH A;  4DOW A;  3FC3 A;  1VQL T;  3QG1 A;  3V7R A;  3A5Z B;  1VQ8 T;  5LJ3 j;  3MEV A;  2DAQ A;  2QDY B;  2WSC E;  4KBM B;  4M78 D;  1KQ2 A;  3LYI A;  4PJO A;  4OB1 B;  2VYT A;  5C0M A;  4BE2 A;  4PJO D;  1VIF A;  2VXF A;  4KT0 E;  1S72 T;  1JJ2 A;  3V8K A;  1Y07 A;  1VQP T;  3G4S A;  2KSS A;  3CME A;  3CCR T;  1BI0 A;  1Y96 A;  5FU7 C;  4B9X A;  2L5Q A;  1V29 B;  2E10 A;  2ZCF B;  4PNO A;  2L3R A;  3OYB A;  2DK3 A;  2QQA A;  4L5G A;  3CXC S;  4LDU A;  2QXF A;  2DZ9 A;  1N9R A;  2NLU A;  4WF2 A;  1I81 A;  1M9S A;  2WSE E;  1X01 A;  2IVW A;  3VYG A;  4EPC A;  2MI6 A;  1VQ9 A;  5A2Q E;  1KD1 C;  3HKS A;  2HQE A;  2XIC A;  1H64 1;  4XTY A;  3CPW S;  2E6N A;  3JCM W;  4LDX A;  2PUO B;  5GMK j;  3RMQ A;  4J7F A;  3OYL A;  2QA4 A;  5GAN j;  5GMK l;  5GAN g;  1Y7X A;  2B8A A;  3QDR B;  2ZPI B;  3MP6 A;  4XTV A;  3OYJ A;  3CMA T;  5GAM h;  1IRE B;  3CCL A;  1MHN A;  1OZ2 A;  3HRU A;  3I55 A;  5DLQ E;  1KD1 U;  1Q86 C;  4F7U B;  4A4E A;  1H3Z A;  1KQS S;  3EFS A;  4JUV A;  5GAN 6;  3JB9 F;  2O01 E;  4C0Z A;  4OGE A;  5GAO p;  3BY7 A;  3VUZ A;  3OSV A;  3DKM A;  2VV5 A;  4F7U F;  4ZGD B;  4C92 D;  3UDC A;  2X4W A;  5CKD A;  4MZP A;  4BI8 B;  3OYE A;  4KUI A;  3OYN A;  5CQX A;  2LQ8 A;  2HD0 A;  3P8B B;  2M9U A;  2RHZ A;  3M57 A;  4OGC A;  3VKI A;  3JRZ A;  3VUB A;  4EDU A;  3CC7 T;  3H6Z A;  5CKB A;  2DXU A;  2M1H A;  2DD4 A;  2V8I A;  3OYK A;  3M5A A;  2DXC A;  4HA8 A;  2OAU A;  3NTI A;  5GAN h;  3MHX A;  1UEB A;  3CC4 T;  5GMK h;  4HT8 A;  4M7D G;  3UT1 A;  1YBY A;  2V8J A;  1S72 A;  2ZGW A;  1UGQ B;  3CCU T;  1Q86 U;  2CGH A;  2RK2 A;  3BFM A;  4KUD K;  1UGS B;  3RUX A;  3CME T;  1M8V A;  1WJR A;  4J6Y A;  4M78 E;  5LJ5 e;  2RJF A;  2QTX A;  4M78 G;  3DLM A;  4IUR A;  3EFR A;  4L59 A;  4A4F A;  2E70 A;  3CPF A;  4ZTJ A;  4M78 A;  3JB9 G;  2D9T A;  2HAX A;  1YJN T;  4QQG A;  4RKU E;  5GAM d;  2DZC A;  3PT9 A;  4EMK C;  1ZQ1 A;  4F7U G;  4M75 E;  5GMK e;  4IUQ A;  3J80 E;  4FL6 A;  3CCS A;  3QJ6 A;  3E9F A;  3CCV T;  1I5L A;  1G3S A;  3CEY A;  4J6W A;  3INZ A;  2P4T A;  5FU7 B;  1OYX A;  1K9M U;  3BDL A;  2VGN A;  1K8A C;  2RH2 A;  3SWN C;  4BI4 A;  3CCU A;  4HCB A;  4C8Q B;  2EQU A;  3CC2 A;  1LNX A;  5D6Y A;  1O9S A;  2KY9 A;  1Q82 C;  1K8A U;  3OYD A;  4XTZ A;  1WGS A;  3FIF A;  3HRS A;  3UWN A;  5C6S A;  2LT4 A;  1YJN A;  1M1K U;  2K5I A;  2PU9 B;  2ZPG B;  2XD0 A;  3OSS C;  3OB9 A;  4PJO B;  3QII A;  4C92 A;  3L42 A;  3JCM e;  1I8F A;  5J26 A;  5FRM A;  2DXB A;  2KAF A;  3SFM A;  3RER A;  4NL2 A;  3OYY A;  4OVA A;  4XU1 A;  5L8R E;  4XU2 A;  4PJO E;  4HCZ A;  4IUT A;  2HBP A;  4PJO F;  2XKO C;  1U8R A;  2LNV A;  5A0L A;  1MGQ A;  2DVE A;  2RI2 A;  4XU0 A;  2E6Z A;  5LJ3 e;  2L8D A;  1WQW A;  3OYA A;  3RKW A;  1D3B A;  2DIG A;  1KC8 U;  3A8O B;  3DB4 A;  5LJ3 f;  1FX7 A;  3L2U A;  3QBY A;  2GCX A;  4BDY A;  3QUI A;  2KVQ G;  4C5I A;  2RJC A;  4MDW A;  4ELY C;  3CCR A;  3OS5 A;  1W4S A;  4HCC A;  2X4X A;  2EJF A;  2V8K A;  4M77 D;  2K57 A;  4J83 A;  4PKC C;  2VXE A;  3RKY A;  5LJ3 g;  1IZ6 A;  4PLI A;  4M77 A;  1O75 A;  4GLK A;  3MP1 A;  5GAO m;  2EJ9 A;  4MMK A;  3C4S A;  5FLX E;  5GMK m;  1OZ3 A;  3L2Q A;  4JRI A;  3G6E T;  5LJ3 h;  3OBY A;  4BE0 A;  2E65 A;  3M4Y A;  3WVE B;  1Y71 A;  2F5K A;  3OW2 A;  3CD6 A;  4NOY A;  3JCM c;  2QI2 A;  3M58 A;  2YLB A;  3OMG A;  3CXC A;  4XU3 A;  3L2V A;  1VQ4 T;  1GXI E;  2JN0 A;  3LWI A;  4MDX A;  3P8D A;  4LDV A;  4M75 D;  1YCY A;  4M7D C;  2RI5 A;  3FLG A;  4J7I A;  3X25 B;  3CCQ A;  1XNI A;  3JCM P;  5A0D A;  1XOV A;  1VQN T;  2DEQ A;  2PUK B;  4E7K A;  3CCL T;  4RCB A;  2EJG A;  4ZGE B;  1RL2 A;  2DO3 A;  3CBP A;  3PIP A;  4EMG A;  4B9W A;  3S3N A;  1G3Y A;  3S3O A;  1HXD A;  2LCC A;  4YTL A;  3O8V A;  4JRQ A;  1Q7Y C;  2GQV A;  3JCM g;  4R55 A;  2XU8 A;  3CCM A;  3S3M A;  4J6X A;  2ZZD A;  3GF5 A;  5GAM j;  1M5Q 1;  4C8Q C;  2RD1 A;  1M1G A;  4C92 G;  4C5G A;  3ME9 A;  3NFC A;  1M1K C;  2Y90 A;  3CC7 A;  4II1 A;  4F7U E;  3GLX A;  3AHU A;  4NL3 A;  1JBM A;  1DJ7 B;  2F69 A;  4XQ3 A;  1Q81 U;  3OMC A;  4LDW A;  4M75 G;  4QVZ A;  4M75 C;  3CC4 A;  4ZGJ B;  1ZBX A;  1YJ9 T;  2QEX A;  1YIJ T;  2KQW A;  2ZPH B;  2LX9 A;  3QJY A;  3X28 B;  2R5A A;  1QW1 A;  4JS4 A;  1QP2 A;  5GAN 4;  1KHI A;  1QP3 A;  3Q1J A;  3HSB A;  1M90 C;  5KCH A;  2Y4X A;  1BIA A;  1HK9 A;  2CKK A;  2LDM A;  2XDD A;  2YRV A;  1VQK T;  3GPL A;  4KUL A;  4BAC A;  2P0K A;  5FRO A;  3M55 A;  2LQK A;  1VUB A;  2MMP A;  2PQW A;  3G6E A;  2XK0 A;  4N4I A;  2MAM A;  1VQL A;  3OQ5 A;  4M75 F;  3KXT A;  4M77 E;  5I2S A;  4C5H A;  2RHI A;  3EAE A;  3GIB A;  3A8M B;  5D6X A;  3JB9 H;  5KE2 A;  3RIR A;  3LX7 A;  3ZFJ A;  4ATO A;  3M9Q A;  4J5Y A;  4ZN1 A;  4M7A C;  4M7A G;  1NE8 A;  1VQP A;  2EAY A;  3C94 A;  4C92 B;  4MZM A;  1BYM A;  2IG0 A;  3A8G B;  1VQ5 A;  4FSX A;  5CK9 A;  3JCM h;  3PNW C;  1VQN A;  5FU6 B;  3WXM B;  5CKE A;  1K73 U;  3CCE T;  3CBM A;  2JTM A;  3PTA A;  5KE3 A;  4IUU A;  4BE1 A;  1BIB A;  2OTL A;  4FU6 A;  3GNF B;  2EYQ A;  2X4Y A;  3RMS A;  3SD4 A;  3SWN B;  5FU6 C;  2DKG A;  3LW5 E;  4PLL A;  2BIV A;  3MEW A;  3CCM T;  2R58 A;  2LVM A;  2RJE A;  4IUV A;  4M77 C;  3RKX A;  4A4G A;  3PMT A;  1YHQ A;  3DB3 A;  5GAM g;  3OYF A;  2RHY A;  3BW1 A;  2WSF E;  4M78 F;  4O6J A;  2ZPE B;  4XK8 E;  5CKH A;  3OYC A;  2QA4 T;  3QO3 A;  3MET A;  3QKJ A;  4DOV A;  2C06 A;  4TVR A;  2JUF A;  3ZEH A;  2E5Q A;  3CCE A;  3X24 B;  2RJD A;  4BUG A;  1WNL A;  2H3J A;  3OW2 S;  2MWP A;  2QEX T;  3M54 A;  1YIT T;  4XTW A;  2LTO A;  1W2B S;  5EG2 A;  4X34 A;  5AYF A;  2DD5 A;  2XG8 D;  2JNG A;  5CKF A;  1BI3 A;  3FDR A;  3JB9 D;  3VYH B;  2XHC A;  2BKD N;  2K4Y A;  4C5E A;  3JCM b;  1M90 U;  2D6F A;  1M1F A;  2QQB A;  3E9G A;  4N0A C;  5LJ5 d;  2PVO B;  1G5V A;  3OY9 A;  4QQ6 A;  1PSE A;  4EMH A;  5GMK i;  5GAO n;  4E7L A;  1N8R C;  4E7J A;  1KQ1 A;  2RA2 A;  3FJP A;  2O4X A;  4IUP A;  3HPW A;  5CR2 A;  3JAM E;  1NJI U;  1VQ4 A;  3TRE A;  4EMK A;  2M0O A;  3FB9 A;  3J81 E;  5IN1 A;  3JCM V;  1QVG S;  3ZBD A;  5GAN 5;  4C8Q E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...