2FHEA

Fasciola hepatica glutathione s-transferase isoform 1 in complex with glutathione
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
216
Chain Sequence
b'PAKLGYWKIRGLQQPVRLLLEYLGEKYEEQIYERDDGEKWFSKKFELGLDLPNLPYYIDDKCKLTQSLAILRYIADKHGMIGTTSEERARVSMIEGAAVDLRQGISRISYQPKFEQLKEGYLKDLPTTMKMWSDFLGKNPYLRGTSVSHVDFMVYEALDAIRYLEPHCLDHFPNLQQFMSRIEALPSIKAYMESNRFIKWPLNGWHAQFGGGDAPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Crystallization, structural determination and analysis of a novel parasite vaccine candidate: Fasciola hepatica glutathione S-transferase.
pubmed doi rcsb
source organism Fasciola hepatica
molecule tags Transferase/substrate
total genus 71
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2fheA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fheA01
3FY7A 2HSHA 3A2VA 2HZEB 1O85A 4KGIA 4RQRA 3N9JA 1XCCA 2OA7A 4JEDA 4Q5RA 3WT2A 1JZDA 1GSEA 4WKWA 2HQTA 1VRSD 2DJKA 2VCTA 2DJ2A 6GSXA 3GL3A 4FYUA 4QQ7A 1IYHA 5FWGA 1ON4A 3C1SA 2HI7A 1TK0B 4K7IA 2I3YA 1OC9A 1BX9A 2N5AA 3HZ4A 2FY6A 4WETA 1FVJA 3U6VA 4GSTA 1W4VA 3R2QA 4FO5A 2C3QA 2IMIA 3IRAA 2IIYA 4N0VA 1MTCA 4MF6A 5HFIA 2MBTA 3W8JA 4ZB8A 4K7OA 4F0CA 16GSA 2VIMA 4BVXA 3CSHA 1X0RA 5DCHA 2HRKB 1AQXA 1T4ZA 1DUGA 2FLSA 1J0FA 3QDNA 3M3MA 4Q5NA 1S3DA 2C4JA 3DD3A 3D5JA 4AGSA 4X1UA 5IMDA 4OWYA 1KNGA 1WJKA 1SJZA 3UOMA 1XBSA 14GSA 2DJ1A 3F4TA 1VF1A 3QAGA 2K8VA 4BL7A 4BWQA 1SJ6A 4F0BA 6GSTA 5CP1A 2LRCA 1K0BA 3IAS2 4WR5A 2H71A 2VCWA 5DJLA 2VL3A 1V57A 2AV4A 3GSTA 2IL3A 1Z5YE 1JLWA 3A3TA 2VOCA 1ZMAA 3K8NA 1K0OA 1UC7A 1T3BA 1Y6EA 3KH7A 1TXXA 3RHCA 5HR1A 3F6DA 2FNOA 4KX4A 2NBSA 3VWVA 3ISOA 2XPDA 1A8YA 4HI7A 2MBSA 2L4QA 1ABAA 3GKMA 1PL2A 5J41A 4KCEA 6GSWA 3F0IA 5AIXA 5A5KA 4PUAA 4USSA 4WR4A 5DDLA 4BWSA 2IN3A 2H6YA 3US3A 3CSIA 3TKQA 1K3LA 2H6XA 4POLA 5KN2A 4JE1A 3MDKA 5JCUA 5H5SA 2OACA 11GSA 1AQVA 1K3YA 4N10A 2VM2A 1GNWA 3ZMLA 4POBA 1YQ1A 1MD3A 1XPVA 3QOUA 5LNKe 4OFMA 1T1VA 4MA9A 4Q5FA 2X64A 1WRYA 4KDYA 3W6GA 1B4PA 4FYBA 4P3YB 3IK9A 4HJ2A 4MPGA 4NPBA 2GZPA 2H19A 3KP8A 1UVZA 5ECSA 2D2ZA 1RQMA 4HU7A 3IAM2 2WDUA 2C80A 4MMMA 3H93A 3G9BA 2H0GA 3GKNA 12GSA 3QAVA 1FVKA 1XFLA 1R26A 2H0IA 2KUCA 4PGTA 4PQIA 3EYTA 2LS5A 4PTSA 4JU5A 1X9SB 2LSTA 5BMUA 2NTOA 2VL9A 1ILOA 2FWEA 5JCGA 4IELA 3RHBA 3GX0A 2P31A 2XHFA 2KLXA 3QD9A 1WWJA 3MNGA 2BTOT 3H4KA 2N5BA 1M99A 4G0KA 1EOGA 3UMAA 1MEKA 4PQ1A 4V2NA 5IIZA 2WB9A 5A4WA 3Q6OA 1JZOA 5CREA 5IMVA 1YZXA 4G10A 2WULA 2HZEA 4GRFA 2V1MA 1GSQA 2A2RA 1TK8B 2CA8A 2OJLA 2CVBA 4DEJA 4J2FA 2OBIA 3LSZA 5CAXA 4EKZA 2R4VA 1XWGA 1CQHA 4K0GA 3WT1A 3ZIVA 1AQWA 2JU5A 1TU7A 2K18A 4HS1A 2IMKA 3ZVJA 1QXHA 4WBRD 3TUEA 1JZWA 2VCQA 3D6IA 4WF5A 1XW9A 4IP1A 3DIEA 4HQSA 1ZGNA 2VD0A 4XTSA 1EP8A 4PXOA 2YJ7A 5HQPA 4Z7XA 1M2BA 2HRKA 1PX7A 5G1LA 2LEGA 5L71A 3DVXA 5ECHB 2ES7A 1O8XA 4MZCA 2RIIA 1TW9A 4GXZA 2M72A 3IE3A 4TR1B 3F6FA 5ECPB 1A24A 4CW9A 8GSSA 1THOA 1VF2A 2GSSA 1PKWA 2L4CA 1TDIA 1GSFA 2H70A 2O85A 2YWNA 3KTBA 3VURA 3I69A 1TTZA 1PA3A 2H30A 4EL1A 2H76A 3CSJA 1NSWA 2J23A 4ZB9A 2WFCA 2WS2A 5AISA 1O73A 2JZTA 4KA0A 4AJ8A 5IPGA 2GDRA 2G2QA 2RM6A 1R5AA 2O89A 1G0TA 3IDVA 3IPZA 4F2IA 1PKZA 3F63A 1GUHA 1HQOA 1DSBA 1EOHA 4YQUA 3QFBC 2DSAA 2XBQA 3S9FA 2MMZA 5AIVA 2AUVA 4LL4B 4XHMA 5LD0A 4GF0A 2NPBA 1EEMA 1V9WA 1FHEA 1B8XA 3D21A 2YOIA 3TOUA 2GTUA 2H1AA 2I1UA 5GSTA 3HJPA 3GV1A 2E0QA 3GYKA 3HZ8A 1K0AA 3KCMA 5E4WA 3DRNA 1K3OA 2C1YA 4HOJA 4X0XA 4F03A 1Z6MA 1AW9A 3FKFA 3GKXA 3ZMKA 5G30A 1GL8A 2DLXA 3LEFA 4PQHA 2OBKA 2IMFA 4RUVA 4ISDA 3PGTA 3VI7A 1HNCA 1FB0A 4PURA 4CDOA 1TRVA 1GP1A 3ERWA 4K7NA 1Z9HA 5B8AA 1AXDA 2HYXA 1XZOA 1GWCA 1BAYA 4EUYA 1QMVA 4OFNA 3GH6A 4MF7A 2GSQA 3R3EA 1NW2A 1QK8A 2C0DA 1UA5A 2RM5A 4NXIA 2F3MA 9GSSA 3LYKA 5IQYA 3TJFA 2GT6A 4AJ7A 1V40A 1XW6A 4LMVA 5G5FA 1BJXA 3I43A 4CHSA 4WEYA 3H8QA 1V2AA 2VLUA 1F37A 1K0DA 3NIVA 3HKRA 5H5QA 1PX6A 3VI5A 5DAKB 4LA1A 3HVXA 3VPQA 3UVHA 1YF0A 4XRDA 3RPPA 5J3RA 2VCXA 4GWRA 3GKKA 1A23A 5ELAA 2F8AA 2DMLA 3LWAA 4V2MA 5D93A 1GLQA 1YF1A 2H66A 5J5NA 2MYGA 2PMTA 5B7CA 3GNJA 1GRXA 1EEJA 2B3SA 3CBUA 1XWCA 5HR0A 3QAWA 2F8FA 3IXRA 1B9XC 1WE0A 4MLYA 2VD1A 1UN2A 5IOXA 3DEXA 2H1GA 3RAZA 3MSZA 2B5EA 2V2GA 2I9HA 2VCZA 4HUAA 4MDCA 4J56E 1T00A 3C8EA 3WGEA 4DSSB 1SKRB 2CT6A 2L57A 2WZ9A 1GLPA 2P5QA 4IJIA 3UL3A 1Q4JA 3I9V2 4TR1A 2EC4A 3KGKA 2ZUPA 1SL2B 3FR3A 5KEJA 3M8NA 1FOVA 4OO4A 1GULA 5ECMB 2C8UA 1HNAA 2HRFA 2ZNMA 4NHWA 1XWKA 2HNLA 1WMJA 3L9VA 4XS1A 3FYGA 2IFQA 3GTUB 3CRUA 3WD6A 4IW9A 5CRHA 3VWUA 2AB6A 2LTKA 5DQSA 1JHBA 5EVOA 4ZILA 1A0FA 13GSA 1PL1A 3KM6A 2YNXA 3L9SA 5F8BA 2LNTA 2CX4A 2I81A 20GSA 1AUCA 2QC7A 1EV4A 3L4NA 4V2LA 3G7JA 3QFAC 5ENUA 3GN3A 4ZL7A 1H75A 3PINA 3GUSA 2YZUA 4KSMA 3P8WA 1DE2A 1F9MA 3APQA 3KP9A 2QSIA 5J4UA 4TR4A 3E9JB 2B6MA 5LCZA 22GSA 3F3RA 2O7KA 2CAQA 1PRXA 2TRXA 3F4RA 4O32A 2ALBA 1MDJA 4HDEA 4ZB6A 3HHVA 1GSUA 4I2UA 2JL4A 2WJUA 4O7HA 3GL5A 2H8LA 2L6DA 2FHEA 1ZYEA 4NWYA 4EE0A 1PQNA 2L6CA 2LRNA 2CX3A 3EWLA 5IO2A 5ABRA 2PN8A 1FG4A 2R2JA 3FHKA 3ZFBA 2HT9A 3E3EA 2CVKA 1AIUA 1X9WB 1E2YA 1SK0A 3GX8A 4K6XA 2YCDA 6GSUA 3LXZA 2DMMA 2YV9A 2PERA 3KMOA 4GTUA 1SL0B 2LRTA 2X8GA 4BA7A 3HCZA 4G2EA 2YV7A 5J9CA 5ECIB 1MD4A 2L5LA 1A2JA 1THXA 3H79A 3M0FA 3W8SA 2AAWA 4POMA 2OE1A 1XVWA 5F0GA 2PVQA 3TOTA 2VO4A 3HD5A 3TDGA 4N30A 1PMTA 5DAKA 1SENA 1SD8A 2R37A 3ZIJA 2H1BA 2K6VA 4V1Ag 2F9SA 4G9HA 1U6TA 5A4UA 18GSA 2DIZA 3OR5A 4KSOA 2L59A 4TVEA 1VF4A 1YKAA 3EURA 1ACVA 1GH2A 1OYJA 4L5OA 5IMAA 2JSZA 4MZBA 4GCIA 5G5EA 4PUFC 3PH9A 5CO3A 1C72A 2YWIA 1YJ6A 7GSSA 1N2AA 1XIYA 3ZVJD 3ZTLA 4ID0A 2LNSA 2HXKA 1DBYA 1DE1A 3ERGA 2YN1A 1F3AA 4MABA 1PSQA 4DSSA 1MDKA 2GQKA 1FW1A 3APSA 10GSA 4I6XA 1ZCPA 1PGTA 4NV5A 2M46A 1A8LA 2RLIA 2OE3A 1V58A 2YWOA 3LORA 3QPMA 4QL9A 1X5EA 3RPNA 2HSMB 1EGRA 3LXTA 4L8EA 5ECQB 2CQ9A 4KE3A 5FHIA 5JWRB 1QGVA 4EXJA 4ZIJA 1Z6NA 3KEBA 5ECLB 6GSSA 3LGCA 2LUSA 5EL8A 4TXVA 2AJQB 3GTUA 4RQXA 2RUEA 1K0NA 4N11A 3EINA 4NAXA 5GZZB 3EE2A 1JFUA 1ZYQB 4EDYA 2VCVA 3LG6A 2YJHA 3Q18A 4G0IA 4KF9A 5F06A 2LKUA 3HY2A 2XPEA 5HR2A 5EPFA 2DJ3A 5DCGA 1EGOA 5F07A 4EF0A 2GS3A 1O81A 2DC5A 1AC1A 4QL7A 1T8EB 3G7YA 1ST9A 2IFQB 4OFTA 4EO3A 4LLRA 4KDUA 5DALB 1ML6A 2KP2A 2WCIA 4ECIA 4O92A 5D9TA 1N8JA 1TRSA 4YQVA 3HJOA 2JSYA 2V6KA 5DVBA 2PVOC 3GFKA 1VF3A 4XS6A 5C00A 1QUWA 5ECNB 1OAZA 3UEMA 3HDCA 4MJAA 3GHAA 4MZWA 2BJXA 4OCEA 5JCWA 3LYPA 17GSA 3TCOA 4RI7A 2IPAA 3FZ4A 2H72A 4HQZA 1OC8A 1TKDB 5G2ZA 3C73A 2IWTA 4IQ1A 3J7Yk 2FGXA 4WBJA 1RK4A 2OE0A 4JRRA 1LJRA 4F9ZA 3ZZXA 2VL2C 3TRXA 5B6MA 3TJJA 3HVSA 4TN8A 3CXGA 5D8IA 4JZQA 1SYXA 2DBCA 2V6OA 5INYA 2LQOA 4H86A 4I8BA 1K0MA 1M9BA 1I5GA 5KN0A 1M2DA 2PWJA 1GSYA 1T4YA 2K8SA 3EU4A 1PD21 1W89A 4TR3A 1X5DA 4XCSA 2GZZA 2VL2A 4XS4B 3FZAA 2N5FA 4ECCA 3QR6A 4TR0A 4L0UA 2CZ2A 3TJGA 1JZRA 4PNGA 3P2AA 1ERTA 5ECRB 1FO5A 1OKTA 3GIXA 4BVYB 1U88A 3IOSA 2EIOA 1ZL9A 4JBBA 4I97A 1M9AA 2B5YA 5G31A 1A2LA 3J7Yb 4IVFA 1O8WA 3L9UA 4MCUA 3UVTA 5G1KA 3Q74A 1BEDA 1TOFA 5IMCA 4D73B 3NOFA 5ECKB 2DIYA 3TKRA 2PPTA 1GTAA 3DYRA 1M2AA 2IJYA 2Z9SA 1HYUA 3I6AA 3TGZA 1SK2A 2GSTA 3MAKA 2NDOA 1CQGA 1B48A 2XBIA 3TRPA 3RDWA 5GSSA 1TP9A 5E59A 5IPHA 2HSMA 5D9VA 1A0RP 1ZOFA 5KN1A 4MJBA 5COHA 1SU9A 1FB6A 3G7IA 2O87A 2FWGA 4HJMA 4RI6A 3GURA 4NV2A 1OVNA 4MH3A 1EWXA 3C7MA 2E2GA 1USBA 3ME7A 1XW5A 4HZ4A 3WGDA 2PBJA 4DVCA 3FZ9A 5IMFA 2HSNB 2C3NA 3EVIA 4MPFA 2P5RA 1GTUA 3KJYA 2H6ZA 3GSSA 5ID2B 2H1DA 3LQ7A 1B4QA 2JADA 1J9BA 2LV3A 3F4SA 3BCIA 4HEA2 3VWXA 3KXOA 1YEXA 4TOPA 4MH2A 1JLVA 1GSSA 1WOUA 5DJMA 2KOKA 3D4TA 3CYNA 4GSNA 5CYYA 1X5CA 5FT3A 1J08A 3D4MA 1GTBA 4FIWA 4ILFA 4E8HA 3P7XA 2HRNA 4MK3A 4ZBDA 4AF2A 3EMPA 3KD0A 1O6JA 1URMA 2CVDA 5CRDA 4AJ6A 5DALA 4FQUA 2C0EA 1GUKA 1F2EA 1G7EA 2KP1A 4LMWA 4I5QA 3HA9A 1WIKA 2H74A 3ZREA 4KCAA 3TB2A 4EVMA 4ECJA 1GTIA 3CMIA 1S3AA 1ZZYA 3UAPA 3GA4A 4IHUA 2CZ3A 4K9ZA 1E6BA 2G0FA 4ZXGA 3IV4A 2ZCTA 1YDKA 3L0HA 3FZ5A 3FR6A 4IJ3A 1YY7A 1HD2A 5CRWA 2K9FA 5D73A 1T7PB 3GMFA 3HXSA 3A2XA 3CTGA 2OADA 3M9KA 5KN3A 3WGXA 2FA4A 2H01A 2MZCA 3DXBA 2YPMA 4EC0A 4L5LA 1G6WA 2MMNA 3JCML 3KMNA 4GLTA 2E7PA 3DGQA 2H73A 2PU9C 4G0LA 5ECOB 2GQMA 3M9JA 1SK1A 4JR4A 1OE8A 4ACSA 3UBLA 2PGTA 2C0FA 1KBNA 2GLRA 4XS4A 1KEBA 2FUG2 5B6NA 2VAFA 2C0GA 3AY8A 4GQCA 3D0ZA 3PPUA 4NMUA 5IM9A 4MF5A 2REMA 4ULXA 2YZHA 2R6KA 4BVYA 4PNFA 1B9YC 4ECBA 2PUKC 4DSQA 3M1GA 2GZYA 2YANA 4TW5A 1IYIA 1NHYA 1KTEA 3ZRDA 3VPTA 1XWBA 3IBHA 4K0NA 5D9WA 2HSYA 2FWHA 3EU3A 1OKDA 3TKSE 2X8HA 3O6TA 4D73A 2HRAA 2JACA 1TI1A 3N5OA 2VM1A 2A2SA 3KIJA 2AHEA 4PX1A 4IGJA 3BD2A 1ERVA 5DQYA 1NHOA 4WXTA 1Z3EA 2X8CA 3O3TA 5A4VA 1R7HA 3P90A 1Y25A 1U87A 4IN0A 5IO0A 5JWOB 1XXUA 5CRGA 2H75A 3EMXA 5D9XA 3LFLA 4FH8A 3FEUA 19GSA 1X9MB 3DMLA 2LQQA 3C1RA 3DKSA 4MJCA 3ZL5A 3VFIA 3ED3A 3HYPA 2R5GA 1M0UA 4ZBBA 3DWVA 1Q98A 3DVWA 3HVVA 2B1KA 2GSRA 5DBQA 3QCPA 4ZBAA 3F9UA 1A2MA 3ZFLA 1LBKA 4KH7A 1XVQA 2YP6A 3V1WA 3IK7A 5ID2A 1V98A 1LU4A 2HZFA 1TI3A 3KTLA 2TRCP 5CNWA 2KHPA 2J9HA 4KW6A 2FA8A 4ZL8A 3MWHA 3CTFA 2H0HA 1TU8A 1SL1B 1XOAA 3APOA 2RUFA 2HLSA 1RW1A 4Q5QA 3TJBA 4IQAA 1TJDA 1BG5A 4HZ2A 2P0GA 3BCKA 4L0WA 2L5OA 1EZKA 4IS0A 2A4VA 3D22A 4TXOB 4POKA 3O76A 3QMXA 1TRUA 4WF4A 1R5PA 1G6YA 4F82A 2ON5A 2V32A 5D96A 5B8BA 5AN1A 3WYWA 4N0ZA 3KZQA 2B1LA 4GQFA 2UZ8A 1F3BA 4ZL9A 1XWAA 1R4WA 3BBYA 1M7TA 1EP7A 4NHZA 2DJJA 1YKCA 3Q19A 4O5RA 5F05A 1VGLA 2JZRA 5HFGA 1XOBA 3CRTA 1WPIA 1Z7PA 2DJ0A 3F3QA 2B5XA 1OC9B 3VK9A 4FYCA 2YWMA 3UARA 4EDZA 5IOWA 3ERFA 2E2MA 2LJRA 1AAZA 2BMXA 3RBTA 4KAEA 1H4OA 3TJKA 3A5WA 5ELGA 4G19A 6GSVA 5GAPD 1HNBA 2MMAA 3UBKA 4BVXB 3ZLPA 3EC3A 1GSDA 1NM3A 2HFDA 1WP0A 4DSRA 3H1NA 2OKAA 4ML1A 5HR3A 5IMZA 4X43A 1SYRA 1G7OA 2X99A 4BPYA 1BQ7A 4TKYA 4JR6A 3IHQA 1SKSB 2M80A 3ZITA 4OCFA 3IA1A 5EY6A 2B7KA 1SJIA 1TK5B 2V41A 3FK8A 3IR4A 4XRAA 2C3TA 4BL7B 3UJ1A 4HU9A 1O7UA 2VLTA 5GAND 4OO5A 3SWLA 1PN9A 1GNEA 2HE3A 1F6MC 4KNDA 4OD7A 5H5RA 3NZNA 4TRXA 2AYTA 2IMDA 3VWWA 3TKSC 1MDIA 1OE7A 2EIRA 3HJMA 1GUMA 2GQLA 1U3AA 1K0CA 1Z7RA 3A2WA 3TKPA 4KUNA 1OC3A 3ZYWA 4MJEA 4IKHA 1TRWA 3UIWA 1U3IA 3FW2A 3F8UA 2LJAA 2LJKA 2FD3A 1EV9A 1FAAA 2WRTA 2IMEA 1S3CA 5JWQB 2VLVA 2ON7A 3BOAA 2FWFA 4KDXA 3L78A 4YQMA 4GSSA 4YAPA 4YAVA 4ML6A 2CAIA 2R3XA 3TKSA 3FRCA 3SBCA 3GRXA 2JZSA 4OMVA 1ERUA 1SD9A 4IBPA 4E8EA 1QQ2A 2B7JA 2VUPA 4J57E 4YH2A 3IC8A 3LJRA 4KB3A 3BJ5A 2CV4A 2NVLA 2GGTA 2I4AA 6GSYA 3VLNA 2GVPA 4MP4A 3IC4A 2QGVA 4LL1B 5J9BA 3U5RE 3E0UA 4K8MA 3PR8A 2QKEA 4K2DA 1YEPA 2GT5A 4I2TA 3KH9A 3FR9A 1SKWB 2F51A 3TRQA 2WGRA 5AGYA 5C04A 3C71A 1BYEA 2MMOA 4K1FA 1ERWA 3GH9A 4V1Ap 2EIQA 1QFNA 2XC2A 4XIHA 4IP6A 5HFKA 2FCHA 2O8VB 2TIRA 4TXOA 1I9DA 3ME8A
chains in the Genus database with same CATH superfamily
3FY7A 2HSHA 3A2VA 2HZEB 1O85A 4KGIA 4RQRA 3N9JA 1XCCA 2OA7A 4JEDA 4Q5RA 3WT2A 1JZDA 1GSEA 4WKWA 2HQTA 2OT3A 1VRSD 2DJKA 2VCTA 2DJ2A 6GSXA 3GL3A 4FYUA 4QQ7A 1IYHA 5FWGA 1ON4A 3C1SA 2HI7A 1TK0B 4K7IA 2I3YA 1OC9A 1BX9A 2N5AA 3HZ4A 2FY6A 4WETA 1FVJA 3U6VA 4GSTA 1W4VA 3R2QA 4FO5A 2C3QA 2IMIA 3IRAA 2IIYA 4N0VA 1MTCA 4MF6A 5HFIA 2MBTA 3W8JA 4ZB8A 4K7OA 4F0CA 16GSA 2VIMA 4BVXA 3CSHA 1X0RA 5DCHA 2HRKB 1AQXA 1T4ZA 1DUGA 2FLSA 1J0FA 3QDNA 3M3MA 2EFEA 4Q5NA 1S3DA 2C4JA 3DD3A 4CY6A 3D5JA 4AGSA 4X1UA 5IMDA 4OWYA 1KNGA 1WJKA 1SJZA 3UOMA 1XBSA 14GSA 2DJ1A 3F4TA 1VF1A 3QAGA 4YKFA 2K8VA 4BL7A 4BWQA 1SJ6A 4F0BA 6GSTA 5CP1A 2LRCA 1K0BA 3CHXC 3IAS2 4WR5A 2H71A 2VCWA 5DJLA 2VL3A 1V57A 2AV4A 3GSTA 2IL3A 1Z5YE 1SVOA 1JLWA 3A3TA 2VOCA 1ZMAA 3K8NA 1K0OA 1UC7A 1T3BA 1Y6EA 3KH7A 1TXXA 4O5UA 3RHCA 5HR1A 3F6DA 2FNOA 4KX4A 2NBSA 3VWVA 3ISOA 2XPDA 1A8YA 4HI7A 2MBSA 2L4QA 1ABAA 3GKMA 1PL2A 5J41A 4KCEA 6GSWA 3F0IA 5AIXA 5A5KA 4PUAA 4USSA 4WR4A 5DDLA 4BWSA 2IN3A 2H6YA 3US3A 3CSIA 3TKQA 1K3LA 2H6XA 4POLA 5KN2A 4JE1A 5A1NB 3MDKA 5JCUA 5H5SA 2OACA 11GSA 1AQVA 1K3YA 4N10A 2VM2A 1GNWA 2WVXB 3ZMLA 4POBA 1YQ1A 1MD3A 1XPVA 3QOUA 5LNKe 4OFMA 1T1VA 4MA9A 4Q5FA 2X64A 2WW2A 1WRYA 4EIQA 4KDYA 3W6GA 1B4PA 4FYBA 4P3YB 3IK9A 4HJ2A 4MPGA 4NPBA 2GZPA 2H19A 3KP8A 1UVZA 5ECSA 2D2ZA 2H1LA 1RQMA 2O3EA 4HU7A 3IAM2 2WDUA 2C80A 4MMMA 3H93A 3G9BA 2H0GA 3GKNA 12GSA 3QAVA 1FVKA 1XFLA 1R26A 2H0IA 2KUCA 4PGTA 4PQIA 3EYTA 2LS5A 4PTSA 4JU5A 1X9SB 2LSTA 2O36A 5BMUA 2NTOA 2VL9A 1ILOA 2FWEA 5JCGA 4IELA 3RHBA 3GX0A 2P31A 2XHFA 2KLXA 3QD9A 4AKGA 1WWJA 3MNGA 2BTOT 3H4KA 2N5BA 1M99A 2WW1A 4G0KA 1EOGA 3CWGA 3UMAA 1MEKA 5J47A 3EPTA 4PQ1A 4V2NA 4FXYP 5IIZA 2WB9A 5A4WA 3Q6OA 1JZOA 5CREA 5IMVA 1YZXA 4G10A 2WULA 2HZEA 4GRFA 2V1MA 1GSQA 2A2RA 1TK8B 2CA8A 2OJLA 3IHGA 2CVBA 4DEJA 4J2FA 2OBIA 3LSZA 4AKIA 5CAXA 4EKZA 2R4VA 1XWGA 1CQHA 4W66A 4K0GA 3WT1A 1SVMA 3ZIVA 1AQWA 2JU5A 1TU7A 2K18A 4HS1A 2IMKA 3ZVJA 1QXHA 4WBRD 3TUEA 1JZWA 2VCQA 3D6IA 4WF5A 1XW9A 4IP1A 3DIEA 4HQSA 1ZGNA 2VD0A 1Y1UA 4XTSA 1EP8A 2A2PA 4PXOA 2YJ7A 5HQPA 4Z7XA 1M2BA 2HRKA 1PX7A 5G1LA 2LEGA 5L71A 3DVXA 5ECHB 2ES7A 1O8XA 4MZCA 2RIIA 1TW9A 4GXZA 2M72A 3IE3A 4TR1B 3F6FA 5ECPB 1A24A 4CW9A 8GSSA 1THOA 1VF2A 2GSSA 1PKWA 2L4CA 1TDIA 1GSFA 2H70A 2O85A 2YWNA 3KTBA 3VURA 3I69A 1TTZA 1PA3A 2H30A 4EL1A 2H76A 2A4HA 3CSJA 1NSWA 2J23A 4ZB9A 2WFCA 2WS2A 5AISA 1O73A 2JZTA 4KA0A 4AJ8A 5IPGA 2GDRA 2G2QA 2RM6A 1R5AA 2O89A 1G0TA 3IDVA 3IPZA 4F2IA 1PKZA 3F63A 4PI2C 1GUHA 1HQOA 1DSBA 1EOHA 4YQUA 3QFBC 2DSAA 2XBQA 3S9FA 2MMZA 5AIVA 2AUVA 4LL4B 4XHMA 5LD0A 4GF0A 2NPBA 1EEMA 1V9WA 1FHEA 1B8XA 3D21A 2YOIA 3TOUA 2GTUA 5A1NA 2H1AA 2I1UA 5GSTA 2O5VA 3HJPA 3GV1A 2WVXA 2E0QA 3GYKA 3HZ8A 1K0AA 3KCMA 5E4WA 1PN0A 3DRNA 1K3OA 4AKXB 2C1YA 4HOJA 4X0XA 4F03A 1Z6MA 1AW9A 3FKFA 3FMWA 3GKXA 3ZMKA 5G30A 1GL8A 2DLXA 3LEFA 4PQHA 2OBKA 2WVYA 2IMFA 4RUVA 4ISDA 3PGTA 3VI7A 1HNCA 1FB0A 4PURA 4CDOA 1TRVA 1GP1A 3ERWA 4K7NA 1Z9HA 5B8AA 1AXDA 2HYXA 1XZOA 1GWCA 1BAYA 4EUYA 1QMVA 4OFNA 5BRTA 3GH6A 4MF7A 2GSQA 3R3EA 1NW2A 1QK8A 2C0DA 1UA5A 2RM5A 4NXIA 2F3MA 9GSSA 4BIKA 3LYKA 5IQYA 3TJFA 2GT6A 4AJ7A 1V40A 1XW6A 4AI6A 4LMVA 5G5FA 1BJXA 3I43A 4CHSA 4WEYA 3H8QA 1V2AA 2VLUA 1F37A 1K0DA 3NIVA 3HKRA 5H5QA 1PX6A 3VI5A 5DAKB 4LA1A 3HVXA 3VPQA 3UVHA 1YF0A 4XRDA 3RPPA 5J3RA 2VCXA 4GWRA 3GKKA 1A23A 5ELAA 2F8AA 2DMLA 3LWAA 4V2MA 5D93A 1GLQA 1YF1A 2H66A 5J5NA 2MYGA 2PMTA 5B7CA 3GNJA 4YKGA 1GRXA 1EEJA 2B3SA 3CBUA 1XWCA 5HR0A 3QAWA 2F8FA 3IXRA 1B9XC 1WE0A 4MLYA 2VD1A 1UN2A 5IOXA 3DEXA 2H1GA 3RAZA 3MSZA 2B5EA 2V2GA 1BF5A 2I9HA 2VCZA 3TU3B 4HUAA 4MDCA 4J56E 1T00A 3C8EA 3WGEA 4DSSB 1SKRB 2CT6A 2L57A 2WZ9A 1GLPA 2P5QA 4K5SA 4IJIA 3UL3A 1Q4JA 3I9V2 4TR1A 2EC4A 3KGKA 2ZUPA 1SL2B 1M3JA 3FR3A 5KEJA 3M8NA 1FOVA 4OO4A 1GULA 5ECMB 2C8UA 1XG8A 1HNAA 2HRFA 2ZNMA 4NHWA 1XWKA 2HNLA 1WMJA 3L9VA 4XS1A 3FYGA 2IFQA 3GTUB 3CRUA 3WD6A 4IW9A 5CRHA 3VWUA 2AB6A 2LTKA 5DQSA 1JHBA 5EVOA 1FOHA 4ZILA 1A0FA 13GSA 1PL1A 3KM6A 4A5PA 2YNXA 3L9SA 5F8BA 2LNTA 2CX4A 2I81A 20GSA 1AUCA 2QC7A 1EV4A 3L4NA 4V2LA 3G7JA 3QFAC 5ENUA 3GN3A 4ZL7A 1H75A 3PINA 3GUSA 2YZUA 4KSMA 4X4JA 3P8WA 1DE2A 1F9MA 3APQA 3KP9A 2QSIA 5J4UA 4TR4A 3E9JB 2B6MA 5LCZA 22GSA 3F3RA 2O7KA 2CAQA 1PRXA 2TRXA 3F4RA 4O32A 2ALBA 1MDJA 4HDEA 4ZB6A 3HHVA 1GSUA 4I2UA 2JL4A 3RGBC 2WJUA 4O7HA 3GL5A 2H8LA 2L6DA 2FHEA 1ZYEA 4NWYA 4EE0A 1PQNA 3MYDA 2L6CA 2LRNA 2CX3A 3EWLA 5IO2A 5ABRA 2PN8A 1FG4A 2R2JA 2X49A 3FHKA 3ZFBA 2HT9A 3E3EA 2CVKA 1AIUA 1X9WB 1E2YA 1SK0A 3GX8A 4K6XA 2YCDA 6GSUA 3LXZA 2DMMA 2YV9A 2PERA 3KMOA 5A5HB 4GTUA 1SL0B 2LRTA 2X8GA 4BA7A 3HCZA 4G2EA 2YV7A 3HVNA 5J9CA 5ECIB 1MD4A 2L5LA 1A2JA 1THXA 3H79A 3M0FA 3W8SA 2AAWA 4POMA 2OE1A 1XVWA 5F0GA 5J40A 2PVQA 3TOTA 4K2XA 2VO4A 3HD5A 4EIPA 3TDGA 4N30A 1PMTA 5DAKA 1SENA 1SD8A 2R37A 3ZIJA 2H1BA 2K6VA 4V1Ag 2F9SA 4G9HA 1U6TA 5A4UA 18GSA 2DIZA 3OR5A 4KSOA 2L59A 4TVEA 1VF4A 1YKAA 3EURA 1ACVA 1GH2A 1OYJA 4L5OA 5IMAA 2JSZA 4AKHA 4MZBA 4Z2TA 4GCIA 5G5EA 4PUFC 3PH9A 5CO3A 1C72A 3A5IA 2YWIA 1YJ6A 7GSSA 1N2AA 1XIYA 3ZVJD 3ZTLA 4ID0A 2LNSA 1SVLA 2HXKA 1DBYA 1DE1A 3ERGA 2YN1A 1F3AA 4MABA 1PSQA 4DSSA 1MDKA 2GQKA 1FW1A 2WW0A 3APSA 10GSA 4I6XA 1ZCPA 1PGTA 4NV5A 4E68A 2M46A 1A8LA 2RLIA 2OE3A 1V58A 2YWOA 2VKZG 3LORA 3QPMA 4QL9A 1X5EA 3RPNA 2HSMB 1EGRA 2WVZA 3LXTA 4L8EA 2EFDA 5ECQB 2CQ9A 4KE3A 5FHIA 5JWRB 1QGVA 4EXJA 4ZIJA 1Z6NA 3KEBA 5ECLB 6GSSA 3LGCA 2LUSA 5EL8A 4TXVA 2AJQB 3GTUA 4RQXA 2RUEA 1K0NA 2QA2A 4N11A 3EINA 4NAXA 5GZZB 3EE2A 1JFUA 1ZYQB 4EDYA 2VCVA 3LG6A 2YJHA 5KOXA 3Q18A 4G0IA 4KF9A 5F06A 2LKUA 3HY2A 2X4AA 2XPEA 5HR2A 5EPFA 2DJ3A 5DCGA 1EGOA 5F07A 4EF0A 2GS3A 1O81A 2DC5A 4CY8A 1AC1A 4QL7A 1T8EB 3G7YA 1ST9A 2IFQB 4OFTA 4EO3A 4LLRA 4KDUA 5DALB 1ML6A 2KP2A 2WCIA 4ECIA 4O92A 5D9TA 1N8JA 1TRSA 4YQVA 3HJOA 2JSYA 2V6KA 5DVBA 2PVOC 3GFKA 1VF3A 4XS6A 5C00A 1QUWA 5ECNB 1OAZA 3UEMA 3HDCA 4MJAA 3GHAA 3LW9A 4MZWA 2BJXA 4OCEA 5JCWA 2R0CA 3LYPA 17GSA 3TCOA 4RI7A 2IPAA 3FZ4A 2H72A 4HQZA 1OC8A 1TKDB 3CQFA 5G2ZA 3C73A 2IWTA 4IQ1A 3J7Yk 2FGXA 4WBJA 2UV8G 1RK4A 2OE0A 4JRRA 1LJRA 4F9ZA 3ZZXA 2VL2C 4Z2UA 3TRXA 5B6MA 3TJJA 3HVSA 3MIXA 4TN8A 3CXGA 5D8IA 4JZQA 5A5HA 1SYXA 2DBCA 2V6OA 5INYA 2LQOA 4H86A 4I8BA 1K0MA 1M9BA 1I5GA 4QMKA 5KN0A 1M2DA 2PWJA 1GSYA 1T4YA 2K8SA 3EU4A 1PD21 1W89A 4TR3A 1X5DA 4XCSA 2GZZA 2VL2A 4XS4B 3FZAA 2N5FA 4ECCA 4N3ZA 3QR6A 4TR0A 4L0UA 2CZ2A 3TJGA 1JZRA 4PNGA 2DKIA 3P2AA 1ERTA 5ECRB 1FO5A 4G01A 1OKTA 3GIXA 4BVYB 1U88A 3IOSA 2EIOA 1ZL9A 4JBBA 4I97A 1M9AA 2B5YA 5G31A 1S3RA 1A2LA 3J7Yb 4IVFA 1O8WA 3L9UA 4MCUA 3UVTA 5G1KA 3Q74A 1BEDA 1TOFA 5IMCA 4D73B 3NOFA 5ECKB 2DIYA 3TKRA 2PPTA 1GTAA 3DYRA 1M2AA 2IJYA 2Z9SA 1HYUA 3I6AA 3TGZA 1SK2A 2R0GA 2GSTA 3MAKA 2NDOA 1CQGA 1B48A 2XBIA 3TRPA 3RDWA 5GSSA 1TP9A 5E59A 5IPHA 2HSMA 5D9VA 1A0RP 1ZOFA 5KN1A 4MJBA 5COHA 1SU9A 1FB6A 3G7IA 2O87A 2FWGA 4HJMA 4RI6A 3GURA 4NV2A 1OVNA 1N25A 4MH3A 1EWXA 3C7MA 2E2GA 1USBA 3ME7A 1XW5A 4HZ4A 3WGDA 2PBJA 4DVCA 3FZ9A 5IMFA 2HSNB 2C3NA 3EVIA 4MPFA 2P5RA 1GTUA 3KJYA 2H6ZA 3GSSA 5ID2B 2H1DA 3LQ7A 1B4QA 2JADA 1J9BA 2LV3A 3F4SA 3BCIA 4HEA2 3VWXA 3KXOA 1YEXA 4TOPA 4MH2A 1JLVA 1GSSA 1WOUA 5DJMA 2KOKA 3D4TA 3CYNA 4GSNA 5CYYA 1X5CA 5FT3A 1J08A 3D4MA 1GTBA 4FIWA 4ILFA 3HMJG 4E8HA 3P7XA 2HRNA 4MK3A 4ZBDA 2WW3A 4AF2A 3EMPA 3KD0A 1O6JA 1URMA 2CVDA 5CRDA 4AJ6A 5DALA 4FQUA 2C0EA 1GUKA 1F2EA 1G7EA 2KP1A 4LMWA 4I5QA 3HA9A 1WIKA 2H74A 3ZREA 4KCAA 3TB2A 2R0PA 4EVMA 4ECJA 1YEWC 1GTIA 3CMIA 1S3AA 1ZZYA 3UAPA 5A34B 3GA4A 4IHUA 2CZ3A 4K9ZA 1E6BA 2G0FA 3RFRC 4ZXGA 3IV4A 2ZCTA 1YDKA 3L0HA 3FZ5A 3FR6A 4IJ3A 1YY7A 1PFOA 1HD2A 5CRWA 4MNNA 2K9FA 5KOWA 5D73A 1T7PB 3GMFA 3HXSA 3A2XA 5J4YA 3CTGA 2OADA 3M9KA 5KN3A 3WGXA 2FA4A 2H01A 2MZCA 3DXBA 2YPMA 4EC0A 4HSCX 4L5LA 1G6WA 2MMNA 3JCML 3KMNA 4GLTA 2E7PA 3DGQA 2H73A 2PU9C 4G0LA 5ECOB 2GQMA 3M9JA 1SK1A 4JR4A 1OE8A 4ACSA 3UBLA 2PGTA 2C0FA 1KBNA 2GLRA 4XS4A 1KEBA 2FUG2 5B6NA 1M3IA 2VAFA 2C0GA 3AY8A 4GQCA 3D0ZA 3PPUA 4NMUA 5IM9A 4MF5A 2REMA 4ULXA 2YZHA 2R6KA 4BVYA 4PNFA 1B9YC 4ECBA 2PUKC 4DSQA 3M1GA 2GZYA 2YANA 4TW5A 1IYIA 1NHYA 1KTEA 3ZRDA 4PI0C 3VPTA 1XWBA 3IBHA 4K0NA 5D9WA 2HSYA 2FWHA 3EU3A 1OKDA 3TKSE 2X8HA 3O6TA 4D73A 1ZYNA 2HRAA 2JACA 1TI1A 3N5OA 2VM1A 2A2SA 3KIJA 2AHEA 4PX1A 4IGJA 3BD2A 1ERVA 5DQYA 1NHOA 4WXTA 1Z3EA 2X8CA 3O3TA 5A4VA 1R7HA 3P90A 1Y25A 1U87A 4IN0A 5IO0A 5JWOB 1XXUA 5CRGA 2H75A 3EMXA 5D9XA 3LFLA 4FH8A 3FEUA 19GSA 1X9MB 3DMLA 2LQQA 3C1RA 3DKSA 4MJCA 4O5QA 3ZL5A 3VFIA 3ED3A 3HYPA 2R5GA 1M0UA 4ZBBA 3DWVA 1Q98A 3DVWA 3HVVA 2B1KA 2GSRA 2HSNA 5DBQA 3QCPA 4ZBAA 3F9UA 1A2MA 3ZFLA 1LBKA 4KH7A 1XVQA 2YP6A 4ZB7A 3V1WA 3IK7A 5ID2A 1V98A 1LU4A 2HZFA 5J4VA 1TI3A 3KTLA 2TRCP 5CNWA 1TXUA 2KHPA 2J9HA 4KW6A 2FA8A 4ZL8A 3MWHA 3CTFA 2H0HA 1TU8A 1SL1B 1XOAA 3APOA 2RUFA 2HLSA 1RW1A 4Q5QA 3TJBA 2QA1A 4IQAA 1TJDA 1BG5A 4HZ2A 2P0GA 3BCKA 2WZSA 4L0WA 2L5OA 1EZKA 4ICYA 4IS0A 2A4VA 3D22A 4TXOB 4POKA 3O76A 3QMXA 1TRUA 4WF4A 2EFCA 2EFHA 1R5PA 1G6YA 4F82A 2ON5A 2V32A 5D96A 5B8BA 5AN1A 3WYWA 4N0ZA 3KZQA 2B1LA 4K5RA 4GQFA 2UZ8A 1F3BA 4ZL9A 1XWAA 1R4WA 3BBYA 1M7TA 1EP7A 4NHZA 2DJJA 5A34A 1YKCA 3Q19A 4O5RA 5F05A 1VGLA 2JZRA 5HFGA 1XOBA 3CRTA 1WPIA 1Z7PA 2DJ0A 3F3QA 2B5XA 1OC9B 3VK9A 4FYCA 2YWMA 3UARA 4EDZA 5IOWA 3ERFA 2E2MA 2LJRA 1AAZA 2BMXA 3RBTA 4KAEA 1H4OA 3TJKA 3A5WA 4PHZC 5ELGA 4G19A 6GSVA 5GAPD 1HNBA 2MMAA 3UBKA 4BVXB 3ZLPA 3EC3A 1GSDA 1NM3A 2HFDA 1WP0A 4DSRA 3H1NA 2OKAA 4ML1A 5HR3A 5IMZA 4X43A 1SYRA 1G7OA 2X99A 4BPYA 1BQ7A 4TKYA 4JR6A 3IHQA 1SKSB 2M80A 4Z2RA 3ZITA 2DKHA 4OCFA 3IA1A 5EY6A 2B7KA 1SJIA 1TK5B 2V41A 3FK8A 3IR4A 4XRAA 2C3TA 4BL7B 1YVLA 3UJ1A 4HU9A 1O7UA 2VLTA 5GAND 4OO5A 3SWLA 1PN9A 1GNEA 2HE3A 1F6MC 4KNDA 4OD7A 5H5RA 3NZNA 4TRXA 2AYTA 2IMDA 3VWWA 3TKSC 1MDIA 1OE7A 2EIRA 3HJMA 4GDFA 1GUMA 2GQLA 1U3AA 1K0CA 1Z7RA 3A2WA 3TKPA 4KUNA 1OC3A 3ZYWA 4MJEA 4IKHA 1TRWA 3UIWA 1U3IA 3FW2A 1ZYPA 3F8UA 2LJAA 2LJKA 2FD3A 1EV9A 1FAAA 2WRTA 2IMEA 1S3CA 5JWQB 1S4BP 2ON7A 2VLVA 3BOAA 2FWFA 4KDXA 3L78A 4YQMA 4GSSA 4YAPA 4YAVA 4ML6A 2CAIA 2R3XA 3TKSA 3FRCA 3SBCA 3GRXA 2JZSA 4OMVA 1ERUA 1SD9A 4IBPA 4E8EA 1QQ2A 2B7JA 2VUPA 4J57E 4YH2A 3IC8A 3LJRA 4KB3A 3BJ5A 2CV4A 2NVLA 1I1IP 2GGTA 2I4AA 6GSYA 3VLNA 2GVPA 4MP4A 3IC4A 2QGVA 4LL1B 5J9BA 3U5RE 3E0UA 4K8MA 3PR8A 2QKEA 4K2DA 1BG1A 1YEPA 2GT5A 4I2TA 3KH9A 3FR9A 1SKWB 2F51A 3TRQA 5BMUB 2WGRA 5AGYA 5C04A 3C71A 1BYEA 2MMOA 4K1FA 1ERWA 3GH9A 4V1Ap 2EIQA 1QFNA 2XC2A 4XIHA 4IP6A 5HFKA 2FCHA 2O8VB 2TIRA 4TXOA 1I9DA 3ME8A
chains in the Genus database with same CATH topology
3FY7A 2HSHA 3A2VA 2HZEB 1O85A 4KGIA 4RQRA 3N9JA 1XCCA 2OA7A 4JEDA 4Q5RA 3WT2A 1JZDA 1GSEA 4WKWA 2HQTA 2OT3A 1VRSD 2DJKA 2VCTA 2DJ2A 6GSXA 3GL3A 4FYUA 4QQ7A 1IYHA 5FWGA 1ON4A 3C1SA 2HI7A 1TK0B 4K7IA 2I3YA 1OC9A 1BX9A 2N5AA 3HZ4A 2FY6A 4WETA 1FVJA 3U6VA 4GSTA 1W4VA 3R2QA 4FO5A 2C3QA 2IMIA 3IRAA 2IIYA 4N0VA 1MTCA 4MF6A 5HFIA 2MBTA 3W8JA 4ZB8A 4K7OA 4F0CA 16GSA 2VIMA 4BVXA 3CSHA 1X0RA 5DCHA 2HRKB 1AQXA 1T4ZA 1DUGA 2FLSA 1J0FA 3QDNA 3M3MA 2EFEA 4Q5NA 1S3DA 2C4JA 3DD3A 4CY6A 3D5JA 4AGSA 4X1UA 5IMDA 4OWYA 1KNGA 1WJKA 1SJZA 3UOMA 1XBSA 14GSA 2DJ1A 3F4TA 1VF1A 3QAGA 4YKFA 2K8VA 4BL7A 4BWQA 1SJ6A 4F0BA 6GSTA 5CP1A 2LRCA 1K0BA 3IAS2 4WR5A 2H71A 2VCWA 5DJLA 2VL3A 1V57A 2AV4A 3GSTA 2IL3A 1Z5YE 1SVOA 1JLWA 3A3TA 2VOCA 1ZMAA 3K8NA 1K0OA 1UC7A 1T3BA 1Y6EA 3KH7A 1TXXA 4O5UA 3RHCA 5HR1A 3F6DA 2FNOA 4KX4A 2NBSA 3VWVA 3ISOA 2XPDA 1A8YA 4HI7A 2MBSA 2L4QA 1ABAA 3GKMA 1PL2A 5J41A 4KCEA 6GSWA 3F0IA 5AIXA 5A5KA 4PUAA 4USSA 4WR4A 5DDLA 4BWSA 2IN3A 2H6YA 3US3A 3CSIA 3TKQA 1K3LA 2H6XA 4POLA 5KN2A 4JE1A 5A1NB 3MDKA 5JCUA 5H5SA 2OACA 11GSA 1AQVA 1K3YA 4N10A 2VM2A 1GNWA 3ZMLA 4POBA 1YQ1A 1MD3A 1XPVA 3QOUA 5LNKe 4OFMA 1T1VA 4MA9A 4Q5FA 2X64A 1WRYA 4EIQA 4KDYA 3W6GA 1B4PA 4FYBA 4P3YB 3IK9A 4HJ2A 4MPGA 4NPBA 2GZPA 2H19A 3KP8A 1UVZA 5ECSA 2D2ZA 2H1LA 1RQMA 4HU7A 3IAM2 2WDUA 2C80A 4MMMA 3H93A 3G9BA 2H0GA 3GKNA 12GSA 3QAVA 1FVKA 1XFLA 1R26A 2H0IA 2KUCA 4PGTA 4PQIA 3EYTA 2LS5A 4PTSA 4JU5A 1X9SB 2LSTA 5BMUA 2NTOA 2VL9A 1ILOA 2FWEA 5JCGA 4IELA 3RHBA 3GX0A 2P31A 2XHFA 2KLXA 3QD9A 4AKGA 1WWJA 3MNGA 2BTOT 3H4KA 2N5BA 1M99A 4G0KA 1EOGA 3CWGA 3UMAA 1MEKA 5J47A 3EPTA 4PQ1A 4V2NA 5IIZA 2WB9A 5A4WA 3Q6OA 1JZOA 5CREA 5IMVA 1YZXA 4G10A 2WULA 2HZEA 4GRFA 2V1MA 1GSQA 2A2RA 1TK8B 2CA8A 2OJLA 3IHGA 2CVBA 4DEJA 4J2FA 2OBIA 3LSZA 4AKIA 5CAXA 4EKZA 2R4VA 1XWGA 1CQHA 4W66A 4K0GA 3WT1A 1SVMA 3ZIVA 1AQWA 2JU5A 1TU7A 2K18A 4HS1A 2IMKA 3ZVJA 1QXHA 4WBRD 3TUEA 1JZWA 2VCQA 3D6IA 4WF5A 1XW9A 4IP1A 3DIEA 4HQSA 1ZGNA 2VD0A 1Y1UA 4XTSA 1EP8A 2A2PA 4PXOA 2YJ7A 5HQPA 4Z7XA 1M2BA 2HRKA 1PX7A 5G1LA 2LEGA 5L71A 3DVXA 5ECHB 2ES7A 1O8XA 4MZCA 2RIIA 1TW9A 4GXZA 2M72A 3IE3A 4TR1B 3F6FA 5ECPB 1A24A 4CW9A 8GSSA 1THOA 1VF2A 2GSSA 1PKWA 2L4CA 1TDIA 1GSFA 2H70A 2O85A 2YWNA 3KTBA 3VURA 3I69A 1TTZA 1PA3A 2H30A 4EL1A 2H76A 2A4HA 3CSJA 1NSWA 2J23A 4ZB9A 2WFCA 2WS2A 5AISA 1O73A 2JZTA 4KA0A 4AJ8A 5IPGA 2GDRA 2G2QA 2RM6A 1R5AA 2O89A 1G0TA 3IDVA 3IPZA 4F2IA 1PKZA 3F63A 1GUHA 1HQOA 1DSBA 1EOHA 4YQUA 3QFBC 2DSAA 2XBQA 3S9FA 2MMZA 5AIVA 2AUVA 4LL4B 4XHMA 5LD0A 4GF0A 2NPBA 1EEMA 1V9WA 1FHEA 1B8XA 3D21A 2YOIA 3TOUA 2GTUA 5A1NA 2H1AA 2I1UA 5GSTA 2O5VA 3HJPA 3GV1A 2E0QA 3GYKA 3HZ8A 1K0AA 3KCMA 5E4WA 1PN0A 3DRNA 1K3OA 4AKXB 2C1YA 4HOJA 4X0XA 4F03A 1Z6MA 1AW9A 3FKFA 3FMWA 3GKXA 3ZMKA 5G30A 1GL8A 2DLXA 3LEFA 4PQHA 2OBKA 2IMFA 4RUVA 4ISDA 3PGTA 3VI7A 1HNCA 1FB0A 4PURA 4CDOA 1TRVA 1GP1A 3ERWA 4K7NA 1Z9HA 5B8AA 1AXDA 2HYXA 1XZOA 1GWCA 1BAYA 4EUYA 1QMVA 4OFNA 5BRTA 3GH6A 4MF7A 2GSQA 3R3EA 1NW2A 1QK8A 2C0DA 1UA5A 2RM5A 4NXIA 2F3MA 9GSSA 3LYKA 5IQYA 3TJFA 2GT6A 4AJ7A 1V40A 1XW6A 4AI6A 4LMVA 5G5FA 1BJXA 3I43A 4CHSA 4WEYA 3H8QA 1V2AA 2VLUA 1F37A 1K0DA 3NIVA 3HKRA 5H5QA 1PX6A 3VI5A 5DAKB 4LA1A 3HVXA 3VPQA 3UVHA 1YF0A 4XRDA 3RPPA 5J3RA 2VCXA 4GWRA 3GKKA 1A23A 5ELAA 2F8AA 2DMLA 3LWAA 4V2MA 5D93A 1GLQA 1YF1A 2H66A 5J5NA 2MYGA 2PMTA 5B7CA 3GNJA 4YKGA 1GRXA 1EEJA 2B3SA 3CBUA 1XWCA 5HR0A 3QAWA 2F8FA 3IXRA 1B9XC 1WE0A 4MLYA 2VD1A 1UN2A 5IOXA 3DEXA 2H1GA 3RAZA 3MSZA 2B5EA 2V2GA 1BF5A 2I9HA 2VCZA 3TU3B 4HUAA 4MDCA 4J56E 1T00A 3C8EA 3WGEA 4DSSB 1SKRB 2CT6A 2L57A 2WZ9A 1GLPA 2P5QA 4K5SA 4IJIA 3UL3A 1Q4JA 3I9V2 4TR1A 2EC4A 3KGKA 2ZUPA 1SL2B 3FR3A 5KEJA 3M8NA 1FOVA 4OO4A 1GULA 5ECMB 2C8UA 1HNAA 2HRFA 2ZNMA 4NHWA 1XWKA 2HNLA 1WMJA 3L9VA 4XS1A 3FYGA 2IFQA 3GTUB 3CRUA 3WD6A 4IW9A 5CRHA 3VWUA 2AB6A 2LTKA 5DQSA 1JHBA 5EVOA 1FOHA 4ZILA 1A0FA 13GSA 1PL1A 3KM6A 4A5PA 2YNXA 3L9SA 5F8BA 2LNTA 2CX4A 2I81A 20GSA 1AUCA 2QC7A 1EV4A 3L4NA 4V2LA 3G7JA 3QFAC 5ENUA 3GN3A 4ZL7A 1H75A 3PINA 3GUSA 2YZUA 4KSMA 4X4JA 3P8WA 1DE2A 1F9MA 3APQA 3KP9A 2QSIA 5J4UA 4TR4A 3E9JB 2B6MA 5LCZA 22GSA 3F3RA 2O7KA 2CAQA 1PRXA 2TRXA 3F4RA 4O32A 2ALBA 1MDJA 4HDEA 4ZB6A 3HHVA 1GSUA 4I2UA 2JL4A 2WJUA 4O7HA 3GL5A 2H8LA 2L6DA 2FHEA 1ZYEA 4NWYA 4EE0A 1PQNA 3MYDA 2L6CA 2LRNA 2CX3A 3EWLA 5IO2A 5ABRA 2PN8A 1FG4A 2R2JA 2X49A 3FHKA 3ZFBA 2HT9A 3E3EA 2CVKA 1AIUA 1X9WB 1E2YA 1SK0A 3GX8A 4K6XA 2YCDA 6GSUA 3LXZA 2DMMA 2YV9A 2PERA 3KMOA 5A5HB 4GTUA 1SL0B 2LRTA 2X8GA 4BA7A 3HCZA 4G2EA 2YV7A 5J9CA 5ECIB 1MD4A 2L5LA 1A2JA 1THXA 3H79A 3M0FA 3W8SA 2AAWA 4POMA 2OE1A 1XVWA 5F0GA 5J40A 2PVQA 3TOTA 4K2XA 2VO4A 3HD5A 4EIPA 3TDGA 4N30A 1PMTA 5DAKA 1SENA 1SD8A 2R37A 3ZIJA 2H1BA 2K6VA 4V1Ag 2F9SA 4G9HA 1U6TA 5A4UA 18GSA 2DIZA 3OR5A 4KSOA 2L59A 4TVEA 1VF4A 1YKAA 3EURA 1ACVA 1GH2A 1OYJA 4L5OA 5IMAA 2JSZA 4AKHA 4MZBA 4Z2TA 4GCIA 5G5EA 4PUFC 3PH9A 5CO3A 1C72A 3A5IA 2YWIA 1YJ6A 7GSSA 1N2AA 1XIYA 3ZVJD 3ZTLA 4ID0A 2LNSA 1SVLA 2HXKA 1DBYA 1DE1A 3ERGA 2YN1A 1F3AA 4MABA 1PSQA 4DSSA 1MDKA 2GQKA 1FW1A 3APSA 10GSA 4I6XA 1ZCPA 1PGTA 4NV5A 4E68A 2M46A 1A8LA 2RLIA 2OE3A 1V58A 2YWOA 2VKZG 3LORA 3QPMA 4QL9A 1X5EA 3RPNA 2HSMB 1EGRA 3LXTA 4L8EA 2EFDA 5ECQB 2CQ9A 4KE3A 5FHIA 5JWRB 1QGVA 4EXJA 4ZIJA 1Z6NA 3KEBA 5ECLB 6GSSA 3LGCA 2LUSA 5EL8A 4TXVA 2AJQB 3GTUA 4RQXA 2RUEA 1K0NA 2QA2A 4N11A 3EINA 4NAXA 5GZZB 3EE2A 1JFUA 1ZYQB 4EDYA 2VCVA 3LG6A 2YJHA 5KOXA 3Q18A 4G0IA 4KF9A 5F06A 2LKUA 3HY2A 2X4AA 2XPEA 5HR2A 5EPFA 2DJ3A 5DCGA 1EGOA 5F07A 4EF0A 2GS3A 1O81A 2DC5A 4CY8A 1AC1A 4QL7A 1T8EB 3G7YA 1ST9A 2IFQB 4OFTA 4EO3A 4LLRA 4KDUA 5DALB 1ML6A 2KP2A 2WCIA 4ECIA 4O92A 5D9TA 1N8JA 1TRSA 4YQVA 3HJOA 2JSYA 2V6KA 5DVBA 2PVOC 3GFKA 1VF3A 4XS6A 5C00A 1QUWA 5ECNB 1OAZA 3UEMA 3HDCA 4MJAA 3GHAA 3LW9A 4MZWA 2BJXA 4OCEA 5JCWA 2R0CA 3LYPA 17GSA 3TCOA 4RI7A 2IPAA 3FZ4A 2H72A 4HQZA 1OC8A 1TKDB 5G2ZA 3C73A 2IWTA 4IQ1A 3J7Yk 2FGXA 4WBJA 2UV8G 1RK4A 2OE0A 4JRRA 1LJRA 4F9ZA 3ZZXA 2VL2C 4Z2UA 3TRXA 5B6MA 3TJJA 3HVSA 3MIXA 4TN8A 3CXGA 5D8IA 4JZQA 5A5HA 1SYXA 2DBCA 2V6OA 5INYA 2LQOA 4H86A 4I8BA 1K0MA 1M9BA 1I5GA 4QMKA 5KN0A 1M2DA 2PWJA 1GSYA 1T4YA 2K8SA 3EU4A 1PD21 1W89A 4TR3A 1X5DA 4XCSA 2GZZA 2VL2A 4XS4B 3FZAA 2N5FA 4ECCA 4N3ZA 3QR6A 4TR0A 4L0UA 2CZ2A 3TJGA 1JZRA 4PNGA 2DKIA 3P2AA 1ERTA 5ECRB 1FO5A 4G01A 1OKTA 3GIXA 4BVYB 1U88A 3IOSA 2EIOA 1ZL9A 4JBBA 4I97A 1M9AA 2B5YA 5G31A 1A2LA 3J7Yb 4IVFA 1O8WA 3L9UA 4MCUA 3UVTA 5G1KA 3Q74A 1BEDA 1TOFA 5IMCA 4D73B 3NOFA 5ECKB 2DIYA 3TKRA 2PPTA 1GTAA 3DYRA 1M2AA 2IJYA 2Z9SA 1HYUA 3I6AA 3TGZA 1SK2A 2R0GA 2GSTA 3MAKA 2NDOA 1CQGA 1B48A 2XBIA 3TRPA 3RDWA 5GSSA 1TP9A 5E59A 5IPHA 2HSMA 5D9VA 1A0RP 1ZOFA 5KN1A 4MJBA 5COHA 1SU9A 1FB6A 3G7IA 2O87A 2FWGA 4HJMA 4RI6A 3GURA 4NV2A 1OVNA 1N25A 4MH3A 1EWXA 3C7MA 2E2GA 1USBA 3ME7A 1XW5A 4HZ4A 3WGDA 2PBJA 4DVCA 3FZ9A 5IMFA 2HSNB 2C3NA 3EVIA 4MPFA 2P5RA 1GTUA 3KJYA 2H6ZA 3GSSA 5ID2B 2H1DA 3LQ7A 1B4QA 2JADA 1J9BA 2LV3A 3F4SA 3BCIA 4HEA2 3VWXA 3KXOA 1YEXA 4TOPA 4MH2A 1JLVA 1GSSA 1WOUA 5DJMA 2KOKA 3D4TA 3CYNA 4GSNA 5CYYA 1X5CA 5FT3A 1J08A 3D4MA 1GTBA 4FIWA 4ILFA 3HMJG 4E8HA 3P7XA 2HRNA 4MK3A 4ZBDA 4AF2A 3EMPA 3KD0A 1O6JA 1URMA 2CVDA 5CRDA 4AJ6A 5DALA 4FQUA 2C0EA 1GUKA 1F2EA 1G7EA 2KP1A 4LMWA 4I5QA 3HA9A 1WIKA 2H74A 3ZREA 4KCAA 3TB2A 2R0PA 4EVMA 4ECJA 1GTIA 3CMIA 1S3AA 1ZZYA 3UAPA 5A34B 3GA4A 4IHUA 2CZ3A 4K9ZA 1E6BA 2G0FA 4ZXGA 3IV4A 2ZCTA 1YDKA 3L0HA 3FZ5A 3FR6A 4IJ3A 1YY7A 1HD2A 5CRWA 4MNNA 2K9FA 5KOWA 5D73A 1T7PB 3GMFA 3HXSA 3A2XA 5J4YA 3CTGA 2OADA 3M9KA 5KN3A 3WGXA 2FA4A 2H01A 2MZCA 3DXBA 2YPMA 4EC0A 4L5LA 1G6WA 2MMNA 3JCML 3KMNA 4GLTA 2E7PA 3DGQA 2H73A 2PU9C 4G0LA 5ECOB 2GQMA 3M9JA 1SK1A 4JR4A 1OE8A 4ACSA 3UBLA 2PGTA 2C0FA 1KBNA 2GLRA 4XS4A 1KEBA 2FUG2 5B6NA 2VAFA 2C0GA 3AY8A 4GQCA 3D0ZA 3PPUA 4NMUA 5IM9A 4MF5A 2REMA 4ULXA 2YZHA 2R6KA 4BVYA 4PNFA 1B9YC 4ECBA 2PUKC 4DSQA 3M1GA 2GZYA 2YANA 4TW5A 1IYIA 1NHYA 1KTEA 3ZRDA 3VPTA 1XWBA 3IBHA 4K0NA 5D9WA 2HSYA 2FWHA 3EU3A 1OKDA 3TKSE 2X8HA 3O6TA 4D73A 1ZYNA 2HRAA 2JACA 1TI1A 3N5OA 2VM1A 2A2SA 3KIJA 2AHEA 4PX1A 4IGJA 3BD2A 1ERVA 5DQYA 1NHOA 4WXTA 1Z3EA 2X8CA 3O3TA 5A4VA 1R7HA 3P90A 1Y25A 1U87A 4IN0A 5IO0A 5JWOB 1XXUA 5CRGA 2H75A 3EMXA 5D9XA 3LFLA 4FH8A 3FEUA 19GSA 1X9MB 3DMLA 2LQQA 3C1RA 3DKSA 4MJCA 4O5QA 3ZL5A 3VFIA 3ED3A 3HYPA 2R5GA 1M0UA 4ZBBA 3DWVA 1Q98A 3DVWA 3HVVA 2B1KA 2GSRA 2HSNA 5DBQA 3QCPA 4ZBAA 3F9UA 1A2MA 3ZFLA 1LBKA 4KH7A 1XVQA 2YP6A 4ZB7A 3V1WA 3IK7A 5ID2A 1V98A 1LU4A 2HZFA 5J4VA 1TI3A 3KTLA 2TRCP 5CNWA 1TXUA 2KHPA 2J9HA 4KW6A 2FA8A 4ZL8A 3MWHA 3CTFA 2H0HA 1TU8A 1SL1B 1XOAA 3APOA 2RUFA 2HLSA 1RW1A 4Q5QA 3TJBA 2QA1A 4IQAA 1TJDA 1BG5A 4HZ2A 2P0GA 3BCKA 4L0WA 2L5OA 1EZKA 4ICYA 4IS0A 2A4VA 3D22A 4TXOB 4POKA 3O76A 3QMXA 1TRUA 4WF4A 2EFCA 2EFHA 1R5PA 1G6YA 4F82A 2ON5A 2V32A 5D96A 5B8BA 5AN1A 3WYWA 4N0ZA 3KZQA 2B1LA 4K5RA 4GQFA 2UZ8A 1F3BA 4ZL9A 1XWAA 1R4WA 3BBYA 1M7TA 1EP7A 4NHZA 2DJJA 5A34A 1YKCA 3Q19A 4O5RA 5F05A 1VGLA 2JZRA 5HFGA 1XOBA 3CRTA 1WPIA 1Z7PA 2DJ0A 3F3QA 2B5XA 1OC9B 3VK9A 4FYCA 2YWMA 3UARA 4EDZA 5IOWA 3ERFA 2E2MA 2LJRA 1AAZA 2BMXA 3RBTA 4KAEA 1H4OA 3TJKA 3A5WA 5ELGA 4G19A 6GSVA 5GAPD 1HNBA 2MMAA 3UBKA 4BVXB 3ZLPA 3EC3A 1GSDA 1NM3A 2HFDA 1WP0A 4DSRA 3H1NA 2OKAA 4ML1A 5HR3A 5IMZA 4X43A 1SYRA 1G7OA 2X99A 4BPYA 1BQ7A 4TKYA 4JR6A 3IHQA 1SKSB 2M80A 4Z2RA 3ZITA 2DKHA 4OCFA 3IA1A 5EY6A 2B7KA 1SJIA 1TK5B 2V41A 3FK8A 3IR4A 4XRAA 2C3TA 4BL7B 1YVLA 3UJ1A 4HU9A 1O7UA 2VLTA 5GAND 4OO5A 3SWLA 1PN9A 1GNEA 2HE3A 1F6MC 4KNDA 4OD7A 5H5RA 3NZNA 4TRXA 2AYTA 2IMDA 3VWWA 3TKSC 1MDIA 1OE7A 2EIRA 3HJMA 4GDFA 1GUMA 2GQLA 1U3AA 1K0CA 1Z7RA 3A2WA 3TKPA 4KUNA 1OC3A 3ZYWA 4MJEA 4IKHA 1TRWA 3UIWA 1U3IA 3FW2A 1ZYPA 3F8UA 2LJAA 2LJKA 2FD3A 1EV9A 1FAAA 2WRTA 2IMEA 1S3CA 5JWQB 2VLVA 2ON7A 3BOAA 2FWFA 4KDXA 3L78A 4YQMA 4GSSA 4YAPA 4YAVA 4ML6A 2CAIA 2R3XA 3TKSA 3FRCA 3SBCA 3GRXA 2JZSA 4OMVA 1ERUA 1SD9A 4IBPA 4E8EA 1QQ2A 2B7JA 2VUPA 4J57E 4YH2A 3IC8A 3LJRA 4KB3A 3BJ5A 2CV4A 2NVLA 2GGTA 2I4AA 6GSYA 3VLNA 2GVPA 4MP4A 3IC4A 2QGVA 4LL1B 5J9BA 3U5RE 3E0UA 4K8MA 3PR8A 2QKEA 4K2DA 1BG1A 1YEPA 2GT5A 4I2TA 3KH9A 3FR9A 1SKWB 2F51A 3TRQA 5BMUB 2WGRA 5AGYA 5C04A 3C71A 1BYEA 2MMOA 4K1FA 1ERWA 3GH9A 4V1Ap 2EIQA 1QFNA 2XC2A 4XIHA 4IP6A 5HFKA 2FCHA 2O8VB 2TIRA 4TXOA 1I9DA 3ME8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FY7 A;  2HSH A;  3A2V A;  2HZE B;  1O85 A;  4KGI A;  4RQR A;  3N9J A;  1XCC A;  2OA7 A;  4JED A;  4Q5R A;  3WT2 A;  1JZD A;  1GSE A;  4WKW A;  2HQT A;  1VRS D;  2DJK A;  2VCT A;  2DJ2 A;  6GSX A;  3GL3 A;  4FYU A;  4QQ7 A;  1IYH A;  5FWG A;  1ON4 A;  3C1S A;  2HI7 A;  1TK0 B;  4K7I A;  2I3Y A;  1OC9 A;  1BX9 A;  2N5A A;  3HZ4 A;  2FY6 A;  4WET A;  1FVJ A;  3U6V A;  4GST A;  1W4V A;  3R2Q A;  4FO5 A;  2C3Q A;  2IMI A;  3IRA A;  2IIY A;  4N0V A;  1MTC A;  4MF6 A;  5HFI A;  2MBT A;  3W8J A;  4ZB8 A;  4K7O A;  4F0C A;  16GS A;  2VIM A;  4BVX A;  3CSH A;  1X0R A;  5DCH A;  2HRK B;  1AQX A;  1T4Z A;  1DUG A;  2FLS A;  1J0F A;  3QDN A;  3M3M A;  4Q5N A;  1S3D A;  2C4J A;  3DD3 A;  3D5J A;  4AGS A;  4X1U A;  5IMD A;  4OWY A;  1KNG A;  1WJK A;  1SJZ A;  3UOM A;  1XBS A;  14GS A;  2DJ1 A;  3F4T A;  1VF1 A;  3QAG A;  2K8V A;  4BL7 A;  4BWQ A;  1SJ6 A;  4F0B A;  6GST A;  5CP1 A;  2LRC A;  1K0B A;  3IAS 2;  4WR5 A;  2H71 A;  2VCW A;  5DJL A;  2VL3 A;  1V57 A;  2AV4 A;  3GST A;  2IL3 A;  1Z5Y E;  1JLW A;  3A3T A;  2VOC A;  1ZMA A;  3K8N A;  1K0O A;  1UC7 A;  1T3B A;  1Y6E A;  3KH7 A;  1TXX A;  3RHC A;  5HR1 A;  3F6D A;  2FNO A;  4KX4 A;  2NBS A;  3VWV A;  3ISO A;  2XPD A;  1A8Y A;  4HI7 A;  2MBS A;  2L4Q A;  1ABA A;  3GKM A;  1PL2 A;  5J41 A;  4KCE A;  6GSW A;  3F0I A;  5AIX A;  5A5K A;  4PUA A;  4USS A;  4WR4 A;  5DDL A;  4BWS A;  2IN3 A;  2H6Y A;  3US3 A;  3CSI A;  3TKQ A;  1K3L A;  2H6X A;  4POL A;  5KN2 A;  4JE1 A;  3MDK A;  5JCU A;  5H5S A;  2OAC A;  11GS A;  1AQV A;  1K3Y A;  4N10 A;  2VM2 A;  1GNW A;  3ZML A;  4POB A;  1YQ1 A;  1MD3 A;  1XPV A;  3QOU A;  5LNK e;  4OFM A;  1T1V A;  4MA9 A;  4Q5F A;  2X64 A;  1WRY A;  4KDY A;  3W6G A;  1B4P A;  4FYB A;  4P3Y B;  3IK9 A;  4HJ2 A;  4MPG A;  4NPB A;  2GZP A;  2H19 A;  3KP8 A;  1UVZ A;  5ECS A;  2D2Z A;  1RQM A;  4HU7 A;  3IAM 2;  2WDU A;  2C80 A;  4MMM A;  3H93 A;  3G9B A;  2H0G A;  3GKN A;  12GS A;  3QAV A;  1FVK A;  1XFL A;  1R26 A;  2H0I A;  2KUC A;  4PGT A;  4PQI A;  3EYT A;  2LS5 A;  4PTS A;  4JU5 A;  1X9S B;  2LST A;  5BMU A;  2NTO A;  2VL9 A;  1ILO A;  2FWE A;  5JCG A;  4IEL A;  3RHB A;  3GX0 A;  2P31 A;  2XHF A;  2KLX A;  3QD9 A;  1WWJ A;  3MNG A;  2BTO T;  3H4K A;  2N5B A;  1M99 A;  4G0K A;  1EOG A;  3UMA A;  1MEK A;  4PQ1 A;  4V2N A;  5IIZ A;  2WB9 A;  5A4W A;  3Q6O A;  1JZO A;  5CRE A;  5IMV A;  1YZX A;  4G10 A;  2WUL A;  2HZE A;  4GRF A;  2V1M A;  1GSQ A;  2A2R A;  1TK8 B;  2CA8 A;  2OJL A;  2CVB A;  4DEJ A;  4J2F A;  2OBI A;  3LSZ A;  5CAX A;  4EKZ A;  2R4V A;  1XWG A;  1CQH A;  4K0G A;  3WT1 A;  3ZIV A;  1AQW A;  2JU5 A;  1TU7 A;  2K18 A;  4HS1 A;  2IMK A;  3ZVJ A;  1QXH A;  4WBR D;  3TUE A;  1JZW A;  2VCQ A;  3D6I A;  4WF5 A;  1XW9 A;  4IP1 A;  3DIE A;  4HQS A;  1ZGN A;  2VD0 A;  4XTS A;  1EP8 A;  4PXO A;  2YJ7 A;  5HQP A;  4Z7X A;  1M2B A;  2HRK A;  1PX7 A;  5G1L A;  2LEG A;  5L71 A;  3DVX A;  5ECH B;  2ES7 A;  1O8X A;  4MZC A;  2RII A;  1TW9 A;  4GXZ A;  2M72 A;  3IE3 A;  4TR1 B;  3F6F A;  5ECP B;  1A24 A;  4CW9 A;  8GSS A;  1THO A;  1VF2 A;  2GSS A;  1PKW A;  2L4C A;  1TDI A;  1GSF A;  2H70 A;  2O85 A;  2YWN A;  3KTB A;  3VUR A;  3I69 A;  1TTZ A;  1PA3 A;  2H30 A;  4EL1 A;  2H76 A;  3CSJ A;  1NSW A;  2J23 A;  4ZB9 A;  2WFC A;  2WS2 A;  5AIS A;  1O73 A;  2JZT A;  4KA0 A;  4AJ8 A;  5IPG A;  2GDR A;  2G2Q A;  2RM6 A;  1R5A A;  2O89 A;  1G0T A;  3IDV A;  3IPZ A;  4F2I A;  1PKZ A;  3F63 A;  1GUH A;  1HQO A;  1DSB A;  1EOH A;  4YQU A;  3QFB C;  2DSA A;  2XBQ A;  3S9F A;  2MMZ A;  5AIV A;  2AUV A;  4LL4 B;  4XHM A;  5LD0 A;  4GF0 A;  2NPB A;  1EEM A;  1V9W A;  1FHE A;  1B8X A;  3D21 A;  2YOI A;  3TOU A;  2GTU A;  2H1A A;  2I1U A;  5GST A;  3HJP A;  3GV1 A;  2E0Q A;  3GYK A;  3HZ8 A;  1K0A A;  3KCM A;  5E4W A;  3DRN A;  1K3O A;  2C1Y A;  4HOJ A;  4X0X A;  4F03 A;  1Z6M A;  1AW9 A;  3FKF A;  3GKX A;  3ZMK A;  5G30 A;  1GL8 A;  2DLX A;  3LEF A;  4PQH A;  2OBK A;  2IMF A;  4RUV A;  4ISD A;  3PGT A;  3VI7 A;  1HNC A;  1FB0 A;  4PUR A;  4CDO A;  1TRV A;  1GP1 A;  3ERW A;  4K7N A;  1Z9H A;  5B8A A;  1AXD A;  2HYX A;  1XZO A;  1GWC A;  1BAY A;  4EUY A;  1QMV A;  4OFN A;  3GH6 A;  4MF7 A;  2GSQ A;  3R3E A;  1NW2 A;  1QK8 A;  2C0D A;  1UA5 A;  2RM5 A;  4NXI A;  2F3M A;  9GSS A;  3LYK A;  5IQY A;  3TJF A;  2GT6 A;  4AJ7 A;  1V40 A;  1XW6 A;  4LMV A;  5G5F A;  1BJX A;  3I43 A;  4CHS A;  4WEY A;  3H8Q A;  1V2A A;  2VLU A;  1F37 A;  1K0D A;  3NIV A;  3HKR A;  5H5Q A;  1PX6 A;  3VI5 A;  5DAK B;  4LA1 A;  3HVX A;  3VPQ A;  3UVH A;  1YF0 A;  4XRD A;  3RPP A;  5J3R A;  2VCX A;  4GWR A;  3GKK A;  1A23 A;  5ELA A;  2F8A A;  2DML A;  3LWA A;  4V2M A;  5D93 A;  1GLQ A;  1YF1 A;  2H66 A;  5J5N A;  2MYG A;  2PMT A;  5B7C A;  3GNJ A;  1GRX A;  1EEJ A;  2B3S A;  3CBU A;  1XWC A;  5HR0 A;  3QAW A;  2F8F A;  3IXR A;  1B9X C;  1WE0 A;  4MLY A;  2VD1 A;  1UN2 A;  5IOX A;  3DEX A;  2H1G A;  3RAZ A;  3MSZ A;  2B5E A;  2V2G A;  2I9H A;  2VCZ A;  4HUA A;  4MDC A;  4J56 E;  1T00 A;  3C8E A;  3WGE A;  4DSS B;  1SKR B;  2CT6 A;  2L57 A;  2WZ9 A;  1GLP A;  2P5Q A;  4IJI A;  3UL3 A;  1Q4J A;  3I9V 2;  4TR1 A;  2EC4 A;  3KGK A;  2ZUP A;  1SL2 B;  3FR3 A;  5KEJ A;  3M8N A;  1FOV A;  4OO4 A;  1GUL A;  5ECM B;  2C8U A;  1HNA A;  2HRF A;  2ZNM A;  4NHW A;  1XWK A;  2HNL A;  1WMJ A;  3L9V A;  4XS1 A;  3FYG A;  2IFQ A;  3GTU B;  3CRU A;  3WD6 A;  4IW9 A;  5CRH A;  3VWU A;  2AB6 A;  2LTK A;  5DQS A;  1JHB A;  5EVO A;  4ZIL A;  1A0F A;  13GS A;  1PL1 A;  3KM6 A;  2YNX A;  3L9S A;  5F8B A;  2LNT A;  2CX4 A;  2I81 A;  20GS A;  1AUC A;  2QC7 A;  1EV4 A;  3L4N A;  4V2L A;  3G7J A;  3QFA C;  5ENU A;  3GN3 A;  4ZL7 A;  1H75 A;  3PIN A;  3GUS A;  2YZU A;  4KSM A;  3P8W A;  1DE2 A;  1F9M A;  3APQ A;  3KP9 A;  2QSI A;  5J4U A;  4TR4 A;  3E9J B;  2B6M A;  5LCZ A;  22GS A;  3F3R A;  2O7K A;  2CAQ A;  1PRX A;  2TRX A;  3F4R A;  4O32 A;  2ALB A;  1MDJ A;  4HDE A;  4ZB6 A;  3HHV A;  1GSU A;  4I2U A;  2JL4 A;  2WJU A;  4O7H A;  3GL5 A;  2H8L A;  2L6D A;  2FHE A;  1ZYE A;  4NWY A;  4EE0 A;  1PQN A;  2L6C A;  2LRN A;  2CX3 A;  3EWL A;  5IO2 A;  5ABR A;  2PN8 A;  1FG4 A;  2R2J A;  3FHK A;  3ZFB A;  2HT9 A;  3E3E A;  2CVK A;  1AIU A;  1X9W B;  1E2Y A;  1SK0 A;  3GX8 A;  4K6X A;  2YCD A;  6GSU A;  3LXZ A;  2DMM A;  2YV9 A;  2PER A;  3KMO A;  4GTU A;  1SL0 B;  2LRT A;  2X8G A;  4BA7 A;  3HCZ A;  4G2E A;  2YV7 A;  5J9C A;  5ECI B;  1MD4 A;  2L5L A;  1A2J A;  1THX A;  3H79 A;  3M0F A;  3W8S A;  2AAW A;  4POM A;  2OE1 A;  1XVW A;  5F0G A;  2PVQ A;  3TOT A;  2VO4 A;  3HD5 A;  3TDG A;  4N30 A;  1PMT A;  5DAK A;  1SEN A;  1SD8 A;  2R37 A;  3ZIJ A;  2H1B A;  2K6V A;  4V1A g;  2F9S A;  4G9H A;  1U6T A;  5A4U A;  18GS A;  2DIZ A;  3OR5 A;  4KSO A;  2L59 A;  4TVE A;  1VF4 A;  1YKA A;  3EUR A;  1ACV A;  1GH2 A;  1OYJ A;  4L5O A;  5IMA A;  2JSZ A;  4MZB A;  4GCI A;  5G5E A;  4PUF C;  3PH9 A;  5CO3 A;  1C72 A;  2YWI A;  1YJ6 A;  7GSS A;  1N2A A;  1XIY A;  3ZVJ D;  3ZTL A;  4ID0 A;  2LNS A;  2HXK A;  1DBY A;  1DE1 A;  3ERG A;  2YN1 A;  1F3A A;  4MAB A;  1PSQ A;  4DSS A;  1MDK A;  2GQK A;  1FW1 A;  3APS A;  10GS A;  4I6X A;  1ZCP A;  1PGT A;  4NV5 A;  2M46 A;  1A8L A;  2RLI A;  2OE3 A;  1V58 A;  2YWO A;  3LOR A;  3QPM A;  4QL9 A;  1X5E A;  3RPN A;  2HSM B;  1EGR A;  3LXT A;  4L8E A;  5ECQ B;  2CQ9 A;  4KE3 A;  5FHI A;  5JWR B;  1QGV A;  4EXJ A;  4ZIJ A;  1Z6N A;  3KEB A;  5ECL B;  6GSS A;  3LGC A;  2LUS A;  5EL8 A;  4TXV A;  2AJQ B;  3GTU A;  4RQX A;  2RUE A;  1K0N A;  4N11 A;  3EIN A;  4NAX A;  5GZZ B;  3EE2 A;  1JFU A;  1ZYQ B;  4EDY A;  2VCV A;  3LG6 A;  2YJH A;  3Q18 A;  4G0I A;  4KF9 A;  5F06 A;  2LKU A;  3HY2 A;  2XPE A;  5HR2 A;  5EPF A;  2DJ3 A;  5DCG A;  1EGO A;  5F07 A;  4EF0 A;  2GS3 A;  1O81 A;  2DC5 A;  1AC1 A;  4QL7 A;  1T8E B;  3G7Y A;  1ST9 A;  2IFQ B;  4OFT A;  4EO3 A;  4LLR A;  4KDU A;  5DAL B;  1ML6 A;  2KP2 A;  2WCI A;  4ECI A;  4O92 A;  5D9T A;  1N8J A;  1TRS A;  4YQV A;  3HJO A;  2JSY A;  2V6K A;  5DVB A;  2PVO C;  3GFK A;  1VF3 A;  4XS6 A;  5C00 A;  1QUW A;  5ECN B;  1OAZ A;  3UEM A;  3HDC A;  4MJA A;  3GHA A;  4MZW A;  2BJX A;  4OCE A;  5JCW A;  3LYP A;  17GS A;  3TCO A;  4RI7 A;  2IPA A;  3FZ4 A;  2H72 A;  4HQZ A;  1OC8 A;  1TKD B;  5G2Z A;  3C73 A;  2IWT A;  4IQ1 A;  3J7Y k;  2FGX A;  4WBJ A;  1RK4 A;  2OE0 A;  4JRR A;  1LJR A;  4F9Z A;  3ZZX A;  2VL2 C;  3TRX A;  5B6M A;  3TJJ A;  3HVS A;  4TN8 A;  3CXG A;  5D8I A;  4JZQ A;  1SYX A;  2DBC A;  2V6O A;  5INY A;  2LQO A;  4H86 A;  4I8B A;  1K0M A;  1M9B A;  1I5G A;  5KN0 A;  1M2D A;  2PWJ A;  1GSY A;  1T4Y A;  2K8S A;  3EU4 A;  1PD2 1;  1W89 A;  4TR3 A;  1X5D A;  4XCS A;  2GZZ A;  2VL2 A;  4XS4 B;  3FZA A;  2N5F A;  4ECC A;  3QR6 A;  4TR0 A;  4L0U A;  2CZ2 A;  3TJG A;  1JZR A;  4PNG A;  3P2A A;  1ERT A;  5ECR B;  1FO5 A;  1OKT A;  3GIX A;  4BVY B;  1U88 A;  3IOS A;  2EIO A;  1ZL9 A;  4JBB A;  4I97 A;  1M9A A;  2B5Y A;  5G31 A;  1A2L A;  3J7Y b;  4IVF A;  1O8W A;  3L9U A;  4MCU A;  3UVT A;  5G1K A;  3Q74 A;  1BED A;  1TOF A;  5IMC A;  4D73 B;  3NOF A;  5ECK B;  2DIY A;  3TKR A;  2PPT A;  1GTA A;  3DYR A;  1M2A A;  2IJY A;  2Z9S A;  1HYU A;  3I6A A;  3TGZ A;  1SK2 A;  2GST A;  3MAK A;  2NDO A;  1CQG A;  1B48 A;  2XBI A;  3TRP A;  3RDW A;  5GSS A;  1TP9 A;  5E59 A;  5IPH A;  2HSM A;  5D9V A;  1A0R P;  1ZOF A;  5KN1 A;  4MJB A;  5COH A;  1SU9 A;  1FB6 A;  3G7I A;  2O87 A;  2FWG A;  4HJM A;  4RI6 A;  3GUR A;  4NV2 A;  1OVN A;  4MH3 A;  1EWX A;  3C7M A;  2E2G A;  1USB A;  3ME7 A;  1XW5 A;  4HZ4 A;  3WGD A;  2PBJ A;  4DVC A;  3FZ9 A;  5IMF A;  2HSN B;  2C3N A;  3EVI A;  4MPF A;  2P5R A;  1GTU A;  3KJY A;  2H6Z A;  3GSS A;  5ID2 B;  2H1D A;  3LQ7 A;  1B4Q A;  2JAD A;  1J9B A;  2LV3 A;  3F4S A;  3BCI A;  4HEA 2;  3VWX A;  3KXO A;  1YEX A;  4TOP A;  4MH2 A;  1JLV A;  1GSS A;  1WOU A;  5DJM A;  2KOK A;  3D4T A;  3CYN A;  4GSN A;  5CYY A;  1X5C A;  5FT3 A;  1J08 A;  3D4M A;  1GTB A;  4FIW A;  4ILF A;  4E8H A;  3P7X A;  2HRN A;  4MK3 A;  4ZBD A;  4AF2 A;  3EMP A;  3KD0 A;  1O6J A;  1URM A;  2CVD A;  5CRD A;  4AJ6 A;  5DAL A;  4FQU A;  2C0E A;  1GUK A;  1F2E A;  1G7E A;  2KP1 A;  4LMW A;  4I5Q A;  3HA9 A;  1WIK A;  2H74 A;  3ZRE A;  4KCA A;  3TB2 A;  4EVM A;  4ECJ A;  1GTI A;  3CMI A;  1S3A A;  1ZZY A;  3UAP A;  3GA4 A;  4IHU A;  2CZ3 A;  4K9Z A;  1E6B A;  2G0F A;  4ZXG A;  3IV4 A;  2ZCT A;  1YDK A;  3L0H A;  3FZ5 A;  3FR6 A;  4IJ3 A;  1YY7 A;  1HD2 A;  5CRW A;  2K9F A;  5D73 A;  1T7P B;  3GMF A;  3HXS A;  3A2X A;  3CTG A;  2OAD A;  3M9K A;  5KN3 A;  3WGX A;  2FA4 A;  2H01 A;  2MZC A;  3DXB A;  2YPM A;  4EC0 A;  4L5L A;  1G6W A;  2MMN A;  3JCM L;  3KMN A;  4GLT A;  2E7P A;  3DGQ A;  2H73 A;  2PU9 C;  4G0L A;  5ECO B;  2GQM A;  3M9J A;  1SK1 A;  4JR4 A;  1OE8 A;  4ACS A;  3UBL A;  2PGT A;  2C0F A;  1KBN A;  2GLR A;  4XS4 A;  1KEB A;  2FUG 2;  5B6N A;  2VAF A;  2C0G A;  3AY8 A;  4GQC A;  3D0Z A;  3PPU A;  4NMU A;  5IM9 A;  4MF5 A;  2REM A;  4ULX A;  2YZH A;  2R6K A;  4BVY A;  4PNF A;  1B9Y C;  4ECB A;  2PUK C;  4DSQ A;  3M1G A;  2GZY A;  2YAN A;  4TW5 A;  1IYI A;  1NHY A;  1KTE A;  3ZRD A;  3VPT A;  1XWB A;  3IBH A;  4K0N A;  5D9W A;  2HSY A;  2FWH A;  3EU3 A;  1OKD A;  3TKS E;  2X8H A;  3O6T A;  4D73 A;  2HRA A;  2JAC A;  1TI1 A;  3N5O A;  2VM1 A;  2A2S A;  3KIJ A;  2AHE A;  4PX1 A;  4IGJ A;  3BD2 A;  1ERV A;  5DQY A;  1NHO A;  4WXT A;  1Z3E A;  2X8C A;  3O3T A;  5A4V A;  1R7H A;  3P90 A;  1Y25 A;  1U87 A;  4IN0 A;  5IO0 A;  5JWO B;  1XXU A;  5CRG A;  2H75 A;  3EMX A;  5D9X A;  3LFL A;  4FH8 A;  3FEU A;  19GS A;  1X9M B;  3DML A;  2LQQ A;  3C1R A;  3DKS A;  4MJC A;  3ZL5 A;  3VFI A;  3ED3 A;  3HYP A;  2R5G A;  1M0U A;  4ZBB A;  3DWV A;  1Q98 A;  3DVW A;  3HVV A;  2B1K A;  2GSR A;  5DBQ A;  3QCP A;  4ZBA A;  3F9U A;  1A2M A;  3ZFL A;  1LBK A;  4KH7 A;  1XVQ A;  2YP6 A;  3V1W A;  3IK7 A;  5ID2 A;  1V98 A;  1LU4 A;  2HZF A;  1TI3 A;  3KTL A;  2TRC P;  5CNW A;  2KHP A;  2J9H A;  4KW6 A;  2FA8 A;  4ZL8 A;  3MWH A;  3CTF A;  2H0H A;  1TU8 A;  1SL1 B;  1XOA A;  3APO A;  2RUF A;  2HLS A;  1RW1 A;  4Q5Q A;  3TJB A;  4IQA A;  1TJD A;  1BG5 A;  4HZ2 A;  2P0G A;  3BCK A;  4L0W A;  2L5O A;  1EZK A;  4IS0 A;  2A4V A;  3D22 A;  4TXO B;  4POK A;  3O76 A;  3QMX A;  1TRU A;  4WF4 A;  1R5P A;  1G6Y A;  4F82 A;  2ON5 A;  2V32 A;  5D96 A;  5B8B A;  5AN1 A;  3WYW A;  4N0Z A;  3KZQ A;  2B1L A;  4GQF A;  2UZ8 A;  1F3B A;  4ZL9 A;  1XWA A;  1R4W A;  3BBY A;  1M7T A;  1EP7 A;  4NHZ A;  2DJJ A;  1YKC A;  3Q19 A;  4O5R A;  5F05 A;  1VGL A;  2JZR A;  5HFG A;  1XOB A;  3CRT A;  1WPI A;  1Z7P A;  2DJ0 A;  3F3Q A;  2B5X A;  1OC9 B;  3VK9 A;  4FYC A;  2YWM A;  3UAR A;  4EDZ A;  5IOW A;  3ERF A;  2E2M A;  2LJR A;  1AAZ A;  2BMX A;  3RBT A;  4KAE A;  1H4O A;  3TJK A;  3A5W A;  5ELG A;  4G19 A;  6GSV A;  5GAP D;  1HNB A;  2MMA A;  3UBK A;  4BVX B;  3ZLP A;  3EC3 A;  1GSD A;  1NM3 A;  2HFD A;  1WP0 A;  4DSR A;  3H1N A;  2OKA A;  4ML1 A;  5HR3 A;  5IMZ A;  4X43 A;  1SYR A;  1G7O A;  2X99 A;  4BPY A;  1BQ7 A;  4TKY A;  4JR6 A;  3IHQ A;  1SKS B;  2M80 A;  3ZIT A;  4OCF A;  3IA1 A;  5EY6 A;  2B7K A;  1SJI A;  1TK5 B;  2V41 A;  3FK8 A;  3IR4 A;  4XRA A;  2C3T A;  4BL7 B;  3UJ1 A;  4HU9 A;  1O7U A;  2VLT A;  5GAN D;  4OO5 A;  3SWL A;  1PN9 A;  1GNE A;  2HE3 A;  1F6M C;  4KND A;  4OD7 A;  5H5R A;  3NZN A;  4TRX A;  2AYT A;  2IMD A;  3VWW A;  3TKS C;  1MDI A;  1OE7 A;  2EIR A;  3HJM A;  1GUM A;  2GQL A;  1U3A A;  1K0C A;  1Z7R A;  3A2W A;  3TKP A;  4KUN A;  1OC3 A;  3ZYW A;  4MJE A;  4IKH A;  1TRW A;  3UIW A;  1U3I A;  3FW2 A;  3F8U A;  2LJA A;  2LJK A;  2FD3 A;  1EV9 A;  1FAA A;  2WRT A;  2IME A;  1S3C A;  5JWQ B;  2VLV A;  2ON7 A;  3BOA A;  2FWF A;  4KDX A;  3L78 A;  4YQM A;  4GSS A;  4YAP A;  4YAV A;  4ML6 A;  2CAI A;  2R3X A;  3TKS A;  3FRC A;  3SBC A;  3GRX A;  2JZS A;  4OMV A;  1ERU A;  1SD9 A;  4IBP A;  4E8E A;  1QQ2 A;  2B7J A;  2VUP A;  4J57 E;  4YH2 A;  3IC8 A;  3LJR A;  4KB3 A;  3BJ5 A;  2CV4 A;  2NVL A;  2GGT A;  2I4A A;  6GSY A;  3VLN A;  2GVP A;  4MP4 A;  3IC4 A;  2QGV A;  4LL1 B;  5J9B A;  3U5R E;  3E0U A;  4K8M A;  3PR8 A;  2QKE A;  4K2D A;  1YEP A;  2GT5 A;  4I2T A;  3KH9 A;  3FR9 A;  1SKW B;  2F51 A;  3TRQ A;  2WGR A;  5AGY A;  5C04 A;  3C71 A;  1BYE A;  2MMO A;  4K1F A;  1ERW A;  3GH9 A;  4V1A p;  2EIQ A;  1QFN A;  2XC2 A;  4XIH A;  4IP6 A;  5HFK A;  2FCH A;  2O8V B;  2TIR A;  4TXO A;  1I9D A;  3ME8 A; 
#chains in the Genus database with same CATH topology
 3FY7 A;  2HSH A;  3A2V A;  2HZE B;  1O85 A;  4KGI A;  4RQR A;  3N9J A;  1XCC A;  2OA7 A;  4JED A;  4Q5R A;  3WT2 A;  1JZD A;  1GSE A;  4WKW A;  2HQT A;  2OT3 A;  1VRS D;  2DJK A;  2VCT A;  2DJ2 A;  6GSX A;  3GL3 A;  4FYU A;  4QQ7 A;  1IYH A;  5FWG A;  1ON4 A;  3C1S A;  2HI7 A;  1TK0 B;  4K7I A;  2I3Y A;  1OC9 A;  1BX9 A;  2N5A A;  3HZ4 A;  2FY6 A;  4WET A;  1FVJ A;  3U6V A;  4GST A;  1W4V A;  3R2Q A;  4FO5 A;  2C3Q A;  2IMI A;  3IRA A;  2IIY A;  4N0V A;  1MTC A;  4MF6 A;  5HFI A;  2MBT A;  3W8J A;  4ZB8 A;  4K7O A;  4F0C A;  16GS A;  2VIM A;  4BVX A;  3CSH A;  1X0R A;  5DCH A;  2HRK B;  1AQX A;  1T4Z A;  1DUG A;  2FLS A;  1J0F A;  3QDN A;  3M3M A;  2EFE A;  4Q5N A;  1S3D A;  2C4J A;  3DD3 A;  4CY6 A;  3D5J A;  4AGS A;  4X1U A;  5IMD A;  4OWY A;  1KNG A;  1WJK A;  1SJZ A;  3UOM A;  1XBS A;  14GS A;  2DJ1 A;  3F4T A;  1VF1 A;  3QAG A;  4YKF A;  2K8V A;  4BL7 A;  4BWQ A;  1SJ6 A;  4F0B A;  6GST A;  5CP1 A;  2LRC A;  1K0B A;  3CHX C;  3IAS 2;  4WR5 A;  2H71 A;  2VCW A;  5DJL A;  2VL3 A;  1V57 A;  2AV4 A;  3GST A;  2IL3 A;  1Z5Y E;  1SVO A;  1JLW A;  3A3T A;  2VOC A;  1ZMA A;  3K8N A;  1K0O A;  1UC7 A;  1T3B A;  1Y6E A;  3KH7 A;  1TXX A;  4O5U A;  3RHC A;  5HR1 A;  3F6D A;  2FNO A;  4KX4 A;  2NBS A;  3VWV A;  3ISO A;  2XPD A;  1A8Y A;  4HI7 A;  2MBS A;  2L4Q A;  1ABA A;  3GKM A;  1PL2 A;  5J41 A;  4KCE A;  6GSW A;  3F0I A;  5AIX A;  5A5K A;  4PUA A;  4USS A;  4WR4 A;  5DDL A;  4BWS A;  2IN3 A;  2H6Y A;  3US3 A;  3CSI A;  3TKQ A;  1K3L A;  2H6X A;  4POL A;  5KN2 A;  4JE1 A;  5A1N B;  3MDK A;  5JCU A;  5H5S A;  2OAC A;  11GS A;  1AQV A;  1K3Y A;  4N10 A;  2VM2 A;  1GNW A;  2WVX B;  3ZML A;  4POB A;  1YQ1 A;  1MD3 A;  1XPV A;  3QOU A;  5LNK e;  4OFM A;  1T1V A;  4MA9 A;  4Q5F A;  2X64 A;  2WW2 A;  1WRY A;  4EIQ A;  4KDY A;  3W6G A;  1B4P A;  4FYB A;  4P3Y B;  3IK9 A;  4HJ2 A;  4MPG A;  4NPB A;  2GZP A;  2H19 A;  3KP8 A;  1UVZ A;  5ECS A;  2D2Z A;  2H1L A;  1RQM A;  2O3E A;  4HU7 A;  3IAM 2;  2WDU A;  2C80 A;  4MMM A;  3H93 A;  3G9B A;  2H0G A;  3GKN A;  12GS A;  3QAV A;  1FVK A;  1XFL A;  1R26 A;  2H0I A;  2KUC A;  4PGT A;  4PQI A;  3EYT A;  2LS5 A;  4PTS A;  4JU5 A;  1X9S B;  2LST A;  2O36 A;  5BMU A;  2NTO A;  2VL9 A;  1ILO A;  2FWE A;  5JCG A;  4IEL A;  3RHB A;  3GX0 A;  2P31 A;  2XHF A;  2KLX A;  3QD9 A;  4AKG A;  1WWJ A;  3MNG A;  2BTO T;  3H4K A;  2N5B A;  1M99 A;  2WW1 A;  4G0K A;  1EOG A;  3CWG A;  3UMA A;  1MEK A;  5J47 A;  3EPT A;  4PQ1 A;  4V2N A;  4FXY P;  5IIZ A;  2WB9 A;  5A4W A;  3Q6O A;  1JZO A;  5CRE A;  5IMV A;  1YZX A;  4G10 A;  2WUL A;  2HZE A;  4GRF A;  2V1M A;  1GSQ A;  2A2R A;  1TK8 B;  2CA8 A;  2OJL A;  3IHG A;  2CVB A;  4DEJ A;  4J2F A;  2OBI A;  3LSZ A;  4AKI A;  5CAX A;  4EKZ A;  2R4V A;  1XWG A;  1CQH A;  4W66 A;  4K0G A;  3WT1 A;  1SVM A;  3ZIV A;  1AQW A;  2JU5 A;  1TU7 A;  2K18 A;  4HS1 A;  2IMK A;  3ZVJ A;  1QXH A;  4WBR D;  3TUE A;  1JZW A;  2VCQ A;  3D6I A;  4WF5 A;  1XW9 A;  4IP1 A;  3DIE A;  4HQS A;  1ZGN A;  2VD0 A;  1Y1U A;  4XTS A;  1EP8 A;  2A2P A;  4PXO A;  2YJ7 A;  5HQP A;  4Z7X A;  1M2B A;  2HRK A;  1PX7 A;  5G1L A;  2LEG A;  5L71 A;  3DVX A;  5ECH B;  2ES7 A;  1O8X A;  4MZC A;  2RII A;  1TW9 A;  4GXZ A;  2M72 A;  3IE3 A;  4TR1 B;  3F6F A;  5ECP B;  1A24 A;  4CW9 A;  8GSS A;  1THO A;  1VF2 A;  2GSS A;  1PKW A;  2L4C A;  1TDI A;  1GSF A;  2H70 A;  2O85 A;  2YWN A;  3KTB A;  3VUR A;  3I69 A;  1TTZ A;  1PA3 A;  2H30 A;  4EL1 A;  2H76 A;  2A4H A;  3CSJ A;  1NSW A;  2J23 A;  4ZB9 A;  2WFC A;  2WS2 A;  5AIS A;  1O73 A;  2JZT A;  4KA0 A;  4AJ8 A;  5IPG A;  2GDR A;  2G2Q A;  2RM6 A;  1R5A A;  2O89 A;  1G0T A;  3IDV A;  3IPZ A;  4F2I A;  1PKZ A;  3F63 A;  4PI2 C;  1GUH A;  1HQO A;  1DSB A;  1EOH A;  4YQU A;  3QFB C;  2DSA A;  2XBQ A;  3S9F A;  2MMZ A;  5AIV A;  2AUV A;  4LL4 B;  4XHM A;  5LD0 A;  4GF0 A;  2NPB A;  1EEM A;  1V9W A;  1FHE A;  1B8X A;  3D21 A;  2YOI A;  3TOU A;  2GTU A;  5A1N A;  2H1A A;  2I1U A;  5GST A;  2O5V A;  3HJP A;  3GV1 A;  2WVX A;  2E0Q A;  3GYK A;  3HZ8 A;  1K0A A;  3KCM A;  5E4W A;  1PN0 A;  3DRN A;  1K3O A;  4AKX B;  2C1Y A;  4HOJ A;  4X0X A;  4F03 A;  1Z6M A;  1AW9 A;  3FKF A;  3FMW A;  3GKX A;  3ZMK A;  5G30 A;  1GL8 A;  2DLX A;  3LEF A;  4PQH A;  2OBK A;  2WVY A;  2IMF A;  4RUV A;  4ISD A;  3PGT A;  3VI7 A;  1HNC A;  1FB0 A;  4PUR A;  4CDO A;  1TRV A;  1GP1 A;  3ERW A;  4K7N A;  1Z9H A;  5B8A A;  1AXD A;  2HYX A;  1XZO A;  1GWC A;  1BAY A;  4EUY A;  1QMV A;  4OFN A;  5BRT A;  3GH6 A;  4MF7 A;  2GSQ A;  3R3E A;  1NW2 A;  1QK8 A;  2C0D A;  1UA5 A;  2RM5 A;  4NXI A;  2F3M A;  9GSS A;  4BIK A;  3LYK A;  5IQY A;  3TJF A;  2GT6 A;  4AJ7 A;  1V40 A;  1XW6 A;  4AI6 A;  4LMV A;  5G5F A;  1BJX A;  3I43 A;  4CHS A;  4WEY A;  3H8Q A;  1V2A A;  2VLU A;  1F37 A;  1K0D A;  3NIV A;  3HKR A;  5H5Q A;  1PX6 A;  3VI5 A;  5DAK B;  4LA1 A;  3HVX A;  3VPQ A;  3UVH A;  1YF0 A;  4XRD A;  3RPP A;  5J3R A;  2VCX A;  4GWR A;  3GKK A;  1A23 A;  5ELA A;  2F8A A;  2DML A;  3LWA A;  4V2M A;  5D93 A;  1GLQ A;  1YF1 A;  2H66 A;  5J5N A;  2MYG A;  2PMT A;  5B7C A;  3GNJ A;  4YKG A;  1GRX A;  1EEJ A;  2B3S A;  3CBU A;  1XWC A;  5HR0 A;  3QAW A;  2F8F A;  3IXR A;  1B9X C;  1WE0 A;  4MLY A;  2VD1 A;  1UN2 A;  5IOX A;  3DEX A;  2H1G A;  3RAZ A;  3MSZ A;  2B5E A;  2V2G A;  1BF5 A;  2I9H A;  2VCZ A;  3TU3 B;  4HUA A;  4MDC A;  4J56 E;  1T00 A;  3C8E A;  3WGE A;  4DSS B;  1SKR B;  2CT6 A;  2L57 A;  2WZ9 A;  1GLP A;  2P5Q A;  4K5S A;  4IJI A;  3UL3 A;  1Q4J A;  3I9V 2;  4TR1 A;  2EC4 A;  3KGK A;  2ZUP A;  1SL2 B;  1M3J A;  3FR3 A;  5KEJ A;  3M8N A;  1FOV A;  4OO4 A;  1GUL A;  5ECM B;  2C8U A;  1XG8 A;  1HNA A;  2HRF A;  2ZNM A;  4NHW A;  1XWK A;  2HNL A;  1WMJ A;  3L9V A;  4XS1 A;  3FYG A;  2IFQ A;  3GTU B;  3CRU A;  3WD6 A;  4IW9 A;  5CRH A;  3VWU A;  2AB6 A;  2LTK A;  5DQS A;  1JHB A;  5EVO A;  1FOH A;  4ZIL A;  1A0F A;  13GS A;  1PL1 A;  3KM6 A;  4A5P A;  2YNX A;  3L9S A;  5F8B A;  2LNT A;  2CX4 A;  2I81 A;  20GS A;  1AUC A;  2QC7 A;  1EV4 A;  3L4N A;  4V2L A;  3G7J A;  3QFA C;  5ENU A;  3GN3 A;  4ZL7 A;  1H75 A;  3PIN A;  3GUS A;  2YZU A;  4KSM A;  4X4J A;  3P8W A;  1DE2 A;  1F9M A;  3APQ A;  3KP9 A;  2QSI A;  5J4U A;  4TR4 A;  3E9J B;  2B6M A;  5LCZ A;  22GS A;  3F3R A;  2O7K A;  2CAQ A;  1PRX A;  2TRX A;  3F4R A;  4O32 A;  2ALB A;  1MDJ A;  4HDE A;  4ZB6 A;  3HHV A;  1GSU A;  4I2U A;  2JL4 A;  3RGB C;  2WJU A;  4O7H A;  3GL5 A;  2H8L A;  2L6D A;  2FHE A;  1ZYE A;  4NWY A;  4EE0 A;  1PQN A;  3MYD A;  2L6C A;  2LRN A;  2CX3 A;  3EWL A;  5IO2 A;  5ABR A;  2PN8 A;  1FG4 A;  2R2J A;  2X49 A;  3FHK A;  3ZFB A;  2HT9 A;  3E3E A;  2CVK A;  1AIU A;  1X9W B;  1E2Y A;  1SK0 A;  3GX8 A;  4K6X A;  2YCD A;  6GSU A;  3LXZ A;  2DMM A;  2YV9 A;  2PER A;  3KMO A;  5A5H B;  4GTU A;  1SL0 B;  2LRT A;  2X8G A;  4BA7 A;  3HCZ A;  4G2E A;  2YV7 A;  3HVN A;  5J9C A;  5ECI B;  1MD4 A;  2L5L A;  1A2J A;  1THX A;  3H79 A;  3M0F A;  3W8S A;  2AAW A;  4POM A;  2OE1 A;  1XVW A;  5F0G A;  5J40 A;  2PVQ A;  3TOT A;  4K2X A;  2VO4 A;  3HD5 A;  4EIP A;  3TDG A;  4N30 A;  1PMT A;  5DAK A;  1SEN A;  1SD8 A;  2R37 A;  3ZIJ A;  2H1B A;  2K6V A;  4V1A g;  2F9S A;  4G9H A;  1U6T A;  5A4U A;  18GS A;  2DIZ A;  3OR5 A;  4KSO A;  2L59 A;  4TVE A;  1VF4 A;  1YKA A;  3EUR A;  1ACV A;  1GH2 A;  1OYJ A;  4L5O A;  5IMA A;  2JSZ A;  4AKH A;  4MZB A;  4Z2T A;  4GCI A;  5G5E A;  4PUF C;  3PH9 A;  5CO3 A;  1C72 A;  3A5I A;  2YWI A;  1YJ6 A;  7GSS A;  1N2A A;  1XIY A;  3ZVJ D;  3ZTL A;  4ID0 A;  2LNS A;  1SVL A;  2HXK A;  1DBY A;  1DE1 A;  3ERG A;  2YN1 A;  1F3A A;  4MAB A;  1PSQ A;  4DSS A;  1MDK A;  2GQK A;  1FW1 A;  2WW0 A;  3APS A;  10GS A;  4I6X A;  1ZCP A;  1PGT A;  4NV5 A;  4E68 A;  2M46 A;  1A8L A;  2RLI A;  2OE3 A;  1V58 A;  2YWO A;  2VKZ G;  3LOR A;  3QPM A;  4QL9 A;  1X5E A;  3RPN A;  2HSM B;  1EGR A;  2WVZ A;  3LXT A;  4L8E A;  2EFD A;  5ECQ B;  2CQ9 A;  4KE3 A;  5FHI A;  5JWR B;  1QGV A;  4EXJ A;  4ZIJ A;  1Z6N A;  3KEB A;  5ECL B;  6GSS A;  3LGC A;  2LUS A;  5EL8 A;  4TXV A;  2AJQ B;  3GTU A;  4RQX A;  2RUE A;  1K0N A;  2QA2 A;  4N11 A;  3EIN A;  4NAX A;  5GZZ B;  3EE2 A;  1JFU A;  1ZYQ B;  4EDY A;  2VCV A;  3LG6 A;  2YJH A;  5KOX A;  3Q18 A;  4G0I A;  4KF9 A;  5F06 A;  2LKU A;  3HY2 A;  2X4A A;  2XPE A;  5HR2 A;  5EPF A;  2DJ3 A;  5DCG A;  1EGO A;  5F07 A;  4EF0 A;  2GS3 A;  1O81 A;  2DC5 A;  4CY8 A;  1AC1 A;  4QL7 A;  1T8E B;  3G7Y A;  1ST9 A;  2IFQ B;  4OFT A;  4EO3 A;  4LLR A;  4KDU A;  5DAL B;  1ML6 A;  2KP2 A;  2WCI A;  4ECI A;  4O92 A;  5D9T A;  1N8J A;  1TRS A;  4YQV A;  3HJO A;  2JSY A;  2V6K A;  5DVB A;  2PVO C;  3GFK A;  1VF3 A;  4XS6 A;  5C00 A;  1QUW A;  5ECN B;  1OAZ A;  3UEM A;  3HDC A;  4MJA A;  3GHA A;  3LW9 A;  4MZW A;  2BJX A;  4OCE A;  5JCW A;  2R0C A;  3LYP A;  17GS A;  3TCO A;  4RI7 A;  2IPA A;  3FZ4 A;  2H72 A;  4HQZ A;  1OC8 A;  1TKD B;  3CQF A;  5G2Z A;  3C73 A;  2IWT A;  4IQ1 A;  3J7Y k;  2FGX A;  4WBJ A;  2UV8 G;  1RK4 A;  2OE0 A;  4JRR A;  1LJR A;  4F9Z A;  3ZZX A;  2VL2 C;  4Z2U A;  3TRX A;  5B6M A;  3TJJ A;  3HVS A;  3MIX A;  4TN8 A;  3CXG A;  5D8I A;  4JZQ A;  5A5H A;  1SYX A;  2DBC A;  2V6O A;  5INY A;  2LQO A;  4H86 A;  4I8B A;  1K0M A;  1M9B A;  1I5G A;  4QMK A;  5KN0 A;  1M2D A;  2PWJ A;  1GSY A;  1T4Y A;  2K8S A;  3EU4 A;  1PD2 1;  1W89 A;  4TR3 A;  1X5D A;  4XCS A;  2GZZ A;  2VL2 A;  4XS4 B;  3FZA A;  2N5F A;  4ECC A;  4N3Z A;  3QR6 A;  4TR0 A;  4L0U A;  2CZ2 A;  3TJG A;  1JZR A;  4PNG A;  2DKI A;  3P2A A;  1ERT A;  5ECR B;  1FO5 A;  4G01 A;  1OKT A;  3GIX A;  4BVY B;  1U88 A;  3IOS A;  2EIO A;  1ZL9 A;  4JBB A;  4I97 A;  1M9A A;  2B5Y A;  5G31 A;  1S3R A;  1A2L A;  3J7Y b;  4IVF A;  1O8W A;  3L9U A;  4MCU A;  3UVT A;  5G1K A;  3Q74 A;  1BED A;  1TOF A;  5IMC A;  4D73 B;  3NOF A;  5ECK B;  2DIY A;  3TKR A;  2PPT A;  1GTA A;  3DYR A;  1M2A A;  2IJY A;  2Z9S A;  1HYU A;  3I6A A;  3TGZ A;  1SK2 A;  2R0G A;  2GST A;  3MAK A;  2NDO A;  1CQG A;  1B48 A;  2XBI A;  3TRP A;  3RDW A;  5GSS A;  1TP9 A;  5E59 A;  5IPH A;  2HSM A;  5D9V A;  1A0R P;  1ZOF A;  5KN1 A;  4MJB A;  5COH A;  1SU9 A;  1FB6 A;  3G7I A;  2O87 A;  2FWG A;  4HJM A;  4RI6 A;  3GUR A;  4NV2 A;  1OVN A;  1N25 A;  4MH3 A;  1EWX A;  3C7M A;  2E2G A;  1USB A;  3ME7 A;  1XW5 A;  4HZ4 A;  3WGD A;  2PBJ A;  4DVC A;  3FZ9 A;  5IMF A;  2HSN B;  2C3N A;  3EVI A;  4MPF A;  2P5R A;  1GTU A;  3KJY A;  2H6Z A;  3GSS A;  5ID2 B;  2H1D A;  3LQ7 A;  1B4Q A;  2JAD A;  1J9B A;  2LV3 A;  3F4S A;  3BCI A;  4HEA 2;  3VWX A;  3KXO A;  1YEX A;  4TOP A;  4MH2 A;  1JLV A;  1GSS A;  1WOU A;  5DJM A;  2KOK A;  3D4T A;  3CYN A;  4GSN A;  5CYY A;  1X5C A;  5FT3 A;  1J08 A;  3D4M A;  1GTB A;  4FIW A;  4ILF A;  3HMJ G;  4E8H A;  3P7X A;  2HRN A;  4MK3 A;  4ZBD A;  2WW3 A;  4AF2 A;  3EMP A;  3KD0 A;  1O6J A;  1URM A;  2CVD A;  5CRD A;  4AJ6 A;  5DAL A;  4FQU A;  2C0E A;  1GUK A;  1F2E A;  1G7E A;  2KP1 A;  4LMW A;  4I5Q A;  3HA9 A;  1WIK A;  2H74 A;  3ZRE A;  4KCA A;  3TB2 A;  2R0P A;  4EVM A;  4ECJ A;  1YEW C;  1GTI A;  3CMI A;  1S3A A;  1ZZY A;  3UAP A;  5A34 B;  3GA4 A;  4IHU A;  2CZ3 A;  4K9Z A;  1E6B A;  2G0F A;  3RFR C;  4ZXG A;  3IV4 A;  2ZCT A;  1YDK A;  3L0H A;  3FZ5 A;  3FR6 A;  4IJ3 A;  1YY7 A;  1PFO A;  1HD2 A;  5CRW A;  4MNN A;  2K9F A;  5KOW A;  5D73 A;  1T7P B;  3GMF A;  3HXS A;  3A2X A;  5J4Y A;  3CTG A;  2OAD A;  3M9K A;  5KN3 A;  3WGX A;  2FA4 A;  2H01 A;  2MZC A;  3DXB A;  2YPM A;  4EC0 A;  4HSC X;  4L5L A;  1G6W A;  2MMN A;  3JCM L;  3KMN A;  4GLT A;  2E7P A;  3DGQ A;  2H73 A;  2PU9 C;  4G0L A;  5ECO B;  2GQM A;  3M9J A;  1SK1 A;  4JR4 A;  1OE8 A;  4ACS A;  3UBL A;  2PGT A;  2C0F A;  1KBN A;  2GLR A;  4XS4 A;  1KEB A;  2FUG 2;  5B6N A;  1M3I A;  2VAF A;  2C0G A;  3AY8 A;  4GQC A;  3D0Z A;  3PPU A;  4NMU A;  5IM9 A;  4MF5 A;  2REM A;  4ULX A;  2YZH A;  2R6K A;  4BVY A;  4PNF A;  1B9Y C;  4ECB A;  2PUK C;  4DSQ A;  3M1G A;  2GZY A;  2YAN A;  4TW5 A;  1IYI A;  1NHY A;  1KTE A;  3ZRD A;  4PI0 C;  3VPT A;  1XWB A;  3IBH A;  4K0N A;  5D9W A;  2HSY A;  2FWH A;  3EU3 A;  1OKD A;  3TKS E;  2X8H A;  3O6T A;  4D73 A;  1ZYN A;  2HRA A;  2JAC A;  1TI1 A;  3N5O A;  2VM1 A;  2A2S A;  3KIJ A;  2AHE A;  4PX1 A;  4IGJ A;  3BD2 A;  1ERV A;  5DQY A;  1NHO A;  4WXT A;  1Z3E A;  2X8C A;  3O3T A;  5A4V A;  1R7H A;  3P90 A;  1Y25 A;  1U87 A;  4IN0 A;  5IO0 A;  5JWO B;  1XXU A;  5CRG A;  2H75 A;  3EMX A;  5D9X A;  3LFL A;  4FH8 A;  3FEU A;  19GS A;  1X9M B;  3DML A;  2LQQ A;  3C1R A;  3DKS A;  4MJC A;  4O5Q A;  3ZL5 A;  3VFI A;  3ED3 A;  3HYP A;  2R5G A;  1M0U A;  4ZBB A;  3DWV A;  1Q98 A;  3DVW A;  3HVV A;  2B1K A;  2GSR A;  2HSN A;  5DBQ A;  3QCP A;  4ZBA A;  3F9U A;  1A2M A;  3ZFL A;  1LBK A;  4KH7 A;  1XVQ A;  2YP6 A;  4ZB7 A;  3V1W A;  3IK7 A;  5ID2 A;  1V98 A;  1LU4 A;  2HZF A;  5J4V A;  1TI3 A;  3KTL A;  2TRC P;  5CNW A;  1TXU A;  2KHP A;  2J9H A;  4KW6 A;  2FA8 A;  4ZL8 A;  3MWH A;  3CTF A;  2H0H A;  1TU8 A;  1SL1 B;  1XOA A;  3APO A;  2RUF A;  2HLS A;  1RW1 A;  4Q5Q A;  3TJB A;  2QA1 A;  4IQA A;  1TJD A;  1BG5 A;  4HZ2 A;  2P0G A;  3BCK A;  2WZS A;  4L0W A;  2L5O A;  1EZK A;  4ICY A;  4IS0 A;  2A4V A;  3D22 A;  4TXO B;  4POK A;  3O76 A;  3QMX A;  1TRU A;  4WF4 A;  2EFC A;  2EFH A;  1R5P A;  1G6Y A;  4F82 A;  2ON5 A;  2V32 A;  5D96 A;  5B8B A;  5AN1 A;  3WYW A;  4N0Z A;  3KZQ A;  2B1L A;  4K5R A;  4GQF A;  2UZ8 A;  1F3B A;  4ZL9 A;  1XWA A;  1R4W A;  3BBY A;  1M7T A;  1EP7 A;  4NHZ A;  2DJJ A;  5A34 A;  1YKC A;  3Q19 A;  4O5R A;  5F05 A;  1VGL A;  2JZR A;  5HFG A;  1XOB A;  3CRT A;  1WPI A;  1Z7P A;  2DJ0 A;  3F3Q A;  2B5X A;  1OC9 B;  3VK9 A;  4FYC A;  2YWM A;  3UAR A;  4EDZ A;  5IOW A;  3ERF A;  2E2M A;  2LJR A;  1AAZ A;  2BMX A;  3RBT A;  4KAE A;  1H4O A;  3TJK A;  3A5W A;  4PHZ C;  5ELG A;  4G19 A;  6GSV A;  5GAP D;  1HNB A;  2MMA A;  3UBK A;  4BVX B;  3ZLP A;  3EC3 A;  1GSD A;  1NM3 A;  2HFD A;  1WP0 A;  4DSR A;  3H1N A;  2OKA A;  4ML1 A;  5HR3 A;  5IMZ A;  4X43 A;  1SYR A;  1G7O A;  2X99 A;  4BPY A;  1BQ7 A;  4TKY A;  4JR6 A;  3IHQ A;  1SKS B;  2M80 A;  4Z2R A;  3ZIT A;  2DKH A;  4OCF A;  3IA1 A;  5EY6 A;  2B7K A;  1SJI A;  1TK5 B;  2V41 A;  3FK8 A;  3IR4 A;  4XRA A;  2C3T A;  4BL7 B;  1YVL A;  3UJ1 A;  4HU9 A;  1O7U A;  2VLT A;  5GAN D;  4OO5 A;  3SWL A;  1PN9 A;  1GNE A;  2HE3 A;  1F6M C;  4KND A;  4OD7 A;  5H5R A;  3NZN A;  4TRX A;  2AYT A;  2IMD A;  3VWW A;  3TKS C;  1MDI A;  1OE7 A;  2EIR A;  3HJM A;  4GDF A;  1GUM A;  2GQL A;  1U3A A;  1K0C A;  1Z7R A;  3A2W A;  3TKP A;  4KUN A;  1OC3 A;  3ZYW A;  4MJE A;  4IKH A;  1TRW A;  3UIW A;  1U3I A;  3FW2 A;  1ZYP A;  3F8U A;  2LJA A;  2LJK A;  2FD3 A;  1EV9 A;  1FAA A;  2WRT A;  2IME A;  1S3C A;  5JWQ B;  1S4B P;  2ON7 A;  2VLV A;  3BOA A;  2FWF A;  4KDX A;  3L78 A;  4YQM A;  4GSS A;  4YAP A;  4YAV A;  4ML6 A;  2CAI A;  2R3X A;  3TKS A;  3FRC A;  3SBC A;  3GRX A;  2JZS A;  4OMV A;  1ERU A;  1SD9 A;  4IBP A;  4E8E A;  1QQ2 A;  2B7J A;  2VUP A;  4J57 E;  4YH2 A;  3IC8 A;  3LJR A;  4KB3 A;  3BJ5 A;  2CV4 A;  2NVL A;  1I1I P;  2GGT A;  2I4A A;  6GSY A;  3VLN A;  2GVP A;  4MP4 A;  3IC4 A;  2QGV A;  4LL1 B;  5J9B A;  3U5R E;  3E0U A;  4K8M A;  3PR8 A;  2QKE A;  4K2D A;  1BG1 A;  1YEP A;  2GT5 A;  4I2T A;  3KH9 A;  3FR9 A;  1SKW B;  2F51 A;  3TRQ A;  5BMU B;  2WGR A;  5AGY A;  5C04 A;  3C71 A;  1BYE A;  2MMO A;  4K1F A;  1ERW A;  3GH9 A;  4V1A p;  2EIQ A;  1QFN A;  2XC2 A;  4XIH A;  4IP6 A;  5HFK A;  2FCH A;  2O8V B;  2TIR A;  4TXO A;  1I9D A;  3ME8 A; 
#chains in the Genus database with same CATH homology
 3FY7 A;  2HSH A;  3A2V A;  2HZE B;  1O85 A;  4KGI A;  4RQR A;  3N9J A;  1XCC A;  2OA7 A;  4JED A;  4Q5R A;  3WT2 A;  1JZD A;  1GSE A;  4WKW A;  2HQT A;  2OT3 A;  1VRS D;  2DJK A;  2VCT A;  2DJ2 A;  6GSX A;  3GL3 A;  4FYU A;  4QQ7 A;  1IYH A;  5FWG A;  1ON4 A;  3C1S A;  2HI7 A;  1TK0 B;  4K7I A;  2I3Y A;  1OC9 A;  1BX9 A;  2N5A A;  3HZ4 A;  2FY6 A;  4WET A;  1FVJ A;  3U6V A;  4GST A;  1W4V A;  3R2Q A;  4FO5 A;  2C3Q A;  2IMI A;  3IRA A;  2IIY A;  4N0V A;  1MTC A;  4MF6 A;  5HFI A;  2MBT A;  3W8J A;  4ZB8 A;  4K7O A;  4F0C A;  16GS A;  2VIM A;  4BVX A;  3CSH A;  1X0R A;  5DCH A;  2HRK B;  1AQX A;  1T4Z A;  1DUG A;  2FLS A;  1J0F A;  3QDN A;  3M3M A;  2EFE A;  4Q5N A;  1S3D A;  2C4J A;  3DD3 A;  4CY6 A;  3D5J A;  4AGS A;  4X1U A;  5IMD A;  4OWY A;  1KNG A;  1WJK A;  1SJZ A;  3UOM A;  1XBS A;  14GS A;  2DJ1 A;  3F4T A;  1VF1 A;  3QAG A;  4YKF A;  2K8V A;  4BL7 A;  4BWQ A;  1SJ6 A;  4F0B A;  6GST A;  5CP1 A;  2LRC A;  1K0B A;  3IAS 2;  4WR5 A;  2H71 A;  2VCW A;  5DJL A;  2VL3 A;  1V57 A;  2AV4 A;  3GST A;  2IL3 A;  1Z5Y E;  1SVO A;  1JLW A;  3A3T A;  2VOC A;  1ZMA A;  3K8N A;  1K0O A;  1UC7 A;  1T3B A;  1Y6E A;  3KH7 A;  1TXX A;  4O5U A;  3RHC A;  5HR1 A;  3F6D A;  2FNO A;  4KX4 A;  2NBS A;  3VWV A;  3ISO A;  2XPD A;  1A8Y A;  4HI7 A;  2MBS A;  2L4Q A;  1ABA A;  3GKM A;  1PL2 A;  5J41 A;  4KCE A;  6GSW A;  3F0I A;  5AIX A;  5A5K A;  4PUA A;  4USS A;  4WR4 A;  5DDL A;  4BWS A;  2IN3 A;  2H6Y A;  3US3 A;  3CSI A;  3TKQ A;  1K3L A;  2H6X A;  4POL A;  5KN2 A;  4JE1 A;  5A1N B;  3MDK A;  5JCU A;  5H5S A;  2OAC A;  11GS A;  1AQV A;  1K3Y A;  4N10 A;  2VM2 A;  1GNW A;  3ZML A;  4POB A;  1YQ1 A;  1MD3 A;  1XPV A;  3QOU A;  5LNK e;  4OFM A;  1T1V A;  4MA9 A;  4Q5F A;  2X64 A;  1WRY A;  4EIQ A;  4KDY A;  3W6G A;  1B4P A;  4FYB A;  4P3Y B;  3IK9 A;  4HJ2 A;  4MPG A;  4NPB A;  2GZP A;  2H19 A;  3KP8 A;  1UVZ A;  5ECS A;  2D2Z A;  2H1L A;  1RQM A;  4HU7 A;  3IAM 2;  2WDU A;  2C80 A;  4MMM A;  3H93 A;  3G9B A;  2H0G A;  3GKN A;  12GS A;  3QAV A;  1FVK A;  1XFL A;  1R26 A;  2H0I A;  2KUC A;  4PGT A;  4PQI A;  3EYT A;  2LS5 A;  4PTS A;  4JU5 A;  1X9S B;  2LST A;  5BMU A;  2NTO A;  2VL9 A;  1ILO A;  2FWE A;  5JCG A;  4IEL A;  3RHB A;  3GX0 A;  2P31 A;  2XHF A;  2KLX A;  3QD9 A;  4AKG A;  1WWJ A;  3MNG A;  2BTO T;  3H4K A;  2N5B A;  1M99 A;  4G0K A;  1EOG A;  3CWG A;  3UMA A;  1MEK A;  5J47 A;  3EPT A;  4PQ1 A;  4V2N A;  5IIZ A;  2WB9 A;  5A4W A;  3Q6O A;  1JZO A;  5CRE A;  5IMV A;  1YZX A;  4G10 A;  2WUL A;  2HZE A;  4GRF A;  2V1M A;  1GSQ A;  2A2R A;  1TK8 B;  2CA8 A;  2OJL A;  3IHG A;  2CVB A;  4DEJ A;  4J2F A;  2OBI A;  3LSZ A;  4AKI A;  5CAX A;  4EKZ A;  2R4V A;  1XWG A;  1CQH A;  4W66 A;  4K0G A;  3WT1 A;  1SVM A;  3ZIV A;  1AQW A;  2JU5 A;  1TU7 A;  2K18 A;  4HS1 A;  2IMK A;  3ZVJ A;  1QXH A;  4WBR D;  3TUE A;  1JZW A;  2VCQ A;  3D6I A;  4WF5 A;  1XW9 A;  4IP1 A;  3DIE A;  4HQS A;  1ZGN A;  2VD0 A;  1Y1U A;  4XTS A;  1EP8 A;  2A2P A;  4PXO A;  2YJ7 A;  5HQP A;  4Z7X A;  1M2B A;  2HRK A;  1PX7 A;  5G1L A;  2LEG A;  5L71 A;  3DVX A;  5ECH B;  2ES7 A;  1O8X A;  4MZC A;  2RII A;  1TW9 A;  4GXZ A;  2M72 A;  3IE3 A;  4TR1 B;  3F6F A;  5ECP B;  1A24 A;  4CW9 A;  8GSS A;  1THO A;  1VF2 A;  2GSS A;  1PKW A;  2L4C A;  1TDI A;  1GSF A;  2H70 A;  2O85 A;  2YWN A;  3KTB A;  3VUR A;  3I69 A;  1TTZ A;  1PA3 A;  2H30 A;  4EL1 A;  2H76 A;  2A4H A;  3CSJ A;  1NSW A;  2J23 A;  4ZB9 A;  2WFC A;  2WS2 A;  5AIS A;  1O73 A;  2JZT A;  4KA0 A;  4AJ8 A;  5IPG A;  2GDR A;  2G2Q A;  2RM6 A;  1R5A A;  2O89 A;  1G0T A;  3IDV A;  3IPZ A;  4F2I A;  1PKZ A;  3F63 A;  1GUH A;  1HQO A;  1DSB A;  1EOH A;  4YQU A;  3QFB C;  2DSA A;  2XBQ A;  3S9F A;  2MMZ A;  5AIV A;  2AUV A;  4LL4 B;  4XHM A;  5LD0 A;  4GF0 A;  2NPB A;  1EEM A;  1V9W A;  1FHE A;  1B8X A;  3D21 A;  2YOI A;  3TOU A;  2GTU A;  5A1N A;  2H1A A;  2I1U A;  5GST A;  2O5V A;  3HJP A;  3GV1 A;  2E0Q A;  3GYK A;  3HZ8 A;  1K0A A;  3KCM A;  5E4W A;  1PN0 A;  3DRN A;  1K3O A;  4AKX B;  2C1Y A;  4HOJ A;  4X0X A;  4F03 A;  1Z6M A;  1AW9 A;  3FKF A;  3FMW A;  3GKX A;  3ZMK A;  5G30 A;  1GL8 A;  2DLX A;  3LEF A;  4PQH A;  2OBK A;  2IMF A;  4RUV A;  4ISD A;  3PGT A;  3VI7 A;  1HNC A;  1FB0 A;  4PUR A;  4CDO A;  1TRV A;  1GP1 A;  3ERW A;  4K7N A;  1Z9H A;  5B8A A;  1AXD A;  2HYX A;  1XZO A;  1GWC A;  1BAY A;  4EUY A;  1QMV A;  4OFN A;  5BRT A;  3GH6 A;  4MF7 A;  2GSQ A;  3R3E A;  1NW2 A;  1QK8 A;  2C0D A;  1UA5 A;  2RM5 A;  4NXI A;  2F3M A;  9GSS A;  3LYK A;  5IQY A;  3TJF A;  2GT6 A;  4AJ7 A;  1V40 A;  1XW6 A;  4AI6 A;  4LMV A;  5G5F A;  1BJX A;  3I43 A;  4CHS A;  4WEY A;  3H8Q A;  1V2A A;  2VLU A;  1F37 A;  1K0D A;  3NIV A;  3HKR A;  5H5Q A;  1PX6 A;  3VI5 A;  5DAK B;  4LA1 A;  3HVX A;  3VPQ A;  3UVH A;  1YF0 A;  4XRD A;  3RPP A;  5J3R A;  2VCX A;  4GWR A;  3GKK A;  1A23 A;  5ELA A;  2F8A A;  2DML A;  3LWA A;  4V2M A;  5D93 A;  1GLQ A;  1YF1 A;  2H66 A;  5J5N A;  2MYG A;  2PMT A;  5B7C A;  3GNJ A;  4YKG A;  1GRX A;  1EEJ A;  2B3S A;  3CBU A;  1XWC A;  5HR0 A;  3QAW A;  2F8F A;  3IXR A;  1B9X C;  1WE0 A;  4MLY A;  2VD1 A;  1UN2 A;  5IOX A;  3DEX A;  2H1G A;  3RAZ A;  3MSZ A;  2B5E A;  2V2G A;  1BF5 A;  2I9H A;  2VCZ A;  3TU3 B;  4HUA A;  4MDC A;  4J56 E;  1T00 A;  3C8E A;  3WGE A;  4DSS B;  1SKR B;  2CT6 A;  2L57 A;  2WZ9 A;  1GLP A;  2P5Q A;  4K5S A;  4IJI A;  3UL3 A;  1Q4J A;  3I9V 2;  4TR1 A;  2EC4 A;  3KGK A;  2ZUP A;  1SL2 B;  3FR3 A;  5KEJ A;  3M8N A;  1FOV A;  4OO4 A;  1GUL A;  5ECM B;  2C8U A;  1HNA A;  2HRF A;  2ZNM A;  4NHW A;  1XWK A;  2HNL A;  1WMJ A;  3L9V A;  4XS1 A;  3FYG A;  2IFQ A;  3GTU B;  3CRU A;  3WD6 A;  4IW9 A;  5CRH A;  3VWU A;  2AB6 A;  2LTK A;  5DQS A;  1JHB A;  5EVO A;  1FOH A;  4ZIL A;  1A0F A;  13GS A;  1PL1 A;  3KM6 A;  4A5P A;  2YNX A;  3L9S A;  5F8B A;  2LNT A;  2CX4 A;  2I81 A;  20GS A;  1AUC A;  2QC7 A;  1EV4 A;  3L4N A;  4V2L A;  3G7J A;  3QFA C;  5ENU A;  3GN3 A;  4ZL7 A;  1H75 A;  3PIN A;  3GUS A;  2YZU A;  4KSM A;  4X4J A;  3P8W A;  1DE2 A;  1F9M A;  3APQ A;  3KP9 A;  2QSI A;  5J4U A;  4TR4 A;  3E9J B;  2B6M A;  5LCZ A;  22GS A;  3F3R A;  2O7K A;  2CAQ A;  1PRX A;  2TRX A;  3F4R A;  4O32 A;  2ALB A;  1MDJ A;  4HDE A;  4ZB6 A;  3HHV A;  1GSU A;  4I2U A;  2JL4 A;  2WJU A;  4O7H A;  3GL5 A;  2H8L A;  2L6D A;  2FHE A;  1ZYE A;  4NWY A;  4EE0 A;  1PQN A;  3MYD A;  2L6C A;  2LRN A;  2CX3 A;  3EWL A;  5IO2 A;  5ABR A;  2PN8 A;  1FG4 A;  2R2J A;  2X49 A;  3FHK A;  3ZFB A;  2HT9 A;  3E3E A;  2CVK A;  1AIU A;  1X9W B;  1E2Y A;  1SK0 A;  3GX8 A;  4K6X A;  2YCD A;  6GSU A;  3LXZ A;  2DMM A;  2YV9 A;  2PER A;  3KMO A;  5A5H B;  4GTU A;  1SL0 B;  2LRT A;  2X8G A;  4BA7 A;  3HCZ A;  4G2E A;  2YV7 A;  5J9C A;  5ECI B;  1MD4 A;  2L5L A;  1A2J A;  1THX A;  3H79 A;  3M0F A;  3W8S A;  2AAW A;  4POM A;  2OE1 A;  1XVW A;  5F0G A;  5J40 A;  2PVQ A;  3TOT A;  4K2X A;  2VO4 A;  3HD5 A;  4EIP A;  3TDG A;  4N30 A;  1PMT A;  5DAK A;  1SEN A;  1SD8 A;  2R37 A;  3ZIJ A;  2H1B A;  2K6V A;  4V1A g;  2F9S A;  4G9H A;  1U6T A;  5A4U A;  18GS A;  2DIZ A;  3OR5 A;  4KSO A;  2L59 A;  4TVE A;  1VF4 A;  1YKA A;  3EUR A;  1ACV A;  1GH2 A;  1OYJ A;  4L5O A;  5IMA A;  2JSZ A;  4AKH A;  4MZB A;  4Z2T A;  4GCI A;  5G5E A;  4PUF C;  3PH9 A;  5CO3 A;  1C72 A;  3A5I A;  2YWI A;  1YJ6 A;  7GSS A;  1N2A A;  1XIY A;  3ZVJ D;  3ZTL A;  4ID0 A;  2LNS A;  1SVL A;  2HXK A;  1DBY A;  1DE1 A;  3ERG A;  2YN1 A;  1F3A A;  4MAB A;  1PSQ A;  4DSS A;  1MDK A;  2GQK A;  1FW1 A;  3APS A;  10GS A;  4I6X A;  1ZCP A;  1PGT A;  4NV5 A;  4E68 A;  2M46 A;  1A8L A;  2RLI A;  2OE3 A;  1V58 A;  2YWO A;  2VKZ G;  3LOR A;  3QPM A;  4QL9 A;  1X5E A;  3RPN A;  2HSM B;  1EGR A;  3LXT A;  4L8E A;  2EFD A;  5ECQ B;  2CQ9 A;  4KE3 A;  5FHI A;  5JWR B;  1QGV A;  4EXJ A;  4ZIJ A;  1Z6N A;  3KEB A;  5ECL B;  6GSS A;  3LGC A;  2LUS A;  5EL8 A;  4TXV A;  2AJQ B;  3GTU A;  4RQX A;  2RUE A;  1K0N A;  2QA2 A;  4N11 A;  3EIN A;  4NAX A;  5GZZ B;  3EE2 A;  1JFU A;  1ZYQ B;  4EDY A;  2VCV A;  3LG6 A;  2YJH A;  5KOX A;  3Q18 A;  4G0I A;  4KF9 A;  5F06 A;  2LKU A;  3HY2 A;  2X4A A;  2XPE A;  5HR2 A;  5EPF A;  2DJ3 A;  5DCG A;  1EGO A;  5F07 A;  4EF0 A;  2GS3 A;  1O81 A;  2DC5 A;  4CY8 A;  1AC1 A;  4QL7 A;  1T8E B;  3G7Y A;  1ST9 A;  2IFQ B;  4OFT A;  4EO3 A;  4LLR A;  4KDU A;  5DAL B;  1ML6 A;  2KP2 A;  2WCI A;  4ECI A;  4O92 A;  5D9T A;  1N8J A;  1TRS A;  4YQV A;  3HJO A;  2JSY A;  2V6K A;  5DVB A;  2PVO C;  3GFK A;  1VF3 A;  4XS6 A;  5C00 A;  1QUW A;  5ECN B;  1OAZ A;  3UEM A;  3HDC A;  4MJA A;  3GHA A;  3LW9 A;  4MZW A;  2BJX A;  4OCE A;  5JCW A;  2R0C A;  3LYP A;  17GS A;  3TCO A;  4RI7 A;  2IPA A;  3FZ4 A;  2H72 A;  4HQZ A;  1OC8 A;  1TKD B;  5G2Z A;  3C73 A;  2IWT A;  4IQ1 A;  3J7Y k;  2FGX A;  4WBJ A;  2UV8 G;  1RK4 A;  2OE0 A;  4JRR A;  1LJR A;  4F9Z A;  3ZZX A;  2VL2 C;  4Z2U A;  3TRX A;  5B6M A;  3TJJ A;  3HVS A;  3MIX A;  4TN8 A;  3CXG A;  5D8I A;  4JZQ A;  5A5H A;  1SYX A;  2DBC A;  2V6O A;  5INY A;  2LQO A;  4H86 A;  4I8B A;  1K0M A;  1M9B A;  1I5G A;  4QMK A;  5KN0 A;  1M2D A;  2PWJ A;  1GSY A;  1T4Y A;  2K8S A;  3EU4 A;  1PD2 1;  1W89 A;  4TR3 A;  1X5D A;  4XCS A;  2GZZ A;  2VL2 A;  4XS4 B;  3FZA A;  2N5F A;  4ECC A;  4N3Z A;  3QR6 A;  4TR0 A;  4L0U A;  2CZ2 A;  3TJG A;  1JZR A;  4PNG A;  2DKI A;  3P2A A;  1ERT A;  5ECR B;  1FO5 A;  4G01 A;  1OKT A;  3GIX A;  4BVY B;  1U88 A;  3IOS A;  2EIO A;  1ZL9 A;  4JBB A;  4I97 A;  1M9A A;  2B5Y A;  5G31 A;  1A2L A;  3J7Y b;  4IVF A;  1O8W A;  3L9U A;  4MCU A;  3UVT A;  5G1K A;  3Q74 A;  1BED A;  1TOF A;  5IMC A;  4D73 B;  3NOF A;  5ECK B;  2DIY A;  3TKR A;  2PPT A;  1GTA A;  3DYR A;  1M2A A;  2IJY A;  2Z9S A;  1HYU A;  3I6A A;  3TGZ A;  1SK2 A;  2R0G A;  2GST A;  3MAK A;  2NDO A;  1CQG A;  1B48 A;  2XBI A;  3TRP A;  3RDW A;  5GSS A;  1TP9 A;  5E59 A;  5IPH A;  2HSM A;  5D9V A;  1A0R P;  1ZOF A;  5KN1 A;  4MJB A;  5COH A;  1SU9 A;  1FB6 A;  3G7I A;  2O87 A;  2FWG A;  4HJM A;  4RI6 A;  3GUR A;  4NV2 A;  1OVN A;  1N25 A;  4MH3 A;  1EWX A;  3C7M A;  2E2G A;  1USB A;  3ME7 A;  1XW5 A;  4HZ4 A;  3WGD A;  2PBJ A;  4DVC A;  3FZ9 A;  5IMF A;  2HSN B;  2C3N A;  3EVI A;  4MPF A;  2P5R A;  1GTU A;  3KJY A;  2H6Z A;  3GSS A;  5ID2 B;  2H1D A;  3LQ7 A;  1B4Q A;  2JAD A;  1J9B A;  2LV3 A;  3F4S A;  3BCI A;  4HEA 2;  3VWX A;  3KXO A;  1YEX A;  4TOP A;  4MH2 A;  1JLV A;  1GSS A;  1WOU A;  5DJM A;  2KOK A;  3D4T A;  3CYN A;  4GSN A;  5CYY A;  1X5C A;  5FT3 A;  1J08 A;  3D4M A;  1GTB A;  4FIW A;  4ILF A;  3HMJ G;  4E8H A;  3P7X A;  2HRN A;  4MK3 A;  4ZBD A;  4AF2 A;  3EMP A;  3KD0 A;  1O6J A;  1URM A;  2CVD A;  5CRD A;  4AJ6 A;  5DAL A;  4FQU A;  2C0E A;  1GUK A;  1F2E A;  1G7E A;  2KP1 A;  4LMW A;  4I5Q A;  3HA9 A;  1WIK A;  2H74 A;  3ZRE A;  4KCA A;  3TB2 A;  2R0P A;  4EVM A;  4ECJ A;  1GTI A;  3CMI A;  1S3A A;  1ZZY A;  3UAP A;  5A34 B;  3GA4 A;  4IHU A;  2CZ3 A;  4K9Z A;  1E6B A;  2G0F A;  4ZXG A;  3IV4 A;  2ZCT A;  1YDK A;  3L0H A;  3FZ5 A;  3FR6 A;  4IJ3 A;  1YY7 A;  1HD2 A;  5CRW A;  4MNN A;  2K9F A;  5KOW A;  5D73 A;  1T7P B;  3GMF A;  3HXS A;  3A2X A;  5J4Y A;  3CTG A;  2OAD A;  3M9K A;  5KN3 A;  3WGX A;  2FA4 A;  2H01 A;  2MZC A;  3DXB A;  2YPM A;  4EC0 A;  4L5L A;  1G6W A;  2MMN A;  3JCM L;  3KMN A;  4GLT A;  2E7P A;  3DGQ A;  2H73 A;  2PU9 C;  4G0L A;  5ECO B;  2GQM A;  3M9J A;  1SK1 A;  4JR4 A;  1OE8 A;  4ACS A;  3UBL A;  2PGT A;  2C0F A;  1KBN A;  2GLR A;  4XS4 A;  1KEB A;  2FUG 2;  5B6N A;  2VAF A;  2C0G A;  3AY8 A;  4GQC A;  3D0Z A;  3PPU A;  4NMU A;  5IM9 A;  4MF5 A;  2REM A;  4ULX A;  2YZH A;  2R6K A;  4BVY A;  4PNF A;  1B9Y C;  4ECB A;  2PUK C;  4DSQ A;  3M1G A;  2GZY A;  2YAN A;  4TW5 A;  1IYI A;  1NHY A;  1KTE A;  3ZRD A;  3VPT A;  1XWB A;  3IBH A;  4K0N A;  5D9W A;  2HSY A;  2FWH A;  3EU3 A;  1OKD A;  3TKS E;  2X8H A;  3O6T A;  4D73 A;  1ZYN A;  2HRA A;  2JAC A;  1TI1 A;  3N5O A;  2VM1 A;  2A2S A;  3KIJ A;  2AHE A;  4PX1 A;  4IGJ A;  3BD2 A;  1ERV A;  5DQY A;  1NHO A;  4WXT A;  1Z3E A;  2X8C A;  3O3T A;  5A4V A;  1R7H A;  3P90 A;  1Y25 A;  1U87 A;  4IN0 A;  5IO0 A;  5JWO B;  1XXU A;  5CRG A;  2H75 A;  3EMX A;  5D9X A;  3LFL A;  4FH8 A;  3FEU A;  19GS A;  1X9M B;  3DML A;  2LQQ A;  3C1R A;  3DKS A;  4MJC A;  4O5Q A;  3ZL5 A;  3VFI A;  3ED3 A;  3HYP A;  2R5G A;  1M0U A;  4ZBB A;  3DWV A;  1Q98 A;  3DVW A;  3HVV A;  2B1K A;  2GSR A;  2HSN A;  5DBQ A;  3QCP A;  4ZBA A;  3F9U A;  1A2M A;  3ZFL A;  1LBK A;  4KH7 A;  1XVQ A;  2YP6 A;  4ZB7 A;  3V1W A;  3IK7 A;  5ID2 A;  1V98 A;  1LU4 A;  2HZF A;  5J4V A;  1TI3 A;  3KTL A;  2TRC P;  5CNW A;  1TXU A;  2KHP A;  2J9H A;  4KW6 A;  2FA8 A;  4ZL8 A;  3MWH A;  3CTF A;  2H0H A;  1TU8 A;  1SL1 B;  1XOA A;  3APO A;  2RUF A;  2HLS A;  1RW1 A;  4Q5Q A;  3TJB A;  2QA1 A;  4IQA A;  1TJD A;  1BG5 A;  4HZ2 A;  2P0G A;  3BCK A;  4L0W A;  2L5O A;  1EZK A;  4ICY A;  4IS0 A;  2A4V A;  3D22 A;  4TXO B;  4POK A;  3O76 A;  3QMX A;  1TRU A;  4WF4 A;  2EFC A;  2EFH A;  1R5P A;  1G6Y A;  4F82 A;  2ON5 A;  2V32 A;  5D96 A;  5B8B A;  5AN1 A;  3WYW A;  4N0Z A;  3KZQ A;  2B1L A;  4K5R A;  4GQF A;  2UZ8 A;  1F3B A;  4ZL9 A;  1XWA A;  1R4W A;  3BBY A;  1M7T A;  1EP7 A;  4NHZ A;  2DJJ A;  5A34 A;  1YKC A;  3Q19 A;  4O5R A;  5F05 A;  1VGL A;  2JZR A;  5HFG A;  1XOB A;  3CRT A;  1WPI A;  1Z7P A;  2DJ0 A;  3F3Q A;  2B5X A;  1OC9 B;  3VK9 A;  4FYC A;  2YWM A;  3UAR A;  4EDZ A;  5IOW A;  3ERF A;  2E2M A;  2LJR A;  1AAZ A;  2BMX A;  3RBT A;  4KAE A;  1H4O A;  3TJK A;  3A5W A;  5ELG A;  4G19 A;  6GSV A;  5GAP D;  1HNB A;  2MMA A;  3UBK A;  4BVX B;  3ZLP A;  3EC3 A;  1GSD A;  1NM3 A;  2HFD A;  1WP0 A;  4DSR A;  3H1N A;  2OKA A;  4ML1 A;  5HR3 A;  5IMZ A;  4X43 A;  1SYR A;  1G7O A;  2X99 A;  4BPY A;  1BQ7 A;  4TKY A;  4JR6 A;  3IHQ A;  1SKS B;  2M80 A;  4Z2R A;  3ZIT A;  2DKH A;  4OCF A;  3IA1 A;  5EY6 A;  2B7K A;  1SJI A;  1TK5 B;  2V41 A;  3FK8 A;  3IR4 A;  4XRA A;  2C3T A;  4BL7 B;  1YVL A;  3UJ1 A;  4HU9 A;  1O7U A;  2VLT A;  5GAN D;  4OO5 A;  3SWL A;  1PN9 A;  1GNE A;  2HE3 A;  1F6M C;  4KND A;  4OD7 A;  5H5R A;  3NZN A;  4TRX A;  2AYT A;  2IMD A;  3VWW A;  3TKS C;  1MDI A;  1OE7 A;  2EIR A;  3HJM A;  4GDF A;  1GUM A;  2GQL A;  1U3A A;  1K0C A;  1Z7R A;  3A2W A;  3TKP A;  4KUN A;  1OC3 A;  3ZYW A;  4MJE A;  4IKH A;  1TRW A;  3UIW A;  1U3I A;  3FW2 A;  1ZYP A;  3F8U A;  2LJA A;  2LJK A;  2FD3 A;  1EV9 A;  1FAA A;  2WRT A;  2IME A;  1S3C A;  5JWQ B;  2VLV A;  2ON7 A;  3BOA A;  2FWF A;  4KDX A;  3L78 A;  4YQM A;  4GSS A;  4YAP A;  4YAV A;  4ML6 A;  2CAI A;  2R3X A;  3TKS A;  3FRC A;  3SBC A;  3GRX A;  2JZS A;  4OMV A;  1ERU A;  1SD9 A;  4IBP A;  4E8E A;  1QQ2 A;  2B7J A;  2VUP A;  4J57 E;  4YH2 A;  3IC8 A;  3LJR A;  4KB3 A;  3BJ5 A;  2CV4 A;  2NVL A;  2GGT A;  2I4A A;  6GSY A;  3VLN A;  2GVP A;  4MP4 A;  3IC4 A;  2QGV A;  4LL1 B;  5J9B A;  3U5R E;  3E0U A;  4K8M A;  3PR8 A;  2QKE A;  4K2D A;  1BG1 A;  1YEP A;  2GT5 A;  4I2T A;  3KH9 A;  3FR9 A;  1SKW B;  2F51 A;  3TRQ A;  5BMU B;  2WGR A;  5AGY A;  5C04 A;  3C71 A;  1BYE A;  2MMO A;  4K1F A;  1ERW A;  3GH9 A;  4V1A p;  2EIQ A;  1QFN A;  2XC2 A;  4XIH A;  4IP6 A;  5HFK A;  2FCH A;  2O8V B;  2TIR A;  4TXO A;  1I9D A;  3ME8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...