2FHEA

Fasciola hepatica glutathione s-transferase isoform 1 in complex with glutathione
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
216
Chain Sequence
PAKLGYWKIRGLQQPVRLLLEYLGEKYEEQIYERDDGEKWFSKKFELGLDLPNLPYYIDDKCKLTQSLAILRYIADKHGMIGTTSEERARVSMIEGAAVDLRQGISRISYQPKFEQLKEGYLKDLPTTMKMWSDFLGKNPYLRGTSVSHVDFMVYEALDAIRYLEPHCLDHFPNLQQFMSRIEALPSIKAYMESNRFIKWPLNGWHAQFGGGDAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Crystallization, structural determination and analysis of a novel parasite vaccine candidate: Fasciola hepatica glutathione S-transferase.
pubmed doi rcsb
source organism Fasciola hepatica
molecule tags Transferase/substrate
total genus 71
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2fheA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fheA01
2AJQB 4GCIA 1VF1A 3MAKA 3PR8A 1Z7PA 2H75A 2PPTA 1F37A 4CHSA 3P90A 4DSSB 2VCQA 5DJMA 5ECPB 2H01A 5FT3A 2P5RA 3TKPA 7GSSA 2MMAA 3L9VA 3VWVA 2H71A 1VF4A 1EGOA 1U6TA 2JZSA 4MABA 4CW9A 1Y6EA 3FW2A 3RPPA 1O8XA 3KP8A 1LBKA 2RUEA 4ZBAA 1FOVA 3GH9A 4QL9A 2OADA 2H1DA 1Z7RA 5B6MA 4IN0A 3FY7A 3FR3A 3TJKA 4E8EA 1B9XC 3FR6A 2DJJA 2RUFA 1XW5A 4F03A 1AAZA 1GTUA 4WR5A 1ML6A 1V98A 3KH9A 3N9JA 4XCSA 19GSA 2OE0A 1HNCA 1XFLA 4L0UA 3QAGA 5ECKB 1AW9A 1R4WA 2OBKA 3EE2A 2N5AA 2K8SA 3APQA 1OKDA 3F63A 5ECLB 3JCML 3ME7A 3CSHA 3A2WA 1GUKA 1QQ2A 1XIYA 2VUPA 3TRXA 1USBA 1Y25A 4FQUA 1V57A 5CYYA 2GSQA 2MBTA 4Q5FA 1FW1A 2QKEA 4F82A 1SU9A 3A2XA 2FCHA 4NHWA 1T4YA 2WULA 4FYCA 4KE3A 1BX9A 1Q4JA 3ZVJD 2HRNA 5EL8A 1XVWA 2CV4A 1EZKA 4WBRD 1GLPA 4QQ7A 1URMA 4POMA 3HJPA 5J5NA 4MJBA 2IN3A 5ELAA 2FWHA 3FKFA 4LLRA 1T7PB 4KSMA 5LD0A 4PURA 1BAYA 3H1NA 2GSTA 2GT6A 1YY7A 3GFKA 5IMCA 2L57A 1OE8A 1O85A 2IMDA 1GSFA 3C7MA 4IJ3A 4V1Ag 4WR4A 3D5JA 4ZB6A 2ZCTA 2DIZA 3K8NA 2I4AA 2F9SA 4KCEA 4NAXA 3H79A 3RHCA 1KTEA 4WXTA 2LRCA 2HRAA 4MH3A 3VPTA 1X9WB 1X0RA 1K0CA 2A2SA 4HQSA 3L4NA 5CRGA 3WT1A 1MDKA 4YH2A 3EC3A 1OC9A 2EIOA 3I43A 5DQSA 2L4QA 4K6XA 1TU7A 1GSQA 1FAAA 1TXXA 1K0OA 2VIMA 5BMUA 4FYBA 3FZAA 1Z9HA 4GF0A 1QK8A 3GRXA 3N5OA 2VM1A 2IFQA 4N30A 2HRKA 1GNWA 3HKRA 1V9WA 1G0TA 1I5GA 3UL3A 4ZB9A 2K18A 4IQ1A 5HR3A 3W6GA 3CTGA 3ZIJA 5GAPD 4AGSA 4G9HA 4LMVA 1N2AA 3LXTA 12GSA 5CRDA 1NHYA 2OJLA 4FH8A 2TRXA 2B7JA 1S3DA 5L71A 1PN9A 5C04A 4ZXGA 3DXBA 1YDKA 1PX6A 2DIYA 3HHVA 2LQOA 1I9DA 4F0BA 5KN0A 4K7NA 1JZRA 5ECRB 2J23A 2LJAA 4NMUA 1XOAA 1QFNA 1OC9B 3F4SA 4TKYA 4IVFA 3PGTA 1B8XA 5ECNB 4N10A 3D4MA 3GL3A 2VCXA 2FWEA 1F6MC 2J9HA 2H74A 4ZBBA 4K8MA 1T3BA 5IM9A 5DDLA 1PKWA 3M9KA 2IFQB 5GSTA 4G10A 2HRKB 2ES7A 2WGRA 4MJEA 4KNDA 3KEBA 1X5DA 4KAEA 3VWXA 1R7HA 2C0GA 5HFGA 1GLQA 3C1RA 2FWGA 3QFAC 5HFKA 1R5PA 5AN1A 3KJYA 4G19A 1GSYA 1FG4A 3TKSA 1ON4A 5CREA 1X5CA 1DBYA 1VF2A 2DJ1A 3VI7A 5IPHA 2C4JA 2VLTA 1Q98A 4MK3A 1CQGA 1NHOA 4AJ8A 2V41A 2WJUA 4TVEA 4HJMA 4IBPA 4L0WA 1Z6NA 3IHQA 2FLSA 2RM5A 1G6WA 3ZTLA 2MZCA 4EKZA 2C3QA 1HQOA 4OD7A 2PN8A 4MF7A 1MDIA 2HE3A 1A8LA 3PPUA 2JZTA 1LU4A 3EU4A 3BJ5A 4OMVA 4TOPA 2GVPA 4Z7XA 1EV4A 3GKXA 1RQMA 2VAFA 2IPAA 2VCTA 2OE1A 1VF3A 5IMVA 3EMXA 5A5KA 5JWOB 3H93A 3MSZA 2DMMA 1AIUA 4IW9A 2NTOA 3G7JA 3ZITA 4G0LA 2O89A 1SD9A 1OYJA 1EOHA 2AUVA 2GGTA 3GH6A 1PMTA 3FZ5A 1H4OA 1U3AA 4FO5A 4MA9A 1AQWA 1GUHA 3RAZA 1BJXA 3QMXA 2BMXA 2GT5A 1X5EA 2FUG2 3IE3A 2H0HA 4ECCA 4OCEA 2H0GA 1K0AA 5H5QA 1ST9A 1ZGNA 1TRWA 1ZYQB 4DVCA 2RIIA 2LJKA 1XXUA 3QOUA 3EMPA 3LGCA 3O3TA 4J2FA 1XWGA 5GZZB 5G30A 3ZL5A 3ME8A 4BA7A 4BPYA 3FHKA 3GKMA 4NXIA 2WCIA 3UVTA 4GSNA 2E0QA 1H75A 3CSJA 2YWOA 5JWRB 2CVBA 1M99A 3VFIA 4TW5A 4V2MA 4HDEA 1B9YC 5CRHA 3UIWA 1XWCA 1LJRA 3KH7A 3CBUA 3GN3A 3H8QA 4GWRA 2VL9A 4TXOA 2B3SA 3M0FA 1MD4A 3E9JB 2X8CA 5B7CA 4K0NA 5J41A 4HU7A 11GSA 2GSSA 3VWUA 1VRSD 3HY2A 3ZZXA 1B4PA 1Z3EA 3CSIA 4XTSA 5B8AA 4OCFA 1ERWA 1GH2A 1F2EA 3IK9A 4EC0A 1XBSA 2R3XA 3IPZA 4I8BA 4OWYA 4ILFA 3F4RA 1PKZA 2XC2A 3HVSA 2KOKA 1BEDA 2IMKA 4J56E 6GSTA 2XPEA 1TJDA 3ZREA 4JEDA 5CRWA 5G31A 1YEXA 3DVXA 1PD21 4POKA 1AQXA 4MH2A 1SJ6A 4GTUA 4F0CA 1SK1A 4K0GA 4FIWA 3KMNA 1W4VA 1SL0B 5C00A 1XOBA 4IS0A 2I81A 4L8EA 3VURA 1A8YA 2JZRA 1C72A 1WIKA 2H76A 2WS2A 1SJZA 1WPIA 4I2UA 2RLIA 3PH9A 2P31A 5EY6A 1SKRB 1TRUA 1OE7A 2FWFA 4ZILA 1SK2A 1ERTA 2L6CA 4WKWA 1B4QA 2AB6A 3ZVJA 4EL1A 2HFDA 1K0DA 3GX8A 3DEXA 3O6TA 3QAWA 3I6AA 2C1YA 4N11A 1GSSA 2H70A 1XVQA 4GRFA 1YF0A 4GSSA 2LJRA 4EE0A 4X43A 2CX3A 1V40A 1FB0A 4HS1A 3FRCA 4NWYA 22GSA 2H73A 2OBIA 1DUGA 2ZUPA 2LV3A 4V1Ap 4IKHA 4KDYA 3HCZA 1JZWA 2L5LA 1WMJA 4HI7A 3GSSA 2K6VA 1XPVA 1QGVA 5IO2A 1O8WA 4KUNA 3LYKA 5F8BA 2C3TA 1MD3A 4EO3A 1HNBA 4L5OA 4ZB8A 2L6DA 3NZNA 1MDJA 1TRSA 3BCIA 4MZCA 4GQCA 1TOFA 1EEJA 3DD3A 2M46A 3LJRA 5JCUA 2DC5A 3G7IA 3P8WA 3UBLA 4XHMA 3ZMLA 2VL2A 4G0KA 3Q19A 4Q5QA 2PGTA 3BOAA 5D93A 1MTCA 1ZOFA 3NOFA 3M9JA 4TRXA 3HVVA 5H5RA 1EEMA 3DYRA 2HSHA 4JZQA 3U5RE 3KGKA 3M1GA 2CAQA 2F3MA 5CP1A 2GZZA 3FYGA 3TOTA 1GSDA 4BVYA 3GNJA 5IIZA 2WFCA 3UVHA 5GAND 4TR4A 3GIXA 5JCGA 3DWVA 1ACVA 3G9BA 17GSA 4AJ7A 1XZOA 4KDUA 2REMA 5HQPA 2FNOA 4MCUA 2BTOT 1AQVA 1A0FA 2B7KA 2L4CA 2HSMA 4YQMA 4ZL9A 5AIVA 3WGDA 3F8UA 2V6KA 1O73A 1G6YA 2FA8A 3KIJA 3TOUA 3GURA 1TK0B 4MZWA 2V6OA 5AISA 2PU9C 5HR1A 1KEBA 3CYNA 3RDWA 3TKSC 4O32A 1K0MA 1TTZA 2V1MA 1XW6A 3WT2A 4KH7A 4ZL8A 4HOJA 5D73A 1E2YA 1GULA 3F6DA 1TDIA 3MWHA 1IYHA 2VLUA 2YV7A 3IDVA 4AF2A 3FR9A 3HA9A 4TR1A 4LMWA 2HXKA 4BVYB 5ECQB 4WF5A 1F3BA 2HNLA 2H66A 3GSTA 6GSXA 5ECHB 3KM6A 3KD0A 3UMAA 2LRTA 4GSTA 1A2LA 5IOXA 1GTAA 1GUMA 3GHAA 3IV4A 8GSSA 2AYTA 4MF5A 5INYA 1SL1B 2YN1A 2N5BA 1OC3A 1A0RP 4DEJA 1ABAA 3I9V2 1T8EB 2HSMB 2OACA 3ZMKA 3TJFA 2LRNA 1BG5A 2NPBA 3J7Yk 1JLVA 5DALA 2PMTA 2D2ZA 4MPFA 3Q18A 3WD6A 2B1LA 10GSA 4X1UA 4GXZA 1DE2A 1JZDA 1OC8A 4FYUA 2M72A 1GTBA 3Q6OA 5CO3A 3CRUA 5G5EA 1JHBA 2V2GA 3NIVA 4XRDA 3UEMA 2HQTA 5IMZA 3EU3A 3KMOA 4I2TA 3EINA 3HYPA 1ZYEA 1GL8A 5G5FA 5DAKA 5GSSA 3KTBA 1WP0A 2GQMA 4TR1B 2PUKC 4TR0A 1K3LA 5JCWA 4O92A 2EC4A 2JACA 1SYRA 2A2RA 5DVBA 4P3YB 2QGVA 2H72A 4KA0A 3E3EA 1TI3A 1M2AA 1OVNA 3APOA 2E7PA 1Z5YE 1FO5A 2NDOA 4H86A 4ECJA 1YKCA 1DSBA 3TB2A 2IJYA 2GDRA 2VM2A 2IMEA 3HD5A 5ELGA 5DALB 2FD3A 1TRVA 2B5YA 2VCZA 1K0NA 1AC1A 5KEJA 2CAIA 5IO0A 1UC7A 2R4VA 2H1AA 1AUCA 3IRAA 1O6JA 2GSRA 1SL2B 2DLXA 2R37A 2YOIA 1T1VA 2GS3A 2KLXA 2B5EA 4KF9A 3IC8A 1SD8A 4HEA2 4PQIA 4K7OA 4PQ1A 5IQYA 3QR6A 3RHBA 1PSQA 3Q74A 5DAKB 3ZFBA 3OR5A 2VOCA 3V1WA 3ISOA 4PGTA 5G1LA 6GSYA 1SK0A 1EV9A 3LSZA 3GKNA 1TKDB 2E2GA 2O87A 4WBJA 1A24A 5A4WA 1ZCPA 2JSZA 4RI6A 2O8VB 2RM6A 5F05A 4ZIJA 4PUAA 4X0XA 4XS6A 2WZ9A 4MJCA 4KCAA 2G0FA 3TKRA 4WF4A 2YWIA 1RW1A 1JZOA 2EIRA 1FB6A 4HJ2A 3P2AA 1Z6MA 2CX4A 3LEFA 2HZFA 3TUEA 4NHZA 18GSA 4RI7A 1TU8A 2DJ3A 3APSA 3H4KA 2H8LA 2B6MA 2JADA 4I5QA 3C73A 5HFIA 3UOMA 4ECIA 4HUAA 3ZFLA 2R6KA 2PBJA 2DJKA 1GSUA 4L5LA 4V2NA 4G2EA 2PVOC 5D9TA 4JR4A 2LNTA 3EVIA 3LG6A 5IOWA 3WGXA 1KBNA 3DIEA 3ERGA 2MYGA 3QPMA 1A23A 2C0EA 9GSSA 2CVDA 2DSAA 2PWJA 4YQVA 5DCGA 1B48A 4PQHA 5G2ZA 3GV1A 1F9MA 5HR2A 5DQYA 3GL5A 1M7TA 1NW2A 2LTKA 2H0IA 5D8IA 3DMLA 4EDYA 5KN3A 4V2LA 1EGRA 4G0IA 3VWWA 2NBSA 1W89A 2IMFA 1T00A 1EP8A 3UARA 3W8JA 1THXA 1YEPA 1CQHA 1T4ZA 2VL2C 2ON7A 1XWBA 4IP6A 5DBQA 3MDKA 5CNWA 2YZHA 4PXOA 1S3AA 3F4TA 2K9FA 1YZXA 4TXOB 3F3QA 2VCVA 1UN2A 2YJ7A 3C71A 4ZBDA 4BL7A 4ID0A 2DJ0A 4GQFA 4OFMA 2H1BA 1PA3A 4BVXA 2DBCA 5KN2A 3WGEA 4DSQA 4HU9A 4EUYA 4IHUA 3M3MA 2OE3A 1V58A 3TGZA 2R2JA 5ENUA 3ERWA 2GZYA 3IAS2 3IBHA 1YKAA 4XIHA 3LXZA 2WRTA 2MMNA 3ZRDA 2IWTA 2E2MA 2XHFA 1XWKA 3WYWA 3IR4A 2V32A 1U88A 1U87A 5G1KA 3IAM2 2BJXA 1M2DA 1XCCA 2ON5A 4TR3A 3GA4A 4I97A 2O85A 5A4UA 2K8VA 1THOA 4NV5A 1SJIA 4JE1A 4OO5A 1VGLA 2QSIA 3LFLA 3J7Yb 4ULXA 4IQAA 5IPGA 1ZZYA 2GQKA 4XRAA 2KUCA 1K0BA 5ECSA 1K3YA 2JL4A 4N0ZA 2HLSA 4KDXA 3EURA 3FZ4A 5DCHA 5F0GA 2C0DA 3RBTA 2IIYA 2L59A 1OAZA 1IYIA 2G2QA 3CTFA 5F07A 3TJGA 3CMIA 4IGJA 1M0UA 4WETA 2CQ9A 1BQ7A 4RQRA 4BL7B 1G7EA 3F3RA 1QUWA 1A2JA 3GUSA 5H5SA 4MMMA 4BVXB 2LUSA 1BYEA 3EWLA 4JRRA 3GX0A 2AHEA 1QXHA 2KHPA 4BWSA 4MJAA 2CZ2A 3QDNA 2YZUA 3DKSA 3BCKA 2H30A 3HDCA 1GTIA 3TCOA 1RK4A 3UJ1A 2JSYA 1J0FA 4YAPA 1PX7A 3ZLPA 4PTSA 3DGQA 1FVJA 3D21A 2XBQA 3BD2A 1J9BA 4OFTA 3TJJA 3A3TA 1V2AA 2LS5A 1M9AA 2X8GA 3GTUA 1ZMAA 3GKKA 4K9ZA 3RPNA 2QC7A 2AV4A 3EYTA 2NVLA 2LQQA 5D9WA 2C80A 2GTUA 16GSA 3R3EA 1TK5B 4KSOA 2HT9A 3D22A 2HRFA 2CT6A 1R5AA 2KP2A 4EVMA 2MBSA 2X99A 4YQUA 4HQZA 6GSWA 3PINA 3L0HA 3L9SA 2YV9A 1F3AA 3F0IA 1QMVA 1HYUA 5ECIB 3F9UA 13GSA 2FA4A 1DE1A 2I1UA 2C3NA 5ABRA 2LNSA 4D73A 5F06A 4PUFC 1EOGA 1YJ6A 4PNGA 3I69A 5KN1A 4KW6A 2X64A 1PQNA 4NPBA 3SWLA 2AAWA 3S9FA 4DSRA 3UAPA 5ECMB 1PGTA 4CDOA 3TKQA 3U6VA 4O5RA 2HSYA 3LWAA 4OFNA 5D9VA 5A4VA 1TK8B 4K1FA 2IMIA 2YCDA 1O7UA 2YPMA 3E0UA 4ML6A 3A5WA 3GTUB 3KCMA 2PERA 3ZIVA 3IXRA 1PL1A 4ACSA 3HZ8A 1G7OA 5J3RA 5J4UA 3VPQA 2HZEA 3SBCA 3LYPA 4I6XA 2CA8A 3O76A 3FZ9A 5AGYA 4N0VA 3QAVA 3P7XA 2H6ZA 4JU5A 3R2QA 1HNAA 1JFUA 6GSSA 4TXVA 2I9HA 4LL1B 2YP6A 3BBYA 3HXSA 2YNXA 3TRPA 4D73B 4POBA 1R26A 2F51A 1UVZA 5EVOA 1O81A 3IOSA 1JLWA 4F9ZA 1K3OA 4TN8A 3HJOA 5E4WA 1HD2A 2OA7A 1TI1A 2XBIA 1EWXA 3TDGA 2XPDA 1TP9A 4XS4A 4J57E 4Q5NA 3IA1A 1WOUA 4MZBA 1XWAA 2HYXA 4XS1A 4IP1A 2FHEA 2A4VA 3KXOA 2HI7A 3QFBC 4EDZA 4ISDA 1KNGA 2UZ8A 3UBKA 2ALBA 2M80A 4K7IA 1WRYA 2KP1A 3DRNA 1ZL9A 4MP4A 1M9BA 1AXDA 4HZ2A 2ZNMA 3IK7A 3D6IA 5LCZA 3ED3A 1S3CA 2HZEB 2YWMA 4RUVA 4LA1A 4ML1A 1PL2A 1ERUA 3GYKA 4ZL7A 4AJ6A 3KP9A 2VD1A 1E6BA 3C8EA 3CXGA 4PNFA 2OKAA 3LORA 1GNEA 2P0GA 4EXJA 5E59A 2LSTA 2I3YA 3KTLA 2MMOA 4NV2A 2R5GA 5D9XA 2TRCP 1MEKA 3D0ZA 5FWGA 1XW9A 4XS4B 4JBBA 2IL3A 4MDCA 4OO4A 1U3IA 2H6XA 1WE0A 2L5OA 4KGIA 4IJIA 2Z9SA 2F8FA 4PX1A 2DJ2A 2PVQA 2VLVA 1X9SB 3TJBA 4O7HA 3M8NA 2VCWA 2MMZA 4RQXA 3LQ7A 2B1KA 2VD0A 2C0FA 3QD9A 2GLRA 2VO4A 5ECOB 2F8AA 2TIRA 3GMFA 5IMAA 2YJHA 4MPGA 2DMLA 2X8HA 1GRXA 1M2BA 4KX4A 1N8JA 2FGXA 3W8SA 3VI5A 1UA5A 2FY6A 3ZYWA 3C1SA 2VL3A 4POLA 2YWNA 4USSA 6GSUA 3DVWA 5DJLA 1WJKA 1EP7A 2CZ3A 4WEYA 1OKTA 5ID2A 5EPFA 4F2IA 5HR0A 3G7YA 3L78A 20GSA 5CAXA 1NM3A 4IELA 3ERFA 5IMDA 4MF6A 5D96A 2H6YA 3VK9A 4DSSA 6GSVA 2CVKA 3L9UA 1GWCA 2WDUA 5B6NA 1SKSB 3KZQA 4LL4B 1SYXA 2C8UA 3AY8A 1X9MB 4JR6A 5AIXA 4K2DA 5B8BA 1SKWB 3CRTA 3VLNA 3A2VA 2YANA 1WWJA 2LEGA 4BWQA 1NSWA 3US3A 4ECBA 1YF1A 2HSNB 4Q5RA 1SENA 3QCPA 1GP1A 14GSA 2JU5A 2B5XA 2LKUA 3TKSE 4KB3A 1FVKA 3IC4A 5COHA 5LNKe 5J9CA 2P5QA 1GSEA 3TRQA 4E8HA 2H19A 1FHEA 4GLTA 1PRXA 2N5FA 4MLYA 5FHIA 1A2MA 3D4TA 2H1GA 4YAVA 2EIQA 3HVXA 1YQ1A 3HZ4A 5IMFA 3FK8A 3HJMA 2GZPA 5JWQB 1J08A 3MNGA 4EF0A 1ILOA 2O7KA 1TW9A 4HZ4A 5J9BA 4QL7A 3F6FA 2WB9A 5ID2B 1ERVA 2GQLA 3FEUA
chains in the Genus database with same CATH superfamily
2AJQB 4GCIA 1VF1A 3MAKA 3PR8A 1Z7PA 2H75A 2PPTA 1F37A 4CHSA 3P90A 4DSSB 2VCQA 5DJMA 5ECPB 2H01A 5FT3A 2P5RA 3TKPA 7GSSA 2MMAA 3L9VA 3VWVA 2H71A 1VF4A 1EGOA 1U6TA 2JZSA 4MABA 4CW9A 1Y6EA 3FW2A 3RPPA 2UV8G 1O8XA 3KP8A 1LBKA 2RUEA 4ZBAA 1FOVA 3GH9A 4MNNA 4QL9A 2OADA 2H1DA 1Z7RA 5B6MA 4IN0A 3FY7A 3FR3A 3TJKA 4E8EA 3EPTA 1B9XC 3FR6A 2DJJA 2RUFA 1SVLA 1XW5A 4F03A 1AAZA 1GTUA 4WR5A 1ML6A 1V98A 3KH9A 3N9JA 4XCSA 19GSA 2OE0A 1HNCA 1XFLA 4L0UA 3QAGA 4O5UA 5ECKB 1AW9A 1R4WA 2OBKA 3EE2A 2N5AA 2K8SA 3APQA 1OKDA 3F63A 5ECLB 3JCML 3ME7A 3CSHA 3A2WA 1GUKA 1QQ2A 1XIYA 2VUPA 3TRXA 1USBA 1Y25A 4FQUA 4AKGA 1V57A 5CYYA 2GSQA 2MBTA 4Q5FA 1FW1A 2QKEA 4F82A 1SU9A 4YKFA 3A2XA 2DKHA 2FCHA 4NHWA 1T4YA 2WULA 4FYCA 4KE3A 1BX9A 1Q4JA 3ZVJD 2HRNA 5EL8A 1XVWA 2CV4A 1EZKA 4WBRD 1GLPA 4QQ7A 1URMA 4POMA 3HJPA 5J5NA 4MJBA 2IN3A 5ELAA 2FWHA 3FKFA 3MYDA 4LLRA 1T7PB 4KSMA 5LD0A 4PURA 1BAYA 3H1NA 2GSTA 2GT6A 1YY7A 3GFKA 5IMCA 2L57A 4HSCX 1OE8A 1O85A 2IMDA 1GSFA 3C7MA 4IJ3A 4V1Ag 4WR4A 3D5JA 4ZB6A 4X4JA 2ZCTA 2DIZA 3K8NA 2I4AA 2F9SA 4KCEA 4NAXA 3H79A 3RHCA 1KTEA 4WXTA 2LRCA 2HRAA 4MH3A 3VPTA 1X9WB 1X0RA 1K0CA 2A2SA 4HQSA 3L4NA 5CRGA 3WT1A 4A5PA 1MDKA 4YH2A 3EC3A 1OC9A 1SVOA 2EIOA 3I43A 5DQSA 4GDFA 2L4QA 4K6XA 1TU7A 1GSQA 5A34A 1FAAA 1TXXA 1K0OA 2VIMA 5BMUA 4FYBA 3FZAA 2O36A 1Z9HA 4GF0A 1QK8A 3GRXA 3N5OA 2VM1A 2IFQA 4N30A 2HRKA 1GNWA 3HKRA 1V9WA 1G0TA 1I5GA 4AKHA 3UL3A 4ZB9A 2K18A 4IQ1A 5HR3A 3W6GA 3CTGA 3ZIJA 5GAPD 4AGSA 4G9HA 4LMVA 1N2AA 3MIXA 3LXTA 12GSA 5CRDA 1NHYA 3A5IA 2OJLA 4FH8A 2TRXA 2B7JA 1S3DA 5L71A 1PN9A 5C04A 4ZXGA 3DXBA 1YDKA 1PX6A 2DIYA 3HHVA 2LQOA 1I9DA 4F0BA 4N3ZA 5KN0A 2J23A 1JZRA 5ECRB 2EFEA 2LJAA 2X4AA 4K7NA 4NMUA 1XOAA 1QFNA 1OC9B 3F4SA 4TKYA 4IVFA 3PGTA 1B8XA 5A34B 5ECNB 2WW3A 4N10A 3D4MA 3GL3A 5BMUB 1BF5A 2VCXA 2FWEA 1F6MC 2J9HA 2H74A 4ZBBA 4K8MA 1T3BA 5IM9A 5DDLA 1PKWA 3CWGA 4Z2RA 3M9KA 2IFQB 5GSTA 4G10A 2HRKB 2WW0A 2ES7A 2WGRA 1FOHA 4MJEA 4KNDA 3KEBA 1X5DA 4KAEA 3VWXA 1R7HA 2C0GA 5HFGA 1GLQA 3C1RA 4G01A 2FWGA 1Y1UA 3QFAC 5HFKA 1R5PA 5AN1A 3KJYA 4G19A 4E68A 1GSYA 1FG4A 3TKSA 1ON4A 5CREA 1X5CA 1DBYA 1VF2A 2DJ1A 3VI7A 5IPHA 2C4JA 2VLTA 1Q98A 4MK3A 1CQGA 1NHOA 4AJ8A 2V41A 2WJUA 4TVEA 4HJMA 4IBPA 4L0WA 1Z6NA 3IHQA 2FLSA 2RM5A 1G6WA 3ZTLA 2MZCA 4EKZA 2C3QA 1HQOA 4OD7A 2PN8A 4MF7A 1MDIA 2HE3A 1A8LA 3PPUA 2JZTA 1LU4A 3EU4A 3BJ5A 4OMVA 4TOPA 2GVPA 4Z7XA 1EV4A 3GKXA 1RQMA 1PFOA 2VAFA 2IPAA 2VCTA 2OE1A 1VF3A 5IMVA 3EMXA 5A5KA 5JWOB 3H93A 3MSZA 2DMMA 1AIUA 4IW9A 2NTOA 3G7JA 3ZITA 4G0LA 2O89A 1SD9A 1OYJA 1EOHA 2AUVA 2GGTA 3FMWA 3GH6A 1PMTA 3FZ5A 1H4OA 1U3AA 4FO5A 2WVXA 4MA9A 1AQWA 1GUHA 3RAZA 1S3RA 1BJXA 3QMXA 2BMXA 2GT5A 1X5EA 2FUG2 3IE3A 2H0HA 4ECCA 4ZB7A 4OCEA 2H0GA 1K0AA 5H5QA 1ST9A 1ZGNA 1TRWA 1ZYQB 4DVCA 2RIIA 2LJKA 1XXUA 3QOUA 3EMPA 3LGCA 3O3TA 4J2FA 1XWGA 5GZZB 5G30A 3ZL5A 3ME8A 4BA7A 4BPYA 3FHKA 3GKMA 4NXIA 2WCIA 3UVTA 4GSNA 2E0QA 1H75A 3CSJA 2YWOA 5JWRB 2CVBA 1M99A 3VFIA 4TW5A 4V2MA 4HDEA 1B9YC 5CRHA 3UIWA 1XWCA 3CHXC 1LJRA 3KH7A 3CBUA 3GN3A 3H8QA 5A5HA 4GWRA 2VL9A 4TXOA 2B3SA 3M0FA 1MD4A 3E9JB 2X8CA 5B7CA 4K0NA 5J41A 4HU7A 11GSA 2GSSA 3VWUA 1VRSD 3HY2A 4PI2C 2WVXB 3ZZXA 1B4PA 1Z3EA 3CSIA 4XTSA 5B8AA 4OCFA 1ERWA 1GH2A 1F2EA 3IK9A 4EC0A 4YKGA 1XBSA 2R3XA 3IPZA 4I8BA 4OWYA 4ILFA 3F4RA 1PKZA 2XC2A 3HVSA 2KOKA 1BEDA 2IMKA 4J56E 6GSTA 2XPEA 1TJDA 3ZREA 4JEDA 5CRWA 5G31A 1YEXA 3DVXA 1PD21 4POKA 1AQXA 4MH2A 1SJ6A 4GTUA 4F0CA 1SK1A 4K0GA 4FIWA 3KMNA 1W4VA 1SL0B 5C00A 1XOBA 4IS0A 2I81A 2WVZA 4L8EA 3VURA 1A8YA 2JZRA 1C72A 1WIKA 2H76A 2WS2A 1SJZA 5A5HB 1WPIA 4I2UA 2RLIA 3PH9A 2P31A 5EY6A 1SKRB 1TRUA 1OE7A 2FWFA 4ZILA 1SK2A 1ERTA 2L6CA 4WKWA 1B4QA 2AB6A 3ZVJA 4EL1A 2HFDA 1K0DA 3GX8A 3DEXA 3O6TA 1M3IA 3QAWA 3I6AA 2C1YA 4N11A 1GSSA 2H70A 1XVQA 4GRFA 1YF0A 4GSSA 3RGBC 2LJRA 4EE0A 4X43A 2CX3A 1V40A 5A1NA 1FB0A 4HS1A 3FRCA 4NWYA 22GSA 2H73A 2OBIA 2H1LA 4K5RA 1DUGA 2ZUPA 2LV3A 4V1Ap 4IKHA 4KDYA 3HCZA 1JZWA 2L5LA 1BG1A 1WMJA 4HI7A 3GSSA 2K6VA 1XPVA 1QGVA 5IO2A 1O8WA 4KUNA 3LYKA 5F8BA 2C3TA 1MD3A 4EO3A 1HNBA 4L5OA 4ZB8A 2L6DA 3NZNA 1M3JA 1MDJA 1TRSA 3BCIA 4MZCA 4GQCA 1TOFA 1EEJA 3DD3A 2M46A 2VKZG 3LJRA 5JCUA 2DC5A 3G7IA 3P8WA 3UBLA 4XHMA 3ZMLA 2VL2A 4G0KA 3Q19A 4Q5QA 2PGTA 3BOAA 5D93A 4QMKA 1MTCA 1ZOFA 3NOFA 3M9JA 4TRXA 3HVVA 5H5RA 1EEMA 3DYRA 1N25A 2HSHA 4JZQA 3U5RE 4AKXB 3KGKA 3M1GA 2CAQA 2F3MA 5CP1A 5A1NB 2GZZA 3FYGA 4CY8A 3TOTA 1GSDA 4ICYA 4BVYA 3GNJA 5IIZA 2WFCA 3UVHA 5GAND 4TR4A 3GIXA 5JCGA 3DWVA 1I1IP 1ACVA 3G9BA 17GSA 4AJ7A 1XZOA 4KDUA 2REMA 5HQPA 2FNOA 4MCUA 2BTOT 1AQVA 1A0FA 2B7KA 2L4CA 2HSMA 4YQMA 4ZL9A 5AIVA 3WGDA 3F8UA 1XG8A 2V6KA 1O73A 1G6YA 2FA8A 3TOUA 3KIJA 3GURA 1TK0B 4MZWA 2V6OA 5AISA 2PU9C 5HR1A 1KEBA 3CYNA 3RDWA 3TKSC 4O32A 1K0MA 1TTZA 5KOXA 2V1MA 1XW6A 3WT2A 4KH7A 4ZL8A 4HOJA 5D73A 1E2YA 1GULA 3F6DA 1TDIA 1IYHA 3MWHA 2VLUA 2YV7A 3IDVA 4AF2A 3FR9A 3HA9A 4TR1A 4LMWA 2HXKA 4BVYB 5ECQB 4WF5A 1F3BA 2HNLA 2H66A 3GSTA 6GSXA 5ECHB 3KM6A 3KD0A 3UMAA 2LRTA 4GSTA 1A2LA 5IOXA 1GTAA 1GUMA 3GHAA 3IV4A 8GSSA 2AYTA 4MF5A 5INYA 1SL1B 2YN1A 2QA1A 2N5BA 1OC3A 1A0RP 4DEJA 2R0GA 1ABAA 3I9V2 1T8EB 2HSMB 2OACA 3ZMKA 3TJFA 2LRNA 1BG5A 2NPBA 3J7Yk 1JLVA 2EFDA 5DALA 2PMTA 2D2ZA 4MPFA 3Q18A 3WD6A 2B1LA 10GSA 4X1UA 4GXZA 1DE2A 1JZDA 1OC8A 4FYUA 2M72A 1GTBA 3Q6OA 5CO3A 3CRUA 5G5EA 1JHBA 2V2GA 3NIVA 4XRDA 3UEMA 2HQTA 5IMZA 3EU3A 3KMOA 4I2TA 3EINA 3HYPA 1ZYEA 2EFCA 1GL8A 5G5FA 5DAKA 5GSSA 3KTBA 1WP0A 2GQMA 4TR1B 2PUKC 4TR0A 1K3LA 5JCWA 4O92A 2EC4A 2JACA 2R0PA 1SYRA 2A2RA 2DKIA 5DVBA 4P3YB 2QGVA 2H72A 4KA0A 3E3EA 1TI3A 1M2AA 1OVNA 3APOA 2E7PA 1Z5YE 1FO5A 2NDOA 4H86A 4ECJA 2QA2A 1YKCA 1DSBA 3TB2A 2IJYA 2GDRA 2VM2A 2IMEA 3HD5A 5ELGA 5DALB 2FD3A 1TRVA 3CQFA 2B5YA 2VCZA 1K0NA 1AC1A 5KEJA 2CAIA 5IO0A 1UC7A 2R4VA 2H1AA 1AUCA 3IRAA 1O6JA 2GSRA 1SL2B 2DLXA 2R37A 2YOIA 1T1VA 2GS3A 2KLXA 2B5EA 4KF9A 1YEWC 3IC8A 1SD8A 2OT3A 4HEA2 4PQIA 4K7OA 4PHZC 4PQ1A 5IQYA 3QR6A 3RHBA 1PSQA 3Q74A 5DAKB 3ZFBA 3OR5A 2VOCA 3V1WA 3ISOA 4PGTA 4EIQA 5G1LA 6GSYA 1SK0A 1EV9A 3LSZA 3GKNA 1TKDB 2E2GA 2O87A 4WBJA 1A24A 5A4WA 1ZCPA 2JSZA 4RI6A 2O8VB 2RM6A 5F05A 4ZIJA 4PUAA 4X0XA 4XS6A 2WZ9A 4MJCA 4KCAA 2G0FA 3TKRA 4WF4A 2YWIA 1RW1A 1JZOA 2EIRA 1FB6A 2WW1A 4HJ2A 3P2AA 1Z6MA 2CX4A 3LEFA 2HZFA 3TUEA 4NHZA 18GSA 4RI7A 1TU8A 2DJ3A 3APSA 3H4KA 2H8LA 2B6MA 4FXYP 2JADA 4I5QA 3C73A 5HFIA 3UOMA 4ECIA 4HUAA 3ZFLA 2R6KA 2PBJA 2DJKA 1GSUA 4L5LA 4V2NA 4G2EA 2PVOC 5D9TA 4JR4A 2LNTA 3EVIA 3LG6A 5IOWA 1ZYNA 3WGXA 1KBNA 3DIEA 3ERGA 2MYGA 3QPMA 1A23A 2C0EA 9GSSA 2CVDA 2DSAA 2PWJA 4YQVA 4PI0C 3RFRC 5DCGA 5BRTA 1B48A 4K2XA 2A2PA 4PQHA 5G2ZA 3GV1A 1F9MA 5HR2A 5DQYA 3GL5A 1M7TA 1NW2A 2LTKA 2H0IA 5D8IA 3DMLA 4EDYA 5KN3A 4V2LA 1EGRA 4G0IA 3VWWA 2NBSA 5J4VA 1W89A 2IMFA 1T00A 1EP8A 3UARA 3W8JA 1THXA 1YEPA 1CQHA 1T4ZA 2VL2C 2ON7A 1XWBA 4IP6A 5DBQA 3MDKA 5CNWA 2YZHA 4PXOA 1S3AA 2EFHA 3TU3B 3F4TA 2K9FA 1YZXA 4TXOB 5J47A 3F3QA 2VCVA 1UN2A 2YJ7A 3C71A 4ZBDA 4BL7A 4ID0A 2DJ0A 3HMJG 4GQFA 4OFMA 2H1BA 1PA3A 4BVXA 2DBCA 5KN2A 3WGEA 4DSQA 4HU9A 4EUYA 4IHUA 2WW2A 3M3MA 2OE3A 1V58A 3TGZA 2R2JA 5ENUA 3ERWA 2GZYA 3IAS2 3IBHA 1YKAA 4XIHA 3LXZA 2WRTA 2MMNA 3ZRDA 2IWTA 2E2MA 2XHFA 1XWKA 3WYWA 3IR4A 2V32A 1U88A 1U87A 5G1KA 3IAM2 2BJXA 1M2DA 2O5VA 2ON5A 1XCCA 4TR3A 3GA4A 4I97A 2O85A 5A4UA 2K8VA 1THOA 4NV5A 1SJIA 4JE1A 4OO5A 1VGLA 2QSIA 3LFLA 3J7Yb 4ULXA 4IQAA 2O3EA 5IPGA 1ZZYA 2GQKA 2WZSA 4XRAA 2KUCA 5J40A 1K0BA 5ECSA 1K3YA 2JL4A 4N0ZA 2HLSA 4KDXA 3EURA 3FZ4A 5DCHA 5F0GA 2C0DA 3RBTA 2IIYA 2L59A 1OAZA 1IYIA 2G2QA 3CTFA 5F07A 3TJGA 3CMIA 4IGJA 1M0UA 4WETA 2CQ9A 1BQ7A 4RQRA 4O5QA 4BL7B 1G7EA 3F3RA 1QUWA 1A2JA 3GUSA 5H5SA 4MMMA 4BVXB 2LUSA 1BYEA 3EWLA 4JRRA 3GX0A 2AHEA 1QXHA 2KHPA 4BWSA 4MJAA 2CZ2A 3QDNA 2YZUA 3DKSA 3BCKA 2H30A 3HDCA 1GTIA 3TCOA 1RK4A 3UJ1A 2JSYA 1J0FA 4YAPA 1PX7A 3ZLPA 4PTSA 3DGQA 1FVJA 3D21A 2XBQA 3BD2A 1J9BA 4OFTA 3TJJA 3A3TA 2WVYA 1V2AA 2LS5A 1M9AA 2X8GA 3GTUA 5KOWA 1ZMAA 3GKKA 4K9ZA 3RPNA 2QC7A 2AV4A 3EYTA 2NVLA 2LQQA 5D9WA 2C80A 2GTUA 4AKIA 16GSA 3R3EA 1TK5B 4KSOA 2HT9A 3D22A 2HRFA 2CT6A 1R5AA 2KP2A 4EVMA 2MBSA 2X99A 4YQUA 4HQZA 6GSWA 3PINA 3L0HA 3L9SA 2YV9A 1F3AA 3F0IA 1QMVA 1HYUA 5ECIB 3F9UA 13GSA 3IHGA 4BIKA 2FA4A 1DE1A 2I1UA 2C3NA 5ABRA 2LNSA 4D73A 5F06A 4PUFC 1EOGA 1YJ6A 4PNGA 3I69A 5KN1A 4KW6A 2X64A 1PQNA 4NPBA 3SWLA 2AAWA 3S9FA 4DSRA 3UAPA 5ECMB 1PGTA 4CDOA 1ZYPA 3TKQA 3U6VA 4O5RA 2HSYA 3LWAA 4OFNA 5D9VA 5A4VA 1TK8B 4K1FA 2IMIA 2YCDA 1O7UA 2YPMA 3E0UA 4ML6A 3A5WA 3GTUB 3KCMA 2PERA 3ZIVA 3IXRA 1PL1A 4ACSA 3HZ8A 1G7OA 5J3RA 5J4UA 3VPQA 2HZEA 3SBCA 3LYPA 4I6XA 2CA8A 5J4YA 3O76A 3FZ9A 5AGYA 4N0VA 3QAVA 3P7XA 2H6ZA 4JU5A 3R2QA 1HNAA 1JFUA 6GSSA 4TXVA 1YVLA 2I9HA 4LL1B 2YP6A 3BBYA 4AI6A 2X49A 3HXSA 2YNXA 3TRPA 4D73B 4POBA 1R26A 2F51A 1UVZA 5EVOA 1O81A 3IOSA 1JLWA 4F9ZA 1K3OA 4TN8A 3HJOA 5E4WA 1HD2A 2OA7A 1TI1A 2XBIA 1EWXA 3TDGA 2XPDA 1TP9A 4XS4A 4J57E 4Q5NA 3IA1A 1WOUA 4MZBA 1XWAA 2HYXA 4XS1A 4IP1A 2FHEA 2A4VA 3KXOA 2HI7A 3QFBC 4EDZA 4ISDA 1KNGA 2UZ8A 3UBKA 2ALBA 2M80A 4K7IA 1WRYA 2KP1A 3DRNA 1ZL9A 4MP4A 1M9BA 1AXDA 4HZ2A 2ZNMA 3IK7A 3D6IA 5LCZA 3ED3A 1S3CA 2HZEB 2YWMA 4RUVA 3LW9A 4LA1A 4ML1A 1PL2A 1ERUA 3GYKA 4ZL7A 4AJ6A 3KP9A 2VD1A 1E6BA 3C8EA 3CXGA 4PNFA 2OKAA 3LORA 1GNEA 2P0GA 4K5SA 4EXJA 5E59A 2LSTA 2I3YA 3KTLA 2MMOA 4Z2UA 4NV2A 2R5GA 5D9XA 2TRCP 1MEKA 3D0ZA 5FWGA 1XW9A 4XS4B 4JBBA 2IL3A 4MDCA 4OO4A 1U3IA 2H6XA 1WE0A 2L5OA 4KGIA 4IJIA 2Z9SA 2F8FA 4PX1A 2DJ2A 2PVQA 2VLVA 1X9SB 2A4HA 3TJBA 4O7HA 3M8NA 2VCWA 1PN0A 2MMZA 4RQXA 3LQ7A 3HVNA 2B1KA 2HSNA 2VD0A 2C0FA 3QD9A 2GLRA 2VO4A 5ECOB 2F8AA 2TIRA 3GMFA 5IMAA 2YJHA 4MPGA 2DMLA 4Z2TA 2X8HA 1GRXA 1M2BA 4KX4A 1N8JA 2FGXA 3W8SA 3VI5A 1SVMA 1UA5A 2FY6A 3ZYWA 3C1SA 4W66A 2R0CA 2VL3A 4POLA 2YWNA 4USSA 6GSUA 3DVWA 5DJLA 1WJKA 1EP7A 2CZ3A 4WEYA 1OKTA 5ID2A 5EPFA 4F2IA 5HR0A 3G7YA 3L78A 20GSA 5CAXA 4CY6A 1NM3A 4IELA 3ERFA 5IMDA 4MF6A 5D96A 4EIPA 2H6YA 3VK9A 1S4BP 6GSVA 4DSSA 2CVKA 3L9UA 1GWCA 2WDUA 5B6NA 1SKSB 3KZQA 4LL4B 1SYXA 2C8UA 3AY8A 1X9MB 1TXUA 4JR6A 5AIXA 4K2DA 5B8BA 1SKWB 3CRTA 3VLNA 3A2VA 2YANA 1WWJA 2LEGA 4BWQA 1NSWA 3US3A 4ECBA 1YF1A 2HSNB 4Q5RA 1SENA 3QCPA 1GP1A 14GSA 2JU5A 2B5XA 2LKUA 3TKSE 4KB3A 1FVKA 3IC4A 5COHA 5LNKe 5J9CA 2P5QA 1GSEA 3TRQA 4E8HA 2H19A 1FHEA 4GLTA 1PRXA 2N5FA 4MLYA 5FHIA 1A2MA 3D4TA 2H1GA 4YAVA 2EIQA 3HVXA 1YQ1A 3HZ4A 5IMFA 3FK8A 3HJMA 2GZPA 5JWQB 1J08A 3MNGA 4EF0A 1ILOA 2O7KA 1TW9A 4HZ4A 5J9BA 4QL7A 3F6FA 2WB9A 5ID2B 1ERVA 2GQLA 3FEUA
chains in the Genus database with same CATH topology
2AJQB 4GCIA 1VF1A 3MAKA 3PR8A 1Z7PA 2H75A 2PPTA 1F37A 4CHSA 3P90A 4DSSB 2VCQA 5DJMA 5ECPB 2H01A 5FT3A 2P5RA 3TKPA 7GSSA 2MMAA 3L9VA 3VWVA 2H71A 1VF4A 1EGOA 1U6TA 2JZSA 4MABA 4CW9A 1Y6EA 3FW2A 3RPPA 2UV8G 1O8XA 3KP8A 1LBKA 2RUEA 4ZBAA 1FOVA 3GH9A 4MNNA 4QL9A 2OADA 2H1DA 1Z7RA 5B6MA 4IN0A 3FY7A 3FR3A 3TJKA 4E8EA 3EPTA 1B9XC 3FR6A 2DJJA 2RUFA 1SVLA 1XW5A 4F03A 1AAZA 1GTUA 4WR5A 1ML6A 1V98A 3KH9A 3N9JA 4XCSA 19GSA 2OE0A 1HNCA 1XFLA 4L0UA 3QAGA 4O5UA 5ECKB 1AW9A 1R4WA 2OBKA 3EE2A 2N5AA 2K8SA 3APQA 1OKDA 3F63A 5ECLB 3JCML 3ME7A 3CSHA 3A2WA 1GUKA 1QQ2A 1XIYA 2VUPA 3TRXA 1USBA 1Y25A 4FQUA 4AKGA 1V57A 5CYYA 2GSQA 2MBTA 4Q5FA 1FW1A 2QKEA 4F82A 1SU9A 4YKFA 3A2XA 2DKHA 2FCHA 4NHWA 1T4YA 2WULA 4FYCA 4KE3A 1BX9A 1Q4JA 3ZVJD 2HRNA 5EL8A 1XVWA 2CV4A 1EZKA 4WBRD 1GLPA 4QQ7A 1URMA 4POMA 3HJPA 5J5NA 4MJBA 2IN3A 5ELAA 2FWHA 3FKFA 3MYDA 4LLRA 1T7PB 4KSMA 5LD0A 4PURA 1BAYA 3H1NA 2GSTA 2GT6A 1YY7A 3GFKA 5IMCA 2L57A 1OE8A 1O85A 2IMDA 1GSFA 3C7MA 4IJ3A 4V1Ag 4WR4A 3D5JA 4ZB6A 4X4JA 2ZCTA 2DIZA 3K8NA 2I4AA 2F9SA 4KCEA 4NAXA 3H79A 3RHCA 1KTEA 4WXTA 2LRCA 2HRAA 4MH3A 3VPTA 1X9WB 1X0RA 1K0CA 2A2SA 4HQSA 3L4NA 5CRGA 3WT1A 4A5PA 1MDKA 4YH2A 3EC3A 1OC9A 1SVOA 2EIOA 3I43A 5DQSA 4GDFA 2L4QA 4K6XA 1TU7A 1GSQA 5A34A 1FAAA 1TXXA 1K0OA 2VIMA 5BMUA 4FYBA 3FZAA 1Z9HA 4GF0A 1QK8A 3GRXA 3N5OA 2VM1A 2IFQA 4N30A 2HRKA 1GNWA 3HKRA 1V9WA 1G0TA 1I5GA 4AKHA 3UL3A 4ZB9A 2K18A 4IQ1A 5HR3A 3W6GA 3CTGA 3ZIJA 5GAPD 4AGSA 4G9HA 4LMVA 1N2AA 3MIXA 3LXTA 12GSA 5CRDA 1NHYA 3A5IA 2OJLA 4FH8A 2TRXA 2B7JA 1S3DA 5L71A 1PN9A 5C04A 4ZXGA 3DXBA 1YDKA 1PX6A 2DIYA 3HHVA 2LQOA 1I9DA 4F0BA 4N3ZA 5KN0A 2J23A 1JZRA 5ECRB 2EFEA 2LJAA 2X4AA 4K7NA 4NMUA 1XOAA 1QFNA 1OC9B 3F4SA 4TKYA 4IVFA 3PGTA 1B8XA 5A34B 5ECNB 4N10A 3D4MA 3GL3A 5BMUB 1BF5A 2VCXA 2FWEA 1F6MC 2J9HA 2H74A 4ZBBA 4K8MA 1T3BA 5IM9A 5DDLA 1PKWA 3CWGA 4Z2RA 3M9KA 2IFQB 5GSTA 4G10A 2HRKB 2ES7A 2WGRA 1FOHA 4MJEA 4KNDA 3KEBA 1X5DA 4KAEA 3VWXA 1R7HA 2C0GA 5HFGA 1GLQA 3C1RA 4G01A 2FWGA 1Y1UA 3QFAC 5HFKA 1R5PA 5AN1A 3KJYA 4G19A 4E68A 1GSYA 1FG4A 3TKSA 1ON4A 5CREA 1X5CA 1DBYA 1VF2A 2DJ1A 3VI7A 5IPHA 2C4JA 2VLTA 1Q98A 4MK3A 1CQGA 1NHOA 4AJ8A 2V41A 2WJUA 4TVEA 4HJMA 4IBPA 4L0WA 1Z6NA 3IHQA 2FLSA 2RM5A 1G6WA 3ZTLA 2MZCA 4EKZA 2C3QA 1HQOA 4OD7A 2PN8A 4MF7A 1MDIA 2HE3A 1A8LA 3PPUA 2JZTA 1LU4A 3EU4A 3BJ5A 4OMVA 4TOPA 2GVPA 4Z7XA 1EV4A 3GKXA 1RQMA 2VAFA 2IPAA 2VCTA 2OE1A 1VF3A 5IMVA 3EMXA 5A5KA 5JWOB 3H93A 3MSZA 2DMMA 1AIUA 4IW9A 2NTOA 3G7JA 3ZITA 4G0LA 2O89A 1SD9A 1OYJA 1EOHA 2AUVA 2GGTA 3FMWA 3GH6A 1PMTA 3FZ5A 1H4OA 1U3AA 4FO5A 4MA9A 1AQWA 1GUHA 3RAZA 1BJXA 3QMXA 2BMXA 2GT5A 1X5EA 2FUG2 3IE3A 2H0HA 4ECCA 4ZB7A 4OCEA 2H0GA 1K0AA 5H5QA 1ST9A 1ZGNA 1TRWA 1ZYQB 4DVCA 2RIIA 2LJKA 1XXUA 3QOUA 3EMPA 3LGCA 3O3TA 4J2FA 1XWGA 5GZZB 5G30A 3ZL5A 3ME8A 4BA7A 4BPYA 3FHKA 3GKMA 4NXIA 2WCIA 3UVTA 4GSNA 2E0QA 1H75A 3CSJA 2YWOA 5JWRB 2CVBA 1M99A 3VFIA 4TW5A 4V2MA 4HDEA 1B9YC 5CRHA 3UIWA 1XWCA 1LJRA 3KH7A 3CBUA 3GN3A 3H8QA 5A5HA 4GWRA 2VL9A 4TXOA 2B3SA 3M0FA 1MD4A 3E9JB 2X8CA 5B7CA 4K0NA 5J41A 4HU7A 11GSA 2GSSA 3VWUA 1VRSD 3HY2A 3ZZXA 1B4PA 1Z3EA 3CSIA 4XTSA 5B8AA 4OCFA 1ERWA 1GH2A 1F2EA 3IK9A 4EC0A 4YKGA 1XBSA 2R3XA 3IPZA 4I8BA 4OWYA 4ILFA 3F4RA 1PKZA 2XC2A 3HVSA 2KOKA 1BEDA 2IMKA 4J56E 6GSTA 2XPEA 1TJDA 3ZREA 4JEDA 5CRWA 5G31A 1YEXA 3DVXA 1PD21 4POKA 1AQXA 4MH2A 1SJ6A 4GTUA 4F0CA 1SK1A 4K0GA 4FIWA 3KMNA 1W4VA 1SL0B 5C00A 1XOBA 4IS0A 2I81A 4L8EA 3VURA 1A8YA 2JZRA 1C72A 1WIKA 2H76A 2WS2A 1SJZA 5A5HB 1WPIA 4I2UA 2RLIA 3PH9A 2P31A 5EY6A 1SKRB 1TRUA 1OE7A 2FWFA 4ZILA 1SK2A 1ERTA 2L6CA 4WKWA 1B4QA 2AB6A 3ZVJA 4EL1A 2HFDA 1K0DA 3GX8A 3DEXA 3O6TA 3QAWA 3I6AA 2C1YA 4N11A 1GSSA 2H70A 1XVQA 4GRFA 1YF0A 4GSSA 2LJRA 4EE0A 4X43A 2CX3A 1V40A 5A1NA 1FB0A 4HS1A 3FRCA 4NWYA 22GSA 2H73A 2OBIA 2H1LA 4K5RA 1DUGA 2ZUPA 2LV3A 4V1Ap 4IKHA 4KDYA 3HCZA 1JZWA 2L5LA 1BG1A 1WMJA 4HI7A 3GSSA 2K6VA 1XPVA 1QGVA 5IO2A 1O8WA 4KUNA 3LYKA 5F8BA 2C3TA 1MD3A 4EO3A 1HNBA 4L5OA 4ZB8A 2L6DA 3NZNA 1MDJA 1TRSA 3BCIA 4MZCA 4GQCA 1TOFA 1EEJA 3DD3A 2M46A 2VKZG 3LJRA 5JCUA 2DC5A 3G7IA 3P8WA 3UBLA 4XHMA 3ZMLA 2VL2A 4G0KA 3Q19A 4Q5QA 2PGTA 3BOAA 5D93A 4QMKA 1MTCA 1ZOFA 3NOFA 3M9JA 4TRXA 3HVVA 5H5RA 1EEMA 3DYRA 1N25A 2HSHA 4JZQA 3U5RE 4AKXB 3KGKA 3M1GA 2CAQA 2F3MA 5CP1A 5A1NB 2GZZA 3FYGA 4CY8A 3TOTA 1GSDA 4ICYA 4BVYA 3GNJA 5IIZA 2WFCA 3UVHA 5GAND 4TR4A 3GIXA 5JCGA 3DWVA 1ACVA 3G9BA 17GSA 4AJ7A 1XZOA 4KDUA 2REMA 5HQPA 2FNOA 4MCUA 2BTOT 1AQVA 1A0FA 2B7KA 2L4CA 2HSMA 4YQMA 4ZL9A 5AIVA 3WGDA 3F8UA 2V6KA 1O73A 1G6YA 2FA8A 3KIJA 3TOUA 3GURA 1TK0B 4MZWA 2V6OA 5AISA 2PU9C 5HR1A 1KEBA 3CYNA 3RDWA 3TKSC 4O32A 1K0MA 1TTZA 5KOXA 2V1MA 1XW6A 3WT2A 4KH7A 4ZL8A 4HOJA 5D73A 1E2YA 1GULA 3F6DA 1TDIA 3MWHA 1IYHA 2VLUA 2YV7A 3IDVA 4AF2A 3FR9A 3HA9A 4TR1A 4LMWA 2HXKA 4BVYB 5ECQB 4WF5A 1F3BA 2HNLA 2H66A 3GSTA 6GSXA 5ECHB 3KM6A 3KD0A 3UMAA 2LRTA 4GSTA 1A2LA 5IOXA 1GTAA 1GUMA 3GHAA 3IV4A 8GSSA 2AYTA 4MF5A 5INYA 1SL1B 2YN1A 2QA1A 2N5BA 1OC3A 1A0RP 4DEJA 2R0GA 1ABAA 3I9V2 1T8EB 2HSMB 2OACA 3ZMKA 3TJFA 2LRNA 1BG5A 2NPBA 3J7Yk 1JLVA 2EFDA 5DALA 2PMTA 2D2ZA 4MPFA 3Q18A 3WD6A 2B1LA 10GSA 4X1UA 4GXZA 1DE2A 1JZDA 1OC8A 4FYUA 2M72A 1GTBA 3Q6OA 5CO3A 3CRUA 5G5EA 1JHBA 2V2GA 3NIVA 4XRDA 3UEMA 2HQTA 5IMZA 3EU3A 3KMOA 4I2TA 3EINA 3HYPA 1ZYEA 2EFCA 1GL8A 5G5FA 5DAKA 5GSSA 3KTBA 1WP0A 2GQMA 4TR1B 2PUKC 4TR0A 1K3LA 5JCWA 4O92A 2EC4A 2JACA 2R0PA 1SYRA 2A2RA 2DKIA 5DVBA 4P3YB 2QGVA 2H72A 4KA0A 3E3EA 1TI3A 1M2AA 1OVNA 3APOA 2E7PA 1Z5YE 1FO5A 2NDOA 4H86A 4ECJA 2QA2A 1YKCA 1DSBA 3TB2A 2IJYA 2GDRA 2VM2A 2IMEA 3HD5A 5ELGA 5DALB 2FD3A 1TRVA 2B5YA 2VCZA 1K0NA 1AC1A 5KEJA 2CAIA 5IO0A 1UC7A 2R4VA 2H1AA 1AUCA 3IRAA 1O6JA 2GSRA 1SL2B 2DLXA 2R37A 2YOIA 1T1VA 2GS3A 2KLXA 2B5EA 4KF9A 3IC8A 1SD8A 2OT3A 4HEA2 4PQIA 4K7OA 4PQ1A 5IQYA 3QR6A 3RHBA 1PSQA 3Q74A 5DAKB 3ZFBA 3OR5A 2VOCA 3V1WA 3ISOA 4PGTA 4EIQA 5G1LA 6GSYA 1SK0A 1EV9A 3LSZA 3GKNA 1TKDB 2E2GA 2O87A 4WBJA 1A24A 5A4WA 1ZCPA 2JSZA 4RI6A 2O8VB 2RM6A 5F05A 4ZIJA 4PUAA 4X0XA 4XS6A 2WZ9A 4MJCA 4KCAA 2G0FA 3TKRA 4WF4A 2YWIA 1RW1A 1JZOA 2EIRA 1FB6A 4HJ2A 3P2AA 1Z6MA 2CX4A 3LEFA 2HZFA 3TUEA 4NHZA 18GSA 4RI7A 1TU8A 2DJ3A 3APSA 3H4KA 2H8LA 2B6MA 2JADA 4I5QA 3C73A 5HFIA 3UOMA 4ECIA 4HUAA 3ZFLA 2R6KA 2PBJA 2DJKA 1GSUA 4L5LA 4V2NA 4G2EA 2PVOC 5D9TA 4JR4A 2LNTA 3EVIA 3LG6A 5IOWA 1ZYNA 3WGXA 1KBNA 3DIEA 3ERGA 2MYGA 3QPMA 1A23A 2C0EA 9GSSA 2CVDA 2DSAA 2PWJA 4YQVA 5DCGA 5BRTA 1B48A 4K2XA 2A2PA 4PQHA 5G2ZA 3GV1A 1F9MA 5HR2A 5DQYA 3GL5A 1M7TA 1NW2A 2LTKA 2H0IA 5D8IA 3DMLA 4EDYA 5KN3A 4V2LA 1EGRA 4G0IA 3VWWA 2NBSA 5J4VA 1W89A 2IMFA 1T00A 1EP8A 3UARA 3W8JA 1THXA 1YEPA 1CQHA 1T4ZA 2VL2C 2ON7A 1XWBA 4IP6A 5DBQA 3MDKA 5CNWA 2YZHA 4PXOA 1S3AA 2EFHA 3TU3B 3F4TA 2K9FA 1YZXA 4TXOB 5J47A 3F3QA 2VCVA 1UN2A 2YJ7A 3C71A 4ZBDA 4BL7A 4ID0A 2DJ0A 3HMJG 4GQFA 4OFMA 2H1BA 1PA3A 4BVXA 2DBCA 5KN2A 3WGEA 4DSQA 4HU9A 4EUYA 4IHUA 3M3MA 2OE3A 1V58A 3TGZA 2R2JA 5ENUA 3ERWA 2GZYA 3IAS2 3IBHA 1YKAA 4XIHA 3LXZA 2WRTA 2MMNA 3ZRDA 2IWTA 2E2MA 2XHFA 1XWKA 3WYWA 3IR4A 2V32A 1U88A 1U87A 5G1KA 3IAM2 2BJXA 1M2DA 2O5VA 2ON5A 1XCCA 4TR3A 3GA4A 4I97A 2O85A 5A4UA 2K8VA 1THOA 4NV5A 1SJIA 4JE1A 4OO5A 1VGLA 2QSIA 3LFLA 3J7Yb 4ULXA 4IQAA 5IPGA 1ZZYA 2GQKA 4XRAA 2KUCA 5J40A 1K0BA 5ECSA 1K3YA 2JL4A 4N0ZA 2HLSA 4KDXA 3EURA 3FZ4A 5DCHA 5F0GA 2C0DA 3RBTA 2IIYA 2L59A 1OAZA 1IYIA 2G2QA 3CTFA 5F07A 3TJGA 3CMIA 4IGJA 1M0UA 4WETA 2CQ9A 1BQ7A 4RQRA 4O5QA 4BL7B 1G7EA 3F3RA 1QUWA 1A2JA 3GUSA 5H5SA 4MMMA 4BVXB 2LUSA 1BYEA 3EWLA 4JRRA 3GX0A 2AHEA 1QXHA 2KHPA 4BWSA 4MJAA 2CZ2A 3QDNA 2YZUA 3DKSA 3BCKA 2H30A 3HDCA 1GTIA 3TCOA 1RK4A 3UJ1A 2JSYA 1J0FA 4YAPA 1PX7A 3ZLPA 4PTSA 3DGQA 1FVJA 3D21A 2XBQA 3BD2A 1J9BA 4OFTA 3TJJA 3A3TA 1V2AA 2LS5A 1M9AA 2X8GA 3GTUA 5KOWA 1ZMAA 3GKKA 4K9ZA 3RPNA 2QC7A 2AV4A 3EYTA 2NVLA 2LQQA 5D9WA 2C80A 2GTUA 4AKIA 16GSA 3R3EA 1TK5B 4KSOA 2HT9A 3D22A 2HRFA 2CT6A 1R5AA 2KP2A 4EVMA 2MBSA 2X99A 4YQUA 4HQZA 6GSWA 3PINA 3L0HA 3L9SA 2YV9A 1F3AA 3F0IA 1QMVA 1HYUA 5ECIB 3F9UA 13GSA 3IHGA 2FA4A 1DE1A 2I1UA 2C3NA 5ABRA 2LNSA 4D73A 5F06A 4PUFC 1EOGA 1YJ6A 4PNGA 3I69A 5KN1A 4KW6A 2X64A 1PQNA 4NPBA 3SWLA 2AAWA 3S9FA 4DSRA 3UAPA 5ECMB 1PGTA 4CDOA 1ZYPA 3TKQA 3U6VA 4O5RA 2HSYA 3LWAA 4OFNA 5D9VA 5A4VA 1TK8B 4K1FA 2IMIA 2YCDA 1O7UA 2YPMA 3E0UA 4ML6A 3A5WA 3GTUB 3KCMA 2PERA 3ZIVA 3IXRA 1PL1A 4ACSA 3HZ8A 1G7OA 5J3RA 5J4UA 3VPQA 2HZEA 3SBCA 3LYPA 4I6XA 2CA8A 5J4YA 3O76A 3FZ9A 5AGYA 4N0VA 3QAVA 3P7XA 2H6ZA 4JU5A 3R2QA 1HNAA 1JFUA 6GSSA 4TXVA 1YVLA 2I9HA 4LL1B 2YP6A 3BBYA 4AI6A 2X49A 3HXSA 2YNXA 3TRPA 4D73B 4POBA 1R26A 2F51A 1UVZA 5EVOA 1O81A 3IOSA 1JLWA 4F9ZA 1K3OA 4TN8A 3HJOA 5E4WA 1HD2A 2OA7A 1TI1A 2XBIA 1EWXA 3TDGA 2XPDA 1TP9A 4XS4A 4J57E 4Q5NA 3IA1A 1WOUA 4MZBA 1XWAA 2HYXA 4XS1A 4IP1A 2FHEA 2A4VA 3KXOA 2HI7A 3QFBC 4EDZA 4ISDA 1KNGA 2UZ8A 3UBKA 2ALBA 2M80A 4K7IA 1WRYA 2KP1A 3DRNA 1ZL9A 4MP4A 1M9BA 1AXDA 4HZ2A 2ZNMA 3IK7A 3D6IA 5LCZA 3ED3A 1S3CA 2HZEB 2YWMA 4RUVA 3LW9A 4LA1A 4ML1A 1PL2A 1ERUA 3GYKA 4ZL7A 4AJ6A 3KP9A 2VD1A 1E6BA 3C8EA 3CXGA 4PNFA 2OKAA 3LORA 1GNEA 2P0GA 4K5SA 4EXJA 5E59A 2LSTA 2I3YA 3KTLA 2MMOA 4Z2UA 4NV2A 2R5GA 5D9XA 2TRCP 1MEKA 3D0ZA 5FWGA 1XW9A 4XS4B 4JBBA 2IL3A 4MDCA 4OO4A 1U3IA 2H6XA 1WE0A 2L5OA 4KGIA 4IJIA 2Z9SA 2F8FA 4PX1A 2DJ2A 2PVQA 2VLVA 1X9SB 2A4HA 3TJBA 4O7HA 3M8NA 2VCWA 1PN0A 2MMZA 4RQXA 3LQ7A 2B1KA 2HSNA 2VD0A 2C0FA 3QD9A 2GLRA 2VO4A 5ECOB 2F8AA 2TIRA 3GMFA 5IMAA 2YJHA 4MPGA 2DMLA 4Z2TA 2X8HA 1GRXA 1M2BA 4KX4A 1N8JA 2FGXA 3W8SA 3VI5A 1SVMA 1UA5A 2FY6A 3ZYWA 3C1SA 4W66A 2R0CA 2VL3A 4POLA 2YWNA 4USSA 6GSUA 3DVWA 5DJLA 1WJKA 1EP7A 2CZ3A 4WEYA 1OKTA 5ID2A 5EPFA 4F2IA 5HR0A 3G7YA 3L78A 20GSA 5CAXA 4CY6A 1NM3A 4IELA 3ERFA 5IMDA 4MF6A 5D96A 4EIPA 2H6YA 3VK9A 4DSSA 6GSVA 2CVKA 3L9UA 1GWCA 2WDUA 5B6NA 1SKSB 3KZQA 4LL4B 1SYXA 2C8UA 3AY8A 1X9MB 1TXUA 4JR6A 5AIXA 4K2DA 5B8BA 1SKWB 3CRTA 3VLNA 3A2VA 2YANA 1WWJA 2LEGA 4BWQA 1NSWA 3US3A 4ECBA 1YF1A 2HSNB 4Q5RA 1SENA 3QCPA 1GP1A 14GSA 2JU5A 2B5XA 2LKUA 3TKSE 4KB3A 1FVKA 3IC4A 5COHA 5LNKe 5J9CA 2P5QA 1GSEA 3TRQA 4E8HA 2H19A 1FHEA 4GLTA 1PRXA 2N5FA 4MLYA 5FHIA 1A2MA 3D4TA 2H1GA 4YAVA 2EIQA 3HVXA 1YQ1A 3HZ4A 5IMFA 3FK8A 3HJMA 2GZPA 5JWQB 1J08A 3MNGA 4EF0A 1ILOA 2O7KA 1TW9A 4HZ4A 5J9BA 4QL7A 3F6FA 2WB9A 5ID2B 1ERVA 2GQLA 3FEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AJQ B;  4GCI A;  1VF1 A;  3MAK A;  3PR8 A;  1Z7P A;  2H75 A;  2PPT A;  1F37 A;  4CHS A;  3P90 A;  4DSS B;  2VCQ A;  5DJM A;  5ECP B;  2H01 A;  5FT3 A;  2P5R A;  3TKP A;  7GSS A;  2MMA A;  3L9V A;  3VWV A;  2H71 A;  1VF4 A;  1EGO A;  1U6T A;  2JZS A;  4MAB A;  4CW9 A;  1Y6E A;  3FW2 A;  3RPP A;  1O8X A;  3KP8 A;  1LBK A;  2RUE A;  4ZBA A;  1FOV A;  3GH9 A;  4QL9 A;  2OAD A;  2H1D A;  1Z7R A;  5B6M A;  4IN0 A;  3FY7 A;  3FR3 A;  3TJK A;  4E8E A;  1B9X C;  3FR6 A;  2DJJ A;  2RUF A;  1XW5 A;  4F03 A;  1AAZ A;  1GTU A;  4WR5 A;  1ML6 A;  1V98 A;  3KH9 A;  3N9J A;  4XCS A;  19GS A;  2OE0 A;  1HNC A;  1XFL A;  4L0U A;  3QAG A;  5ECK B;  1AW9 A;  1R4W A;  2OBK A;  3EE2 A;  2N5A A;  2K8S A;  3APQ A;  1OKD A;  3F63 A;  5ECL B;  3JCM L;  3ME7 A;  3CSH A;  3A2W A;  1GUK A;  1QQ2 A;  1XIY A;  2VUP A;  3TRX A;  1USB A;  1Y25 A;  4FQU A;  1V57 A;  5CYY A;  2GSQ A;  2MBT A;  4Q5F A;  1FW1 A;  2QKE A;  4F82 A;  1SU9 A;  3A2X A;  2FCH A;  4NHW A;  1T4Y A;  2WUL A;  4FYC A;  4KE3 A;  1BX9 A;  1Q4J A;  3ZVJ D;  2HRN A;  5EL8 A;  1XVW A;  2CV4 A;  1EZK A;  4WBR D;  1GLP A;  4QQ7 A;  1URM A;  4POM A;  3HJP A;  5J5N A;  4MJB A;  2IN3 A;  5ELA A;  2FWH A;  3FKF A;  4LLR A;  1T7P B;  4KSM A;  5LD0 A;  4PUR A;  1BAY A;  3H1N A;  2GST A;  2GT6 A;  1YY7 A;  3GFK A;  5IMC A;  2L57 A;  1OE8 A;  1O85 A;  2IMD A;  1GSF A;  3C7M A;  4IJ3 A;  4V1A g;  4WR4 A;  3D5J A;  4ZB6 A;  2ZCT A;  2DIZ A;  3K8N A;  2I4A A;  2F9S A;  4KCE A;  4NAX A;  3H79 A;  3RHC A;  1KTE A;  4WXT A;  2LRC A;  2HRA A;  4MH3 A;  3VPT A;  1X9W B;  1X0R A;  1K0C A;  2A2S A;  4HQS A;  3L4N A;  5CRG A;  3WT1 A;  1MDK A;  4YH2 A;  3EC3 A;  1OC9 A;  2EIO A;  3I43 A;  5DQS A;  2L4Q A;  4K6X A;  1TU7 A;  1GSQ A;  1FAA A;  1TXX A;  1K0O A;  2VIM A;  5BMU A;  4FYB A;  3FZA A;  1Z9H A;  4GF0 A;  1QK8 A;  3GRX A;  3N5O A;  2VM1 A;  2IFQ A;  4N30 A;  2HRK A;  1GNW A;  3HKR A;  1V9W A;  1G0T A;  1I5G A;  3UL3 A;  4ZB9 A;  2K18 A;  4IQ1 A;  5HR3 A;  3W6G A;  3CTG A;  3ZIJ A;  5GAP D;  4AGS A;  4G9H A;  4LMV A;  1N2A A;  3LXT A;  12GS A;  5CRD A;  1NHY A;  2OJL A;  4FH8 A;  2TRX A;  2B7J A;  1S3D A;  5L71 A;  1PN9 A;  5C04 A;  4ZXG A;  3DXB A;  1YDK A;  1PX6 A;  2DIY A;  3HHV A;  2LQO A;  1I9D A;  4F0B A;  5KN0 A;  4K7N A;  1JZR A;  5ECR B;  2J23 A;  2LJA A;  4NMU A;  1XOA A;  1QFN A;  1OC9 B;  3F4S A;  4TKY A;  4IVF A;  3PGT A;  1B8X A;  5ECN B;  4N10 A;  3D4M A;  3GL3 A;  2VCX A;  2FWE A;  1F6M C;  2J9H A;  2H74 A;  4ZBB A;  4K8M A;  1T3B A;  5IM9 A;  5DDL A;  1PKW A;  3M9K A;  2IFQ B;  5GST A;  4G10 A;  2HRK B;  2ES7 A;  2WGR A;  4MJE A;  4KND A;  3KEB A;  1X5D A;  4KAE A;  3VWX A;  1R7H A;  2C0G A;  5HFG A;  1GLQ A;  3C1R A;  2FWG A;  3QFA C;  5HFK A;  1R5P A;  5AN1 A;  3KJY A;  4G19 A;  1GSY A;  1FG4 A;  3TKS A;  1ON4 A;  5CRE A;  1X5C A;  1DBY A;  1VF2 A;  2DJ1 A;  3VI7 A;  5IPH A;  2C4J A;  2VLT A;  1Q98 A;  4MK3 A;  1CQG A;  1NHO A;  4AJ8 A;  2V41 A;  2WJU A;  4TVE A;  4HJM A;  4IBP A;  4L0W A;  1Z6N A;  3IHQ A;  2FLS A;  2RM5 A;  1G6W A;  3ZTL A;  2MZC A;  4EKZ A;  2C3Q A;  1HQO A;  4OD7 A;  2PN8 A;  4MF7 A;  1MDI A;  2HE3 A;  1A8L A;  3PPU A;  2JZT A;  1LU4 A;  3EU4 A;  3BJ5 A;  4OMV A;  4TOP A;  2GVP A;  4Z7X A;  1EV4 A;  3GKX A;  1RQM A;  2VAF A;  2IPA A;  2VCT A;  2OE1 A;  1VF3 A;  5IMV A;  3EMX A;  5A5K A;  5JWO B;  3H93 A;  3MSZ A;  2DMM A;  1AIU A;  4IW9 A;  2NTO A;  3G7J A;  3ZIT A;  4G0L A;  2O89 A;  1SD9 A;  1OYJ A;  1EOH A;  2AUV A;  2GGT A;  3GH6 A;  1PMT A;  3FZ5 A;  1H4O A;  1U3A A;  4FO5 A;  4MA9 A;  1AQW A;  1GUH A;  3RAZ A;  1BJX A;  3QMX A;  2BMX A;  2GT5 A;  1X5E A;  2FUG 2;  3IE3 A;  2H0H A;  4ECC A;  4OCE A;  2H0G A;  1K0A A;  5H5Q A;  1ST9 A;  1ZGN A;  1TRW A;  1ZYQ B;  4DVC A;  2RII A;  2LJK A;  1XXU A;  3QOU A;  3EMP A;  3LGC A;  3O3T A;  4J2F A;  1XWG A;  5GZZ B;  5G30 A;  3ZL5 A;  3ME8 A;  4BA7 A;  4BPY A;  3FHK A;  3GKM A;  4NXI A;  2WCI A;  3UVT A;  4GSN A;  2E0Q A;  1H75 A;  3CSJ A;  2YWO A;  5JWR B;  2CVB A;  1M99 A;  3VFI A;  4TW5 A;  4V2M A;  4HDE A;  1B9Y C;  5CRH A;  3UIW A;  1XWC A;  1LJR A;  3KH7 A;  3CBU A;  3GN3 A;  3H8Q A;  4GWR A;  2VL9 A;  4TXO A;  2B3S A;  3M0F A;  1MD4 A;  3E9J B;  2X8C A;  5B7C A;  4K0N A;  5J41 A;  4HU7 A;  11GS A;  2GSS A;  3VWU A;  1VRS D;  3HY2 A;  3ZZX A;  1B4P A;  1Z3E A;  3CSI A;  4XTS A;  5B8A A;  4OCF A;  1ERW A;  1GH2 A;  1F2E A;  3IK9 A;  4EC0 A;  1XBS A;  2R3X A;  3IPZ A;  4I8B A;  4OWY A;  4ILF A;  3F4R A;  1PKZ A;  2XC2 A;  3HVS A;  2KOK A;  1BED A;  2IMK A;  4J56 E;  6GST A;  2XPE A;  1TJD A;  3ZRE A;  4JED A;  5CRW A;  5G31 A;  1YEX A;  3DVX A;  1PD2 1;  4POK A;  1AQX A;  4MH2 A;  1SJ6 A;  4GTU A;  4F0C A;  1SK1 A;  4K0G A;  4FIW A;  3KMN A;  1W4V A;  1SL0 B;  5C00 A;  1XOB A;  4IS0 A;  2I81 A;  4L8E A;  3VUR A;  1A8Y A;  2JZR A;  1C72 A;  1WIK A;  2H76 A;  2WS2 A;  1SJZ A;  1WPI A;  4I2U A;  2RLI A;  3PH9 A;  2P31 A;  5EY6 A;  1SKR B;  1TRU A;  1OE7 A;  2FWF A;  4ZIL A;  1SK2 A;  1ERT A;  2L6C A;  4WKW A;  1B4Q A;  2AB6 A;  3ZVJ A;  4EL1 A;  2HFD A;  1K0D A;  3GX8 A;  3DEX A;  3O6T A;  3QAW A;  3I6A A;  2C1Y A;  4N11 A;  1GSS A;  2H70 A;  1XVQ A;  4GRF A;  1YF0 A;  4GSS A;  2LJR A;  4EE0 A;  4X43 A;  2CX3 A;  1V40 A;  1FB0 A;  4HS1 A;  3FRC A;  4NWY A;  22GS A;  2H73 A;  2OBI A;  1DUG A;  2ZUP A;  2LV3 A;  4V1A p;  4IKH A;  4KDY A;  3HCZ A;  1JZW A;  2L5L A;  1WMJ A;  4HI7 A;  3GSS A;  2K6V A;  1XPV A;  1QGV A;  5IO2 A;  1O8W A;  4KUN A;  3LYK A;  5F8B A;  2C3T A;  1MD3 A;  4EO3 A;  1HNB A;  4L5O A;  4ZB8 A;  2L6D A;  3NZN A;  1MDJ A;  1TRS A;  3BCI A;  4MZC A;  4GQC A;  1TOF A;  1EEJ A;  3DD3 A;  2M46 A;  3LJR A;  5JCU A;  2DC5 A;  3G7I A;  3P8W A;  3UBL A;  4XHM A;  3ZML A;  2VL2 A;  4G0K A;  3Q19 A;  4Q5Q A;  2PGT A;  3BOA A;  5D93 A;  1MTC A;  1ZOF A;  3NOF A;  3M9J A;  4TRX A;  3HVV A;  5H5R A;  1EEM A;  3DYR A;  2HSH A;  4JZQ A;  3U5R E;  3KGK A;  3M1G A;  2CAQ A;  2F3M A;  5CP1 A;  2GZZ A;  3FYG A;  3TOT A;  1GSD A;  4BVY A;  3GNJ A;  5IIZ A;  2WFC A;  3UVH A;  5GAN D;  4TR4 A;  3GIX A;  5JCG A;  3DWV A;  1ACV A;  3G9B A;  17GS A;  4AJ7 A;  1XZO A;  4KDU A;  2REM A;  5HQP A;  2FNO A;  4MCU A;  2BTO T;  1AQV A;  1A0F A;  2B7K A;  2L4C A;  2HSM A;  4YQM A;  4ZL9 A;  5AIV A;  3WGD A;  3F8U A;  2V6K A;  1O73 A;  1G6Y A;  2FA8 A;  3KIJ A;  3TOU A;  3GUR A;  1TK0 B;  4MZW A;  2V6O A;  5AIS A;  2PU9 C;  5HR1 A;  1KEB A;  3CYN A;  3RDW A;  3TKS C;  4O32 A;  1K0M A;  1TTZ A;  2V1M A;  1XW6 A;  3WT2 A;  4KH7 A;  4ZL8 A;  4HOJ A;  5D73 A;  1E2Y A;  1GUL A;  3F6D A;  1TDI A;  3MWH A;  1IYH A;  2VLU A;  2YV7 A;  3IDV A;  4AF2 A;  3FR9 A;  3HA9 A;  4TR1 A;  4LMW A;  2HXK A;  4BVY B;  5ECQ B;  4WF5 A;  1F3B A;  2HNL A;  2H66 A;  3GST A;  6GSX A;  5ECH B;  3KM6 A;  3KD0 A;  3UMA A;  2LRT A;  4GST A;  1A2L A;  5IOX A;  1GTA A;  1GUM A;  3GHA A;  3IV4 A;  8GSS A;  2AYT A;  4MF5 A;  5INY A;  1SL1 B;  2YN1 A;  2N5B A;  1OC3 A;  1A0R P;  4DEJ A;  1ABA A;  3I9V 2;  1T8E B;  2HSM B;  2OAC A;  3ZMK A;  3TJF A;  2LRN A;  1BG5 A;  2NPB A;  3J7Y k;  1JLV A;  5DAL A;  2PMT A;  2D2Z A;  4MPF A;  3Q18 A;  3WD6 A;  2B1L A;  10GS A;  4X1U A;  4GXZ A;  1DE2 A;  1JZD A;  1OC8 A;  4FYU A;  2M72 A;  1GTB A;  3Q6O A;  5CO3 A;  3CRU A;  5G5E A;  1JHB A;  2V2G A;  3NIV A;  4XRD A;  3UEM A;  2HQT A;  5IMZ A;  3EU3 A;  3KMO A;  4I2T A;  3EIN A;  3HYP A;  1ZYE A;  1GL8 A;  5G5F A;  5DAK A;  5GSS A;  3KTB A;  1WP0 A;  2GQM A;  4TR1 B;  2PUK C;  4TR0 A;  1K3L A;  5JCW A;  4O92 A;  2EC4 A;  2JAC A;  1SYR A;  2A2R A;  5DVB A;  4P3Y B;  2QGV A;  2H72 A;  4KA0 A;  3E3E A;  1TI3 A;  1M2A A;  1OVN A;  3APO A;  2E7P A;  1Z5Y E;  1FO5 A;  2NDO A;  4H86 A;  4ECJ A;  1YKC A;  1DSB A;  3TB2 A;  2IJY A;  2GDR A;  2VM2 A;  2IME A;  3HD5 A;  5ELG A;  5DAL B;  2FD3 A;  1TRV A;  2B5Y A;  2VCZ A;  1K0N A;  1AC1 A;  5KEJ A;  2CAI A;  5IO0 A;  1UC7 A;  2R4V A;  2H1A A;  1AUC A;  3IRA A;  1O6J A;  2GSR A;  1SL2 B;  2DLX A;  2R37 A;  2YOI A;  1T1V A;  2GS3 A;  2KLX A;  2B5E A;  4KF9 A;  3IC8 A;  1SD8 A;  4HEA 2;  4PQI A;  4K7O A;  4PQ1 A;  5IQY A;  3QR6 A;  3RHB A;  1PSQ A;  3Q74 A;  5DAK B;  3ZFB A;  3OR5 A;  2VOC A;  3V1W A;  3ISO A;  4PGT A;  5G1L A;  6GSY A;  1SK0 A;  1EV9 A;  3LSZ A;  3GKN A;  1TKD B;  2E2G A;  2O87 A;  4WBJ A;  1A24 A;  5A4W A;  1ZCP A;  2JSZ A;  4RI6 A;  2O8V B;  2RM6 A;  5F05 A;  4ZIJ A;  4PUA A;  4X0X A;  4XS6 A;  2WZ9 A;  4MJC A;  4KCA A;  2G0F A;  3TKR A;  4WF4 A;  2YWI A;  1RW1 A;  1JZO A;  2EIR A;  1FB6 A;  4HJ2 A;  3P2A A;  1Z6M A;  2CX4 A;  3LEF A;  2HZF A;  3TUE A;  4NHZ A;  18GS A;  4RI7 A;  1TU8 A;  2DJ3 A;  3APS A;  3H4K A;  2H8L A;  2B6M A;  2JAD A;  4I5Q A;  3C73 A;  5HFI A;  3UOM A;  4ECI A;  4HUA A;  3ZFL A;  2R6K A;  2PBJ A;  2DJK A;  1GSU A;  4L5L A;  4V2N A;  4G2E A;  2PVO C;  5D9T A;  4JR4 A;  2LNT A;  3EVI A;  3LG6 A;  5IOW A;  3WGX A;  1KBN A;  3DIE A;  3ERG A;  2MYG A;  3QPM A;  1A23 A;  2C0E A;  9GSS A;  2CVD A;  2DSA A;  2PWJ A;  4YQV A;  5DCG A;  1B48 A;  4PQH A;  5G2Z A;  3GV1 A;  1F9M A;  5HR2 A;  5DQY A;  3GL5 A;  1M7T A;  1NW2 A;  2LTK A;  2H0I A;  5D8I A;  3DML A;  4EDY A;  5KN3 A;  4V2L A;  1EGR A;  4G0I A;  3VWW A;  2NBS A;  1W89 A;  2IMF A;  1T00 A;  1EP8 A;  3UAR A;  3W8J A;  1THX A;  1YEP A;  1CQH A;  1T4Z A;  2VL2 C;  2ON7 A;  1XWB A;  4IP6 A;  5DBQ A;  3MDK A;  5CNW A;  2YZH A;  4PXO A;  1S3A A;  3F4T A;  2K9F A;  1YZX A;  4TXO B;  3F3Q A;  2VCV A;  1UN2 A;  2YJ7 A;  3C71 A;  4ZBD A;  4BL7 A;  4ID0 A;  2DJ0 A;  4GQF A;  4OFM A;  2H1B A;  1PA3 A;  4BVX A;  2DBC A;  5KN2 A;  3WGE A;  4DSQ A;  4HU9 A;  4EUY A;  4IHU A;  3M3M A;  2OE3 A;  1V58 A;  3TGZ A;  2R2J A;  5ENU A;  3ERW A;  2GZY A;  3IAS 2;  3IBH A;  1YKA A;  4XIH A;  3LXZ A;  2WRT A;  2MMN A;  3ZRD A;  2IWT A;  2E2M A;  2XHF A;  1XWK A;  3WYW A;  3IR4 A;  2V32 A;  1U88 A;  1U87 A;  5G1K A;  3IAM 2;  2BJX A;  1M2D A;  1XCC A;  2ON5 A;  4TR3 A;  3GA4 A;  4I97 A;  2O85 A;  5A4U A;  2K8V A;  1THO A;  4NV5 A;  1SJI A;  4JE1 A;  4OO5 A;  1VGL A;  2QSI A;  3LFL A;  3J7Y b;  4ULX A;  4IQA A;  5IPG A;  1ZZY A;  2GQK A;  4XRA A;  2KUC A;  1K0B A;  5ECS A;  1K3Y A;  2JL4 A;  4N0Z A;  2HLS A;  4KDX A;  3EUR A;  3FZ4 A;  5DCH A;  5F0G A;  2C0D A;  3RBT A;  2IIY A;  2L59 A;  1OAZ A;  1IYI A;  2G2Q A;  3CTF A;  5F07 A;  3TJG A;  3CMI A;  4IGJ A;  1M0U A;  4WET A;  2CQ9 A;  1BQ7 A;  4RQR A;  4BL7 B;  1G7E A;  3F3R A;  1QUW A;  1A2J A;  3GUS A;  5H5S A;  4MMM A;  4BVX B;  2LUS A;  1BYE A;  3EWL A;  4JRR A;  3GX0 A;  2AHE A;  1QXH A;  2KHP A;  4BWS A;  4MJA A;  2CZ2 A;  3QDN A;  2YZU A;  3DKS A;  3BCK A;  2H30 A;  3HDC A;  1GTI A;  3TCO A;  1RK4 A;  3UJ1 A;  2JSY A;  1J0F A;  4YAP A;  1PX7 A;  3ZLP A;  4PTS A;  3DGQ A;  1FVJ A;  3D21 A;  2XBQ A;  3BD2 A;  1J9B A;  4OFT A;  3TJJ A;  3A3T A;  1V2A A;  2LS5 A;  1M9A A;  2X8G A;  3GTU A;  1ZMA A;  3GKK A;  4K9Z A;  3RPN A;  2QC7 A;  2AV4 A;  3EYT A;  2NVL A;  2LQQ A;  5D9W A;  2C80 A;  2GTU A;  16GS A;  3R3E A;  1TK5 B;  4KSO A;  2HT9 A;  3D22 A;  2HRF A;  2CT6 A;  1R5A A;  2KP2 A;  4EVM A;  2MBS A;  2X99 A;  4YQU A;  4HQZ A;  6GSW A;  3PIN A;  3L0H A;  3L9S A;  2YV9 A;  1F3A A;  3F0I A;  1QMV A;  1HYU A;  5ECI B;  3F9U A;  13GS A;  2FA4 A;  1DE1 A;  2I1U A;  2C3N A;  5ABR A;  2LNS A;  4D73 A;  5F06 A;  4PUF C;  1EOG A;  1YJ6 A;  4PNG A;  3I69 A;  5KN1 A;  4KW6 A;  2X64 A;  1PQN A;  4NPB A;  3SWL A;  2AAW A;  3S9F A;  4DSR A;  3UAP A;  5ECM B;  1PGT A;  4CDO A;  3TKQ A;  3U6V A;  4O5R A;  2HSY A;  3LWA A;  4OFN A;  5D9V A;  5A4V A;  1TK8 B;  4K1F A;  2IMI A;  2YCD A;  1O7U A;  2YPM A;  3E0U A;  4ML6 A;  3A5W A;  3GTU B;  3KCM A;  2PER A;  3ZIV A;  3IXR A;  1PL1 A;  4ACS A;  3HZ8 A;  1G7O A;  5J3R A;  5J4U A;  3VPQ A;  2HZE A;  3SBC A;  3LYP A;  4I6X A;  2CA8 A;  3O76 A;  3FZ9 A;  5AGY A;  4N0V A;  3QAV A;  3P7X A;  2H6Z A;  4JU5 A;  3R2Q A;  1HNA A;  1JFU A;  6GSS A;  4TXV A;  2I9H A;  4LL1 B;  2YP6 A;  3BBY A;  3HXS A;  2YNX A;  3TRP A;  4D73 B;  4POB A;  1R26 A;  2F51 A;  1UVZ A;  5EVO A;  1O81 A;  3IOS A;  1JLW A;  4F9Z A;  1K3O A;  4TN8 A;  3HJO A;  5E4W A;  1HD2 A;  2OA7 A;  1TI1 A;  2XBI A;  1EWX A;  3TDG A;  2XPD A;  1TP9 A;  4XS4 A;  4J57 E;  4Q5N A;  3IA1 A;  1WOU A;  4MZB A;  1XWA A;  2HYX A;  4XS1 A;  4IP1 A;  2FHE A;  2A4V A;  3KXO A;  2HI7 A;  3QFB C;  4EDZ A;  4ISD A;  1KNG A;  2UZ8 A;  3UBK A;  2ALB A;  2M80 A;  4K7I A;  1WRY A;  2KP1 A;  3DRN A;  1ZL9 A;  4MP4 A;  1M9B A;  1AXD A;  4HZ2 A;  2ZNM A;  3IK7 A;  3D6I A;  5LCZ A;  3ED3 A;  1S3C A;  2HZE B;  2YWM A;  4RUV A;  4LA1 A;  4ML1 A;  1PL2 A;  1ERU A;  3GYK A;  4ZL7 A;  4AJ6 A;  3KP9 A;  2VD1 A;  1E6B A;  3C8E A;  3CXG A;  4PNF A;  2OKA A;  3LOR A;  1GNE A;  2P0G A;  4EXJ A;  5E59 A;  2LST A;  2I3Y A;  3KTL A;  2MMO A;  4NV2 A;  2R5G A;  5D9X A;  2TRC P;  1MEK A;  3D0Z A;  5FWG A;  1XW9 A;  4XS4 B;  4JBB A;  2IL3 A;  4MDC A;  4OO4 A;  1U3I A;  2H6X A;  1WE0 A;  2L5O A;  4KGI A;  4IJI A;  2Z9S A;  2F8F A;  4PX1 A;  2DJ2 A;  2PVQ A;  2VLV A;  1X9S B;  3TJB A;  4O7H A;  3M8N A;  2VCW A;  2MMZ A;  4RQX A;  3LQ7 A;  2B1K A;  2VD0 A;  2C0F A;  3QD9 A;  2GLR A;  2VO4 A;  5ECO B;  2F8A A;  2TIR A;  3GMF A;  5IMA A;  2YJH A;  4MPG A;  2DML A;  2X8H A;  1GRX A;  1M2B A;  4KX4 A;  1N8J A;  2FGX A;  3W8S A;  3VI5 A;  1UA5 A;  2FY6 A;  3ZYW A;  3C1S A;  2VL3 A;  4POL A;  2YWN A;  4USS A;  6GSU A;  3DVW A;  5DJL A;  1WJK A;  1EP7 A;  2CZ3 A;  4WEY A;  1OKT A;  5ID2 A;  5EPF A;  4F2I A;  5HR0 A;  3G7Y A;  3L78 A;  20GS A;  5CAX A;  1NM3 A;  4IEL A;  3ERF A;  5IMD A;  4MF6 A;  5D96 A;  2H6Y A;  3VK9 A;  4DSS A;  6GSV A;  2CVK A;  3L9U A;  1GWC A;  2WDU A;  5B6N A;  1SKS B;  3KZQ A;  4LL4 B;  1SYX A;  2C8U A;  3AY8 A;  1X9M B;  4JR6 A;  5AIX A;  4K2D A;  5B8B A;  1SKW B;  3CRT A;  3VLN A;  3A2V A;  2YAN A;  1WWJ A;  2LEG A;  4BWQ A;  1NSW A;  3US3 A;  4ECB A;  1YF1 A;  2HSN B;  4Q5R A;  1SEN A;  3QCP A;  1GP1 A;  14GS A;  2JU5 A;  2B5X A;  2LKU A;  3TKS E;  4KB3 A;  1FVK A;  3IC4 A;  5COH A;  5LNK e;  5J9C A;  2P5Q A;  1GSE A;  3TRQ A;  4E8H A;  2H19 A;  1FHE A;  4GLT A;  1PRX A;  2N5F A;  4MLY A;  5FHI A;  1A2M A;  3D4T A;  2H1G A;  4YAV A;  2EIQ A;  3HVX A;  1YQ1 A;  3HZ4 A;  5IMF A;  3FK8 A;  3HJM A;  2GZP A;  5JWQ B;  1J08 A;  3MNG A;  4EF0 A;  1ILO A;  2O7K A;  1TW9 A;  4HZ4 A;  5J9B A;  4QL7 A;  3F6F A;  2WB9 A;  5ID2 B;  1ERV A;  2GQL A;  3FEU A; 
#chains in the Genus database with same CATH topology
 2AJQ B;  4GCI A;  1VF1 A;  3MAK A;  3PR8 A;  1Z7P A;  2H75 A;  2PPT A;  1F37 A;  4CHS A;  3P90 A;  4DSS B;  2VCQ A;  5DJM A;  5ECP B;  2H01 A;  5FT3 A;  2P5R A;  3TKP A;  7GSS A;  2MMA A;  3L9V A;  3VWV A;  2H71 A;  1VF4 A;  1EGO A;  1U6T A;  2JZS A;  4MAB A;  4CW9 A;  1Y6E A;  3FW2 A;  3RPP A;  2UV8 G;  1O8X A;  3KP8 A;  1LBK A;  2RUE A;  4ZBA A;  1FOV A;  3GH9 A;  4MNN A;  4QL9 A;  2OAD A;  2H1D A;  1Z7R A;  5B6M A;  4IN0 A;  3FY7 A;  3FR3 A;  3TJK A;  4E8E A;  3EPT A;  1B9X C;  3FR6 A;  2DJJ A;  2RUF A;  1SVL A;  1XW5 A;  4F03 A;  1AAZ A;  1GTU A;  4WR5 A;  1ML6 A;  1V98 A;  3KH9 A;  3N9J A;  4XCS A;  19GS A;  2OE0 A;  1HNC A;  1XFL A;  4L0U A;  3QAG A;  4O5U A;  5ECK B;  1AW9 A;  1R4W A;  2OBK A;  3EE2 A;  2N5A A;  2K8S A;  3APQ A;  1OKD A;  3F63 A;  5ECL B;  3JCM L;  3ME7 A;  3CSH A;  3A2W A;  1GUK A;  1QQ2 A;  1XIY A;  2VUP A;  3TRX A;  1USB A;  1Y25 A;  4FQU A;  4AKG A;  1V57 A;  5CYY A;  2GSQ A;  2MBT A;  4Q5F A;  1FW1 A;  2QKE A;  4F82 A;  1SU9 A;  4YKF A;  3A2X A;  2DKH A;  2FCH A;  4NHW A;  1T4Y A;  2WUL A;  4FYC A;  4KE3 A;  1BX9 A;  1Q4J A;  3ZVJ D;  2HRN A;  5EL8 A;  1XVW A;  2CV4 A;  1EZK A;  4WBR D;  1GLP A;  4QQ7 A;  1URM A;  4POM A;  3HJP A;  5J5N A;  4MJB A;  2IN3 A;  5ELA A;  2FWH A;  3FKF A;  3MYD A;  4LLR A;  1T7P B;  4KSM A;  5LD0 A;  4PUR A;  1BAY A;  3H1N A;  2GST A;  2GT6 A;  1YY7 A;  3GFK A;  5IMC A;  2L57 A;  4HSC X;  1OE8 A;  1O85 A;  2IMD A;  1GSF A;  3C7M A;  4IJ3 A;  4V1A g;  4WR4 A;  3D5J A;  4ZB6 A;  4X4J A;  2ZCT A;  2DIZ A;  3K8N A;  2I4A A;  2F9S A;  4KCE A;  4NAX A;  3H79 A;  3RHC A;  1KTE A;  4WXT A;  2LRC A;  2HRA A;  4MH3 A;  3VPT A;  1X9W B;  1X0R A;  1K0C A;  2A2S A;  4HQS A;  3L4N A;  5CRG A;  3WT1 A;  4A5P A;  1MDK A;  4YH2 A;  3EC3 A;  1OC9 A;  1SVO A;  2EIO A;  3I43 A;  5DQS A;  4GDF A;  2L4Q A;  4K6X A;  1TU7 A;  1GSQ A;  5A34 A;  1FAA A;  1TXX A;  1K0O A;  2VIM A;  5BMU A;  4FYB A;  3FZA A;  2O36 A;  1Z9H A;  4GF0 A;  1QK8 A;  3GRX A;  3N5O A;  2VM1 A;  2IFQ A;  4N30 A;  2HRK A;  1GNW A;  3HKR A;  1V9W A;  1G0T A;  1I5G A;  4AKH A;  3UL3 A;  4ZB9 A;  2K18 A;  4IQ1 A;  5HR3 A;  3W6G A;  3CTG A;  3ZIJ A;  5GAP D;  4AGS A;  4G9H A;  4LMV A;  1N2A A;  3MIX A;  3LXT A;  12GS A;  5CRD A;  1NHY A;  3A5I A;  2OJL A;  4FH8 A;  2TRX A;  2B7J A;  1S3D A;  5L71 A;  1PN9 A;  5C04 A;  4ZXG A;  3DXB A;  1YDK A;  1PX6 A;  2DIY A;  3HHV A;  2LQO A;  1I9D A;  4F0B A;  4N3Z A;  5KN0 A;  2J23 A;  1JZR A;  5ECR B;  2EFE A;  2LJA A;  2X4A A;  4K7N A;  4NMU A;  1XOA A;  1QFN A;  1OC9 B;  3F4S A;  4TKY A;  4IVF A;  3PGT A;  1B8X A;  5A34 B;  5ECN B;  2WW3 A;  4N10 A;  3D4M A;  3GL3 A;  5BMU B;  1BF5 A;  2VCX A;  2FWE A;  1F6M C;  2J9H A;  2H74 A;  4ZBB A;  4K8M A;  1T3B A;  5IM9 A;  5DDL A;  1PKW A;  3CWG A;  4Z2R A;  3M9K A;  2IFQ B;  5GST A;  4G10 A;  2HRK B;  2WW0 A;  2ES7 A;  2WGR A;  1FOH A;  4MJE A;  4KND A;  3KEB A;  1X5D A;  4KAE A;  3VWX A;  1R7H A;  2C0G A;  5HFG A;  1GLQ A;  3C1R A;  4G01 A;  2FWG A;  1Y1U A;  3QFA C;  5HFK A;  1R5P A;  5AN1 A;  3KJY A;  4G19 A;  4E68 A;  1GSY A;  1FG4 A;  3TKS A;  1ON4 A;  5CRE A;  1X5C A;  1DBY A;  1VF2 A;  2DJ1 A;  3VI7 A;  5IPH A;  2C4J A;  2VLT A;  1Q98 A;  4MK3 A;  1CQG A;  1NHO A;  4AJ8 A;  2V41 A;  2WJU A;  4TVE A;  4HJM A;  4IBP A;  4L0W A;  1Z6N A;  3IHQ A;  2FLS A;  2RM5 A;  1G6W A;  3ZTL A;  2MZC A;  4EKZ A;  2C3Q A;  1HQO A;  4OD7 A;  2PN8 A;  4MF7 A;  1MDI A;  2HE3 A;  1A8L A;  3PPU A;  2JZT A;  1LU4 A;  3EU4 A;  3BJ5 A;  4OMV A;  4TOP A;  2GVP A;  4Z7X A;  1EV4 A;  3GKX A;  1RQM A;  1PFO A;  2VAF A;  2IPA A;  2VCT A;  2OE1 A;  1VF3 A;  5IMV A;  3EMX A;  5A5K A;  5JWO B;  3H93 A;  3MSZ A;  2DMM A;  1AIU A;  4IW9 A;  2NTO A;  3G7J A;  3ZIT A;  4G0L A;  2O89 A;  1SD9 A;  1OYJ A;  1EOH A;  2AUV A;  2GGT A;  3FMW A;  3GH6 A;  1PMT A;  3FZ5 A;  1H4O A;  1U3A A;  4FO5 A;  2WVX A;  4MA9 A;  1AQW A;  1GUH A;  3RAZ A;  1S3R A;  1BJX A;  3QMX A;  2BMX A;  2GT5 A;  1X5E A;  2FUG 2;  3IE3 A;  2H0H A;  4ECC A;  4ZB7 A;  4OCE A;  2H0G A;  1K0A A;  5H5Q A;  1ST9 A;  1ZGN A;  1TRW A;  1ZYQ B;  4DVC A;  2RII A;  2LJK A;  1XXU A;  3QOU A;  3EMP A;  3LGC A;  3O3T A;  4J2F A;  1XWG A;  5GZZ B;  5G30 A;  3ZL5 A;  3ME8 A;  4BA7 A;  4BPY A;  3FHK A;  3GKM A;  4NXI A;  2WCI A;  3UVT A;  4GSN A;  2E0Q A;  1H75 A;  3CSJ A;  2YWO A;  5JWR B;  2CVB A;  1M99 A;  3VFI A;  4TW5 A;  4V2M A;  4HDE A;  1B9Y C;  5CRH A;  3UIW A;  1XWC A;  3CHX C;  1LJR A;  3KH7 A;  3CBU A;  3GN3 A;  3H8Q A;  5A5H A;  4GWR A;  2VL9 A;  4TXO A;  2B3S A;  3M0F A;  1MD4 A;  3E9J B;  2X8C A;  5B7C A;  4K0N A;  5J41 A;  4HU7 A;  11GS A;  2GSS A;  3VWU A;  1VRS D;  3HY2 A;  4PI2 C;  2WVX B;  3ZZX A;  1B4P A;  1Z3E A;  3CSI A;  4XTS A;  5B8A A;  4OCF A;  1ERW A;  1GH2 A;  1F2E A;  3IK9 A;  4EC0 A;  4YKG A;  1XBS A;  2R3X A;  3IPZ A;  4I8B A;  4OWY A;  4ILF A;  3F4R A;  1PKZ A;  2XC2 A;  3HVS A;  2KOK A;  1BED A;  2IMK A;  4J56 E;  6GST A;  2XPE A;  1TJD A;  3ZRE A;  4JED A;  5CRW A;  5G31 A;  1YEX A;  3DVX A;  1PD2 1;  4POK A;  1AQX A;  4MH2 A;  1SJ6 A;  4GTU A;  4F0C A;  1SK1 A;  4K0G A;  4FIW A;  3KMN A;  1W4V A;  1SL0 B;  5C00 A;  1XOB A;  4IS0 A;  2I81 A;  2WVZ A;  4L8E A;  3VUR A;  1A8Y A;  2JZR A;  1C72 A;  1WIK A;  2H76 A;  2WS2 A;  1SJZ A;  5A5H B;  1WPI A;  4I2U A;  2RLI A;  3PH9 A;  2P31 A;  5EY6 A;  1SKR B;  1TRU A;  1OE7 A;  2FWF A;  4ZIL A;  1SK2 A;  1ERT A;  2L6C A;  4WKW A;  1B4Q A;  2AB6 A;  3ZVJ A;  4EL1 A;  2HFD A;  1K0D A;  3GX8 A;  3DEX A;  3O6T A;  1M3I A;  3QAW A;  3I6A A;  2C1Y A;  4N11 A;  1GSS A;  2H70 A;  1XVQ A;  4GRF A;  1YF0 A;  4GSS A;  3RGB C;  2LJR A;  4EE0 A;  4X43 A;  2CX3 A;  1V40 A;  5A1N A;  1FB0 A;  4HS1 A;  3FRC A;  4NWY A;  22GS A;  2H73 A;  2OBI A;  2H1L A;  4K5R A;  1DUG A;  2ZUP A;  2LV3 A;  4V1A p;  4IKH A;  4KDY A;  3HCZ A;  1JZW A;  2L5L A;  1BG1 A;  1WMJ A;  4HI7 A;  3GSS A;  2K6V A;  1XPV A;  1QGV A;  5IO2 A;  1O8W A;  4KUN A;  3LYK A;  5F8B A;  2C3T A;  1MD3 A;  4EO3 A;  1HNB A;  4L5O A;  4ZB8 A;  2L6D A;  3NZN A;  1M3J A;  1MDJ A;  1TRS A;  3BCI A;  4MZC A;  4GQC A;  1TOF A;  1EEJ A;  3DD3 A;  2M46 A;  2VKZ G;  3LJR A;  5JCU A;  2DC5 A;  3G7I A;  3P8W A;  3UBL A;  4XHM A;  3ZML A;  2VL2 A;  4G0K A;  3Q19 A;  4Q5Q A;  2PGT A;  3BOA A;  5D93 A;  4QMK A;  1MTC A;  1ZOF A;  3NOF A;  3M9J A;  4TRX A;  3HVV A;  5H5R A;  1EEM A;  3DYR A;  1N25 A;  2HSH A;  4JZQ A;  3U5R E;  4AKX B;  3KGK A;  3M1G A;  2CAQ A;  2F3M A;  5CP1 A;  5A1N B;  2GZZ A;  3FYG A;  4CY8 A;  3TOT A;  1GSD A;  4ICY A;  4BVY A;  3GNJ A;  5IIZ A;  2WFC A;  3UVH A;  5GAN D;  4TR4 A;  3GIX A;  5JCG A;  3DWV A;  1I1I P;  1ACV A;  3G9B A;  17GS A;  4AJ7 A;  1XZO A;  4KDU A;  2REM A;  5HQP A;  2FNO A;  4MCU A;  2BTO T;  1AQV A;  1A0F A;  2B7K A;  2L4C A;  2HSM A;  4YQM A;  4ZL9 A;  5AIV A;  3WGD A;  3F8U A;  1XG8 A;  2V6K A;  1O73 A;  1G6Y A;  2FA8 A;  3TOU A;  3KIJ A;  3GUR A;  1TK0 B;  4MZW A;  2V6O A;  5AIS A;  2PU9 C;  5HR1 A;  1KEB A;  3CYN A;  3RDW A;  3TKS C;  4O32 A;  1K0M A;  1TTZ A;  5KOX A;  2V1M A;  1XW6 A;  3WT2 A;  4KH7 A;  4ZL8 A;  4HOJ A;  5D73 A;  1E2Y A;  1GUL A;  3F6D A;  1TDI A;  1IYH A;  3MWH A;  2VLU A;  2YV7 A;  3IDV A;  4AF2 A;  3FR9 A;  3HA9 A;  4TR1 A;  4LMW A;  2HXK A;  4BVY B;  5ECQ B;  4WF5 A;  1F3B A;  2HNL A;  2H66 A;  3GST A;  6GSX A;  5ECH B;  3KM6 A;  3KD0 A;  3UMA A;  2LRT A;  4GST A;  1A2L A;  5IOX A;  1GTA A;  1GUM A;  3GHA A;  3IV4 A;  8GSS A;  2AYT A;  4MF5 A;  5INY A;  1SL1 B;  2YN1 A;  2QA1 A;  2N5B A;  1OC3 A;  1A0R P;  4DEJ A;  2R0G A;  1ABA A;  3I9V 2;  1T8E B;  2HSM B;  2OAC A;  3ZMK A;  3TJF A;  2LRN A;  1BG5 A;  2NPB A;  3J7Y k;  1JLV A;  2EFD A;  5DAL A;  2PMT A;  2D2Z A;  4MPF A;  3Q18 A;  3WD6 A;  2B1L A;  10GS A;  4X1U A;  4GXZ A;  1DE2 A;  1JZD A;  1OC8 A;  4FYU A;  2M72 A;  1GTB A;  3Q6O A;  5CO3 A;  3CRU A;  5G5E A;  1JHB A;  2V2G A;  3NIV A;  4XRD A;  3UEM A;  2HQT A;  5IMZ A;  3EU3 A;  3KMO A;  4I2T A;  3EIN A;  3HYP A;  1ZYE A;  2EFC A;  1GL8 A;  5G5F A;  5DAK A;  5GSS A;  3KTB A;  1WP0 A;  2GQM A;  4TR1 B;  2PUK C;  4TR0 A;  1K3L A;  5JCW A;  4O92 A;  2EC4 A;  2JAC A;  2R0P A;  1SYR A;  2A2R A;  2DKI A;  5DVB A;  4P3Y B;  2QGV A;  2H72 A;  4KA0 A;  3E3E A;  1TI3 A;  1M2A A;  1OVN A;  3APO A;  2E7P A;  1Z5Y E;  1FO5 A;  2NDO A;  4H86 A;  4ECJ A;  2QA2 A;  1YKC A;  1DSB A;  3TB2 A;  2IJY A;  2GDR A;  2VM2 A;  2IME A;  3HD5 A;  5ELG A;  5DAL B;  2FD3 A;  1TRV A;  3CQF A;  2B5Y A;  2VCZ A;  1K0N A;  1AC1 A;  5KEJ A;  2CAI A;  5IO0 A;  1UC7 A;  2R4V A;  2H1A A;  1AUC A;  3IRA A;  1O6J A;  2GSR A;  1SL2 B;  2DLX A;  2R37 A;  2YOI A;  1T1V A;  2GS3 A;  2KLX A;  2B5E A;  4KF9 A;  1YEW C;  3IC8 A;  1SD8 A;  2OT3 A;  4HEA 2;  4PQI A;  4K7O A;  4PHZ C;  4PQ1 A;  5IQY A;  3QR6 A;  3RHB A;  1PSQ A;  3Q74 A;  5DAK B;  3ZFB A;  3OR5 A;  2VOC A;  3V1W A;  3ISO A;  4PGT A;  4EIQ A;  5G1L A;  6GSY A;  1SK0 A;  1EV9 A;  3LSZ A;  3GKN A;  1TKD B;  2E2G A;  2O87 A;  4WBJ A;  1A24 A;  5A4W A;  1ZCP A;  2JSZ A;  4RI6 A;  2O8V B;  2RM6 A;  5F05 A;  4ZIJ A;  4PUA A;  4X0X A;  4XS6 A;  2WZ9 A;  4MJC A;  4KCA A;  2G0F A;  3TKR A;  4WF4 A;  2YWI A;  1RW1 A;  1JZO A;  2EIR A;  1FB6 A;  2WW1 A;  4HJ2 A;  3P2A A;  1Z6M A;  2CX4 A;  3LEF A;  2HZF A;  3TUE A;  4NHZ A;  18GS A;  4RI7 A;  1TU8 A;  2DJ3 A;  3APS A;  3H4K A;  2H8L A;  2B6M A;  4FXY P;  2JAD A;  4I5Q A;  3C73 A;  5HFI A;  3UOM A;  4ECI A;  4HUA A;  3ZFL A;  2R6K A;  2PBJ A;  2DJK A;  1GSU A;  4L5L A;  4V2N A;  4G2E A;  2PVO C;  5D9T A;  4JR4 A;  2LNT A;  3EVI A;  3LG6 A;  5IOW A;  1ZYN A;  3WGX A;  1KBN A;  3DIE A;  3ERG A;  2MYG A;  3QPM A;  1A23 A;  2C0E A;  9GSS A;  2CVD A;  2DSA A;  2PWJ A;  4YQV A;  4PI0 C;  3RFR C;  5DCG A;  5BRT A;  1B48 A;  4K2X A;  2A2P A;  4PQH A;  5G2Z A;  3GV1 A;  1F9M A;  5HR2 A;  5DQY A;  3GL5 A;  1M7T A;  1NW2 A;  2LTK A;  2H0I A;  5D8I A;  3DML A;  4EDY A;  5KN3 A;  4V2L A;  1EGR A;  4G0I A;  3VWW A;  2NBS A;  5J4V A;  1W89 A;  2IMF A;  1T00 A;  1EP8 A;  3UAR A;  3W8J A;  1THX A;  1YEP A;  1CQH A;  1T4Z A;  2VL2 C;  2ON7 A;  1XWB A;  4IP6 A;  5DBQ A;  3MDK A;  5CNW A;  2YZH A;  4PXO A;  1S3A A;  2EFH A;  3TU3 B;  3F4T A;  2K9F A;  1YZX A;  4TXO B;  5J47 A;  3F3Q A;  2VCV A;  1UN2 A;  2YJ7 A;  3C71 A;  4ZBD A;  4BL7 A;  4ID0 A;  2DJ0 A;  3HMJ G;  4GQF A;  4OFM A;  2H1B A;  1PA3 A;  4BVX A;  2DBC A;  5KN2 A;  3WGE A;  4DSQ A;  4HU9 A;  4EUY A;  4IHU A;  2WW2 A;  3M3M A;  2OE3 A;  1V58 A;  3TGZ A;  2R2J A;  5ENU A;  3ERW A;  2GZY A;  3IAS 2;  3IBH A;  1YKA A;  4XIH A;  3LXZ A;  2WRT A;  2MMN A;  3ZRD A;  2IWT A;  2E2M A;  2XHF A;  1XWK A;  3WYW A;  3IR4 A;  2V32 A;  1U88 A;  1U87 A;  5G1K A;  3IAM 2;  2BJX A;  1M2D A;  2O5V A;  2ON5 A;  1XCC A;  4TR3 A;  3GA4 A;  4I97 A;  2O85 A;  5A4U A;  2K8V A;  1THO A;  4NV5 A;  1SJI A;  4JE1 A;  4OO5 A;  1VGL A;  2QSI A;  3LFL A;  3J7Y b;  4ULX A;  4IQA A;  2O3E A;  5IPG A;  1ZZY A;  2GQK A;  2WZS A;  4XRA A;  2KUC A;  5J40 A;  1K0B A;  5ECS A;  1K3Y A;  2JL4 A;  4N0Z A;  2HLS A;  4KDX A;  3EUR A;  3FZ4 A;  5DCH A;  5F0G A;  2C0D A;  3RBT A;  2IIY A;  2L59 A;  1OAZ A;  1IYI A;  2G2Q A;  3CTF A;  5F07 A;  3TJG A;  3CMI A;  4IGJ A;  1M0U A;  4WET A;  2CQ9 A;  1BQ7 A;  4RQR A;  4O5Q A;  4BL7 B;  1G7E A;  3F3R A;  1QUW A;  1A2J A;  3GUS A;  5H5S A;  4MMM A;  4BVX B;  2LUS A;  1BYE A;  3EWL A;  4JRR A;  3GX0 A;  2AHE A;  1QXH A;  2KHP A;  4BWS A;  4MJA A;  2CZ2 A;  3QDN A;  2YZU A;  3DKS A;  3BCK A;  2H30 A;  3HDC A;  1GTI A;  3TCO A;  1RK4 A;  3UJ1 A;  2JSY A;  1J0F A;  4YAP A;  1PX7 A;  3ZLP A;  4PTS A;  3DGQ A;  1FVJ A;  3D21 A;  2XBQ A;  3BD2 A;  1J9B A;  4OFT A;  3TJJ A;  3A3T A;  2WVY A;  1V2A A;  2LS5 A;  1M9A A;  2X8G A;  3GTU A;  5KOW A;  1ZMA A;  3GKK A;  4K9Z A;  3RPN A;  2QC7 A;  2AV4 A;  3EYT A;  2NVL A;  2LQQ A;  5D9W A;  2C80 A;  2GTU A;  4AKI A;  16GS A;  3R3E A;  1TK5 B;  4KSO A;  2HT9 A;  3D22 A;  2HRF A;  2CT6 A;  1R5A A;  2KP2 A;  4EVM A;  2MBS A;  2X99 A;  4YQU A;  4HQZ A;  6GSW A;  3PIN A;  3L0H A;  3L9S A;  2YV9 A;  1F3A A;  3F0I A;  1QMV A;  1HYU A;  5ECI B;  3F9U A;  13GS A;  3IHG A;  4BIK A;  2FA4 A;  1DE1 A;  2I1U A;  2C3N A;  5ABR A;  2LNS A;  4D73 A;  5F06 A;  4PUF C;  1EOG A;  1YJ6 A;  4PNG A;  3I69 A;  5KN1 A;  4KW6 A;  2X64 A;  1PQN A;  4NPB A;  3SWL A;  2AAW A;  3S9F A;  4DSR A;  3UAP A;  5ECM B;  1PGT A;  4CDO A;  1ZYP A;  3TKQ A;  3U6V A;  4O5R A;  2HSY A;  3LWA A;  4OFN A;  5D9V A;  5A4V A;  1TK8 B;  4K1F A;  2IMI A;  2YCD A;  1O7U A;  2YPM A;  3E0U A;  4ML6 A;  3A5W A;  3GTU B;  3KCM A;  2PER A;  3ZIV A;  3IXR A;  1PL1 A;  4ACS A;  3HZ8 A;  1G7O A;  5J3R A;  5J4U A;  3VPQ A;  2HZE A;  3SBC A;  3LYP A;  4I6X A;  2CA8 A;  5J4Y A;  3O76 A;  3FZ9 A;  5AGY A;  4N0V A;  3QAV A;  3P7X A;  2H6Z A;  4JU5 A;  3R2Q A;  1HNA A;  1JFU A;  6GSS A;  4TXV A;  1YVL A;  2I9H A;  4LL1 B;  2YP6 A;  3BBY A;  4AI6 A;  2X49 A;  3HXS A;  2YNX A;  3TRP A;  4D73 B;  4POB A;  1R26 A;  2F51 A;  1UVZ A;  5EVO A;  1O81 A;  3IOS A;  1JLW A;  4F9Z A;  1K3O A;  4TN8 A;  3HJO A;  5E4W A;  1HD2 A;  2OA7 A;  1TI1 A;  2XBI A;  1EWX A;  3TDG A;  2XPD A;  1TP9 A;  4XS4 A;  4J57 E;  4Q5N A;  3IA1 A;  1WOU A;  4MZB A;  1XWA A;  2HYX A;  4XS1 A;  4IP1 A;  2FHE A;  2A4V A;  3KXO A;  2HI7 A;  3QFB C;  4EDZ A;  4ISD A;  1KNG A;  2UZ8 A;  3UBK A;  2ALB A;  2M80 A;  4K7I A;  1WRY A;  2KP1 A;  3DRN A;  1ZL9 A;  4MP4 A;  1M9B A;  1AXD A;  4HZ2 A;  2ZNM A;  3IK7 A;  3D6I A;  5LCZ A;  3ED3 A;  1S3C A;  2HZE B;  2YWM A;  4RUV A;  3LW9 A;  4LA1 A;  4ML1 A;  1PL2 A;  1ERU A;  3GYK A;  4ZL7 A;  4AJ6 A;  3KP9 A;  2VD1 A;  1E6B A;  3C8E A;  3CXG A;  4PNF A;  2OKA A;  3LOR A;  1GNE A;  2P0G A;  4K5S A;  4EXJ A;  5E59 A;  2LST A;  2I3Y A;  3KTL A;  2MMO A;  4Z2U A;  4NV2 A;  2R5G A;  5D9X A;  2TRC P;  1MEK A;  3D0Z A;  5FWG A;  1XW9 A;  4XS4 B;  4JBB A;  2IL3 A;  4MDC A;  4OO4 A;  1U3I A;  2H6X A;  1WE0 A;  2L5O A;  4KGI A;  4IJI A;  2Z9S A;  2F8F A;  4PX1 A;  2DJ2 A;  2PVQ A;  2VLV A;  1X9S B;  2A4H A;  3TJB A;  4O7H A;  3M8N A;  2VCW A;  1PN0 A;  2MMZ A;  4RQX A;  3LQ7 A;  3HVN A;  2B1K A;  2HSN A;  2VD0 A;  2C0F A;  3QD9 A;  2GLR A;  2VO4 A;  5ECO B;  2F8A A;  2TIR A;  3GMF A;  5IMA A;  2YJH A;  4MPG A;  2DML A;  4Z2T A;  2X8H A;  1GRX A;  1M2B A;  4KX4 A;  1N8J A;  2FGX A;  3W8S A;  3VI5 A;  1SVM A;  1UA5 A;  2FY6 A;  3ZYW A;  3C1S A;  4W66 A;  2R0C A;  2VL3 A;  4POL A;  2YWN A;  4USS A;  6GSU A;  3DVW A;  5DJL A;  1WJK A;  1EP7 A;  2CZ3 A;  4WEY A;  1OKT A;  5ID2 A;  5EPF A;  4F2I A;  5HR0 A;  3G7Y A;  3L78 A;  20GS A;  5CAX A;  4CY6 A;  1NM3 A;  4IEL A;  3ERF A;  5IMD A;  4MF6 A;  5D96 A;  4EIP A;  2H6Y A;  3VK9 A;  1S4B P;  6GSV A;  4DSS A;  2CVK A;  3L9U A;  1GWC A;  2WDU A;  5B6N A;  1SKS B;  3KZQ A;  4LL4 B;  1SYX A;  2C8U A;  3AY8 A;  1X9M B;  1TXU A;  4JR6 A;  5AIX A;  4K2D A;  5B8B A;  1SKW B;  3CRT A;  3VLN A;  3A2V A;  2YAN A;  1WWJ A;  2LEG A;  4BWQ A;  1NSW A;  3US3 A;  4ECB A;  1YF1 A;  2HSN B;  4Q5R A;  1SEN A;  3QCP A;  1GP1 A;  14GS A;  2JU5 A;  2B5X A;  2LKU A;  3TKS E;  4KB3 A;  1FVK A;  3IC4 A;  5COH A;  5LNK e;  5J9C A;  2P5Q A;  1GSE A;  3TRQ A;  4E8H A;  2H19 A;  1FHE A;  4GLT A;  1PRX A;  2N5F A;  4MLY A;  5FHI A;  1A2M A;  3D4T A;  2H1G A;  4YAV A;  2EIQ A;  3HVX A;  1YQ1 A;  3HZ4 A;  5IMF A;  3FK8 A;  3HJM A;  2GZP A;  5JWQ B;  1J08 A;  3MNG A;  4EF0 A;  1ILO A;  2O7K A;  1TW9 A;  4HZ4 A;  5J9B A;  4QL7 A;  3F6F A;  2WB9 A;  5ID2 B;  1ERV A;  2GQL A;  3FEU A; 
#chains in the Genus database with same CATH homology
 2AJQ B;  4GCI A;  1VF1 A;  3MAK A;  3PR8 A;  1Z7P A;  2H75 A;  2PPT A;  1F37 A;  4CHS A;  3P90 A;  4DSS B;  2VCQ A;  5DJM A;  5ECP B;  2H01 A;  5FT3 A;  2P5R A;  3TKP A;  7GSS A;  2MMA A;  3L9V A;  3VWV A;  2H71 A;  1VF4 A;  1EGO A;  1U6T A;  2JZS A;  4MAB A;  4CW9 A;  1Y6E A;  3FW2 A;  3RPP A;  2UV8 G;  1O8X A;  3KP8 A;  1LBK A;  2RUE A;  4ZBA A;  1FOV A;  3GH9 A;  4MNN A;  4QL9 A;  2OAD A;  2H1D A;  1Z7R A;  5B6M A;  4IN0 A;  3FY7 A;  3FR3 A;  3TJK A;  4E8E A;  3EPT A;  1B9X C;  3FR6 A;  2DJJ A;  2RUF A;  1SVL A;  1XW5 A;  4F03 A;  1AAZ A;  1GTU A;  4WR5 A;  1ML6 A;  1V98 A;  3KH9 A;  3N9J A;  4XCS A;  19GS A;  2OE0 A;  1HNC A;  1XFL A;  4L0U A;  3QAG A;  4O5U A;  5ECK B;  1AW9 A;  1R4W A;  2OBK A;  3EE2 A;  2N5A A;  2K8S A;  3APQ A;  1OKD A;  3F63 A;  5ECL B;  3JCM L;  3ME7 A;  3CSH A;  3A2W A;  1GUK A;  1QQ2 A;  1XIY A;  2VUP A;  3TRX A;  1USB A;  1Y25 A;  4FQU A;  4AKG A;  1V57 A;  5CYY A;  2GSQ A;  2MBT A;  4Q5F A;  1FW1 A;  2QKE A;  4F82 A;  1SU9 A;  4YKF A;  3A2X A;  2DKH A;  2FCH A;  4NHW A;  1T4Y A;  2WUL A;  4FYC A;  4KE3 A;  1BX9 A;  1Q4J A;  3ZVJ D;  2HRN A;  5EL8 A;  1XVW A;  2CV4 A;  1EZK A;  4WBR D;  1GLP A;  4QQ7 A;  1URM A;  4POM A;  3HJP A;  5J5N A;  4MJB A;  2IN3 A;  5ELA A;  2FWH A;  3FKF A;  3MYD A;  4LLR A;  1T7P B;  4KSM A;  5LD0 A;  4PUR A;  1BAY A;  3H1N A;  2GST A;  2GT6 A;  1YY7 A;  3GFK A;  5IMC A;  2L57 A;  1OE8 A;  1O85 A;  2IMD A;  1GSF A;  3C7M A;  4IJ3 A;  4V1A g;  4WR4 A;  3D5J A;  4ZB6 A;  4X4J A;  2ZCT A;  2DIZ A;  3K8N A;  2I4A A;  2F9S A;  4KCE A;  4NAX A;  3H79 A;  3RHC A;  1KTE A;  4WXT A;  2LRC A;  2HRA A;  4MH3 A;  3VPT A;  1X9W B;  1X0R A;  1K0C A;  2A2S A;  4HQS A;  3L4N A;  5CRG A;  3WT1 A;  4A5P A;  1MDK A;  4YH2 A;  3EC3 A;  1OC9 A;  1SVO A;  2EIO A;  3I43 A;  5DQS A;  4GDF A;  2L4Q A;  4K6X A;  1TU7 A;  1GSQ A;  5A34 A;  1FAA A;  1TXX A;  1K0O A;  2VIM A;  5BMU A;  4FYB A;  3FZA A;  1Z9H A;  4GF0 A;  1QK8 A;  3GRX A;  3N5O A;  2VM1 A;  2IFQ A;  4N30 A;  2HRK A;  1GNW A;  3HKR A;  1V9W A;  1G0T A;  1I5G A;  4AKH A;  3UL3 A;  4ZB9 A;  2K18 A;  4IQ1 A;  5HR3 A;  3W6G A;  3CTG A;  3ZIJ A;  5GAP D;  4AGS A;  4G9H A;  4LMV A;  1N2A A;  3MIX A;  3LXT A;  12GS A;  5CRD A;  1NHY A;  3A5I A;  2OJL A;  4FH8 A;  2TRX A;  2B7J A;  1S3D A;  5L71 A;  1PN9 A;  5C04 A;  4ZXG A;  3DXB A;  1YDK A;  1PX6 A;  2DIY A;  3HHV A;  2LQO A;  1I9D A;  4F0B A;  4N3Z A;  5KN0 A;  2J23 A;  1JZR A;  5ECR B;  2EFE A;  2LJA A;  2X4A A;  4K7N A;  4NMU A;  1XOA A;  1QFN A;  1OC9 B;  3F4S A;  4TKY A;  4IVF A;  3PGT A;  1B8X A;  5A34 B;  5ECN B;  4N10 A;  3D4M A;  3GL3 A;  5BMU B;  1BF5 A;  2VCX A;  2FWE A;  1F6M C;  2J9H A;  2H74 A;  4ZBB A;  4K8M A;  1T3B A;  5IM9 A;  5DDL A;  1PKW A;  3CWG A;  4Z2R A;  3M9K A;  2IFQ B;  5GST A;  4G10 A;  2HRK B;  2ES7 A;  2WGR A;  1FOH A;  4MJE A;  4KND A;  3KEB A;  1X5D A;  4KAE A;  3VWX A;  1R7H A;  2C0G A;  5HFG A;  1GLQ A;  3C1R A;  4G01 A;  2FWG A;  1Y1U A;  3QFA C;  5HFK A;  1R5P A;  5AN1 A;  3KJY A;  4G19 A;  4E68 A;  1GSY A;  1FG4 A;  3TKS A;  1ON4 A;  5CRE A;  1X5C A;  1DBY A;  1VF2 A;  2DJ1 A;  3VI7 A;  5IPH A;  2C4J A;  2VLT A;  1Q98 A;  4MK3 A;  1CQG A;  1NHO A;  4AJ8 A;  2V41 A;  2WJU A;  4TVE A;  4HJM A;  4IBP A;  4L0W A;  1Z6N A;  3IHQ A;  2FLS A;  2RM5 A;  1G6W A;  3ZTL A;  2MZC A;  4EKZ A;  2C3Q A;  1HQO A;  4OD7 A;  2PN8 A;  4MF7 A;  1MDI A;  2HE3 A;  1A8L A;  3PPU A;  2JZT A;  1LU4 A;  3EU4 A;  3BJ5 A;  4OMV A;  4TOP A;  2GVP A;  4Z7X A;  1EV4 A;  3GKX A;  1RQM A;  2VAF A;  2IPA A;  2VCT A;  2OE1 A;  1VF3 A;  5IMV A;  3EMX A;  5A5K A;  5JWO B;  3H93 A;  3MSZ A;  2DMM A;  1AIU A;  4IW9 A;  2NTO A;  3G7J A;  3ZIT A;  4G0L A;  2O89 A;  1SD9 A;  1OYJ A;  1EOH A;  2AUV A;  2GGT A;  3FMW A;  3GH6 A;  1PMT A;  3FZ5 A;  1H4O A;  1U3A A;  4FO5 A;  4MA9 A;  1AQW A;  1GUH A;  3RAZ A;  1BJX A;  3QMX A;  2BMX A;  2GT5 A;  1X5E A;  2FUG 2;  3IE3 A;  2H0H A;  4ECC A;  4ZB7 A;  4OCE A;  2H0G A;  1K0A A;  5H5Q A;  1ST9 A;  1ZGN A;  1TRW A;  1ZYQ B;  4DVC A;  2RII A;  2LJK A;  1XXU A;  3QOU A;  3EMP A;  3LGC A;  3O3T A;  4J2F A;  1XWG A;  5GZZ B;  5G30 A;  3ZL5 A;  3ME8 A;  4BA7 A;  4BPY A;  3FHK A;  3GKM A;  4NXI A;  2WCI A;  3UVT A;  4GSN A;  2E0Q A;  1H75 A;  3CSJ A;  2YWO A;  5JWR B;  2CVB A;  1M99 A;  3VFI A;  4TW5 A;  4V2M A;  4HDE A;  1B9Y C;  5CRH A;  3UIW A;  1XWC A;  1LJR A;  3KH7 A;  3CBU A;  3GN3 A;  3H8Q A;  5A5H A;  4GWR A;  2VL9 A;  4TXO A;  2B3S A;  3M0F A;  1MD4 A;  3E9J B;  2X8C A;  5B7C A;  4K0N A;  5J41 A;  4HU7 A;  11GS A;  2GSS A;  3VWU A;  1VRS D;  3HY2 A;  3ZZX A;  1B4P A;  1Z3E A;  3CSI A;  4XTS A;  5B8A A;  4OCF A;  1ERW A;  1GH2 A;  1F2E A;  3IK9 A;  4EC0 A;  4YKG A;  1XBS A;  2R3X A;  3IPZ A;  4I8B A;  4OWY A;  4ILF A;  3F4R A;  1PKZ A;  2XC2 A;  3HVS A;  2KOK A;  1BED A;  2IMK A;  4J56 E;  6GST A;  2XPE A;  1TJD A;  3ZRE A;  4JED A;  5CRW A;  5G31 A;  1YEX A;  3DVX A;  1PD2 1;  4POK A;  1AQX A;  4MH2 A;  1SJ6 A;  4GTU A;  4F0C A;  1SK1 A;  4K0G A;  4FIW A;  3KMN A;  1W4V A;  1SL0 B;  5C00 A;  1XOB A;  4IS0 A;  2I81 A;  4L8E A;  3VUR A;  1A8Y A;  2JZR A;  1C72 A;  1WIK A;  2H76 A;  2WS2 A;  1SJZ A;  5A5H B;  1WPI A;  4I2U A;  2RLI A;  3PH9 A;  2P31 A;  5EY6 A;  1SKR B;  1TRU A;  1OE7 A;  2FWF A;  4ZIL A;  1SK2 A;  1ERT A;  2L6C A;  4WKW A;  1B4Q A;  2AB6 A;  3ZVJ A;  4EL1 A;  2HFD A;  1K0D A;  3GX8 A;  3DEX A;  3O6T A;  3QAW A;  3I6A A;  2C1Y A;  4N11 A;  1GSS A;  2H70 A;  1XVQ A;  4GRF A;  1YF0 A;  4GSS A;  2LJR A;  4EE0 A;  4X43 A;  2CX3 A;  1V40 A;  5A1N A;  1FB0 A;  4HS1 A;  3FRC A;  4NWY A;  22GS A;  2H73 A;  2OBI A;  2H1L A;  4K5R A;  1DUG A;  2ZUP A;  2LV3 A;  4V1A p;  4IKH A;  4KDY A;  3HCZ A;  1JZW A;  2L5L A;  1BG1 A;  1WMJ A;  4HI7 A;  3GSS A;  2K6V A;  1XPV A;  1QGV A;  5IO2 A;  1O8W A;  4KUN A;  3LYK A;  5F8B A;  2C3T A;  1MD3 A;  4EO3 A;  1HNB A;  4L5O A;  4ZB8 A;  2L6D A;  3NZN A;  1MDJ A;  1TRS A;  3BCI A;  4MZC A;  4GQC A;  1TOF A;  1EEJ A;  3DD3 A;  2M46 A;  2VKZ G;  3LJR A;  5JCU A;  2DC5 A;  3G7I A;  3P8W A;  3UBL A;  4XHM A;  3ZML A;  2VL2 A;  4G0K A;  3Q19 A;  4Q5Q A;  2PGT A;  3BOA A;  5D93 A;  4QMK A;  1MTC A;  1ZOF A;  3NOF A;  3M9J A;  4TRX A;  3HVV A;  5H5R A;  1EEM A;  3DYR A;  1N25 A;  2HSH A;  4JZQ A;  3U5R E;  4AKX B;  3KGK A;  3M1G A;  2CAQ A;  2F3M A;  5CP1 A;  5A1N B;  2GZZ A;  3FYG A;  4CY8 A;  3TOT A;  1GSD A;  4ICY A;  4BVY A;  3GNJ A;  5IIZ A;  2WFC A;  3UVH A;  5GAN D;  4TR4 A;  3GIX A;  5JCG A;  3DWV A;  1ACV A;  3G9B A;  17GS A;  4AJ7 A;  1XZO A;  4KDU A;  2REM A;  5HQP A;  2FNO A;  4MCU A;  2BTO T;  1AQV A;  1A0F A;  2B7K A;  2L4C A;  2HSM A;  4YQM A;  4ZL9 A;  5AIV A;  3WGD A;  3F8U A;  2V6K A;  1O73 A;  1G6Y A;  2FA8 A;  3KIJ A;  3TOU A;  3GUR A;  1TK0 B;  4MZW A;  2V6O A;  5AIS A;  2PU9 C;  5HR1 A;  1KEB A;  3CYN A;  3RDW A;  3TKS C;  4O32 A;  1K0M A;  1TTZ A;  5KOX A;  2V1M A;  1XW6 A;  3WT2 A;  4KH7 A;  4ZL8 A;  4HOJ A;  5D73 A;  1E2Y A;  1GUL A;  3F6D A;  1TDI A;  3MWH A;  1IYH A;  2VLU A;  2YV7 A;  3IDV A;  4AF2 A;  3FR9 A;  3HA9 A;  4TR1 A;  4LMW A;  2HXK A;  4BVY B;  5ECQ B;  4WF5 A;  1F3B A;  2HNL A;  2H66 A;  3GST A;  6GSX A;  5ECH B;  3KM6 A;  3KD0 A;  3UMA A;  2LRT A;  4GST A;  1A2L A;  5IOX A;  1GTA A;  1GUM A;  3GHA A;  3IV4 A;  8GSS A;  2AYT A;  4MF5 A;  5INY A;  1SL1 B;  2YN1 A;  2QA1 A;  2N5B A;  1OC3 A;  1A0R P;  4DEJ A;  2R0G A;  1ABA A;  3I9V 2;  1T8E B;  2HSM B;  2OAC A;  3ZMK A;  3TJF A;  2LRN A;  1BG5 A;  2NPB A;  3J7Y k;  1JLV A;  2EFD A;  5DAL A;  2PMT A;  2D2Z A;  4MPF A;  3Q18 A;  3WD6 A;  2B1L A;  10GS A;  4X1U A;  4GXZ A;  1DE2 A;  1JZD A;  1OC8 A;  4FYU A;  2M72 A;  1GTB A;  3Q6O A;  5CO3 A;  3CRU A;  5G5E A;  1JHB A;  2V2G A;  3NIV A;  4XRD A;  3UEM A;  2HQT A;  5IMZ A;  3EU3 A;  3KMO A;  4I2T A;  3EIN A;  3HYP A;  1ZYE A;  2EFC A;  1GL8 A;  5G5F A;  5DAK A;  5GSS A;  3KTB A;  1WP0 A;  2GQM A;  4TR1 B;  2PUK C;  4TR0 A;  1K3L A;  5JCW A;  4O92 A;  2EC4 A;  2JAC A;  2R0P A;  1SYR A;  2A2R A;  2DKI A;  5DVB A;  4P3Y B;  2QGV A;  2H72 A;  4KA0 A;  3E3E A;  1TI3 A;  1M2A A;  1OVN A;  3APO A;  2E7P A;  1Z5Y E;  1FO5 A;  2NDO A;  4H86 A;  4ECJ A;  2QA2 A;  1YKC A;  1DSB A;  3TB2 A;  2IJY A;  2GDR A;  2VM2 A;  2IME A;  3HD5 A;  5ELG A;  5DAL B;  2FD3 A;  1TRV A;  2B5Y A;  2VCZ A;  1K0N A;  1AC1 A;  5KEJ A;  2CAI A;  5IO0 A;  1UC7 A;  2R4V A;  2H1A A;  1AUC A;  3IRA A;  1O6J A;  2GSR A;  1SL2 B;  2DLX A;  2R37 A;  2YOI A;  1T1V A;  2GS3 A;  2KLX A;  2B5E A;  4KF9 A;  3IC8 A;  1SD8 A;  2OT3 A;  4HEA 2;  4PQI A;  4K7O A;  4PQ1 A;  5IQY A;  3QR6 A;  3RHB A;  1PSQ A;  3Q74 A;  5DAK B;  3ZFB A;  3OR5 A;  2VOC A;  3V1W A;  3ISO A;  4PGT A;  4EIQ A;  5G1L A;  6GSY A;  1SK0 A;  1EV9 A;  3LSZ A;  3GKN A;  1TKD B;  2E2G A;  2O87 A;  4WBJ A;  1A24 A;  5A4W A;  1ZCP A;  2JSZ A;  4RI6 A;  2O8V B;  2RM6 A;  5F05 A;  4ZIJ A;  4PUA A;  4X0X A;  4XS6 A;  2WZ9 A;  4MJC A;  4KCA A;  2G0F A;  3TKR A;  4WF4 A;  2YWI A;  1RW1 A;  1JZO A;  2EIR A;  1FB6 A;  4HJ2 A;  3P2A A;  1Z6M A;  2CX4 A;  3LEF A;  2HZF A;  3TUE A;  4NHZ A;  18GS A;  4RI7 A;  1TU8 A;  2DJ3 A;  3APS A;  3H4K A;  2H8L A;  2B6M A;  2JAD A;  4I5Q A;  3C73 A;  5HFI A;  3UOM A;  4ECI A;  4HUA A;  3ZFL A;  2R6K A;  2PBJ A;  2DJK A;  1GSU A;  4L5L A;  4V2N A;  4G2E A;  2PVO C;  5D9T A;  4JR4 A;  2LNT A;  3EVI A;  3LG6 A;  5IOW A;  1ZYN A;  3WGX A;  1KBN A;  3DIE A;  3ERG A;  2MYG A;  3QPM A;  1A23 A;  2C0E A;  9GSS A;  2CVD A;  2DSA A;  2PWJ A;  4YQV A;  5DCG A;  5BRT A;  1B48 A;  4K2X A;  2A2P A;  4PQH A;  5G2Z A;  3GV1 A;  1F9M A;  5HR2 A;  5DQY A;  3GL5 A;  1M7T A;  1NW2 A;  2LTK A;  2H0I A;  5D8I A;  3DML A;  4EDY A;  5KN3 A;  4V2L A;  1EGR A;  4G0I A;  3VWW A;  2NBS A;  5J4V A;  1W89 A;  2IMF A;  1T00 A;  1EP8 A;  3UAR A;  3W8J A;  1THX A;  1YEP A;  1CQH A;  1T4Z A;  2VL2 C;  2ON7 A;  1XWB A;  4IP6 A;  5DBQ A;  3MDK A;  5CNW A;  2YZH A;  4PXO A;  1S3A A;  2EFH A;  3TU3 B;  3F4T A;  2K9F A;  1YZX A;  4TXO B;  5J47 A;  3F3Q A;  2VCV A;  1UN2 A;  2YJ7 A;  3C71 A;  4ZBD A;  4BL7 A;  4ID0 A;  2DJ0 A;  3HMJ G;  4GQF A;  4OFM A;  2H1B A;  1PA3 A;  4BVX A;  2DBC A;  5KN2 A;  3WGE A;  4DSQ A;  4HU9 A;  4EUY A;  4IHU A;  3M3M A;  2OE3 A;  1V58 A;  3TGZ A;  2R2J A;  5ENU A;  3ERW A;  2GZY A;  3IAS 2;  3IBH A;  1YKA A;  4XIH A;  3LXZ A;  2WRT A;  2MMN A;  3ZRD A;  2IWT A;  2E2M A;  2XHF A;  1XWK A;  3WYW A;  3IR4 A;  2V32 A;  1U88 A;  1U87 A;  5G1K A;  3IAM 2;  2BJX A;  1M2D A;  2O5V A;  2ON5 A;  1XCC A;  4TR3 A;  3GA4 A;  4I97 A;  2O85 A;  5A4U A;  2K8V A;  1THO A;  4NV5 A;  1SJI A;  4JE1 A;  4OO5 A;  1VGL A;  2QSI A;  3LFL A;  3J7Y b;  4ULX A;  4IQA A;  5IPG A;  1ZZY A;  2GQK A;  4XRA A;  2KUC A;  5J40 A;  1K0B A;  5ECS A;  1K3Y A;  2JL4 A;  4N0Z A;  2HLS A;  4KDX A;  3EUR A;  3FZ4 A;  5DCH A;  5F0G A;  2C0D A;  3RBT A;  2IIY A;  2L59 A;  1OAZ A;  1IYI A;  2G2Q A;  3CTF A;  5F07 A;  3TJG A;  3CMI A;  4IGJ A;  1M0U A;  4WET A;  2CQ9 A;  1BQ7 A;  4RQR A;  4O5Q A;  4BL7 B;  1G7E A;  3F3R A;  1QUW A;  1A2J A;  3GUS A;  5H5S A;  4MMM A;  4BVX B;  2LUS A;  1BYE A;  3EWL A;  4JRR A;  3GX0 A;  2AHE A;  1QXH A;  2KHP A;  4BWS A;  4MJA A;  2CZ2 A;  3QDN A;  2YZU A;  3DKS A;  3BCK A;  2H30 A;  3HDC A;  1GTI A;  3TCO A;  1RK4 A;  3UJ1 A;  2JSY A;  1J0F A;  4YAP A;  1PX7 A;  3ZLP A;  4PTS A;  3DGQ A;  1FVJ A;  3D21 A;  2XBQ A;  3BD2 A;  1J9B A;  4OFT A;  3TJJ A;  3A3T A;  1V2A A;  2LS5 A;  1M9A A;  2X8G A;  3GTU A;  5KOW A;  1ZMA A;  3GKK A;  4K9Z A;  3RPN A;  2QC7 A;  2AV4 A;  3EYT A;  2NVL A;  2LQQ A;  5D9W A;  2C80 A;  2GTU A;  4AKI A;  16GS A;  3R3E A;  1TK5 B;  4KSO A;  2HT9 A;  3D22 A;  2HRF A;  2CT6 A;  1R5A A;  2KP2 A;  4EVM A;  2MBS A;  2X99 A;  4YQU A;  4HQZ A;  6GSW A;  3PIN A;  3L0H A;  3L9S A;  2YV9 A;  1F3A A;  3F0I A;  1QMV A;  1HYU A;  5ECI B;  3F9U A;  13GS A;  3IHG A;  2FA4 A;  1DE1 A;  2I1U A;  2C3N A;  5ABR A;  2LNS A;  4D73 A;  5F06 A;  4PUF C;  1EOG A;  1YJ6 A;  4PNG A;  3I69 A;  5KN1 A;  4KW6 A;  2X64 A;  1PQN A;  4NPB A;  3SWL A;  2AAW A;  3S9F A;  4DSR A;  3UAP A;  5ECM B;  1PGT A;  4CDO A;  1ZYP A;  3TKQ A;  3U6V A;  4O5R A;  2HSY A;  3LWA A;  4OFN A;  5D9V A;  5A4V A;  1TK8 B;  4K1F A;  2IMI A;  2YCD A;  1O7U A;  2YPM A;  3E0U A;  4ML6 A;  3A5W A;  3GTU B;  3KCM A;  2PER A;  3ZIV A;  3IXR A;  1PL1 A;  4ACS A;  3HZ8 A;  1G7O A;  5J3R A;  5J4U A;  3VPQ A;  2HZE A;  3SBC A;  3LYP A;  4I6X A;  2CA8 A;  5J4Y A;  3O76 A;  3FZ9 A;  5AGY A;  4N0V A;  3QAV A;  3P7X A;  2H6Z A;  4JU5 A;  3R2Q A;  1HNA A;  1JFU A;  6GSS A;  4TXV A;  1YVL A;  2I9H A;  4LL1 B;  2YP6 A;  3BBY A;  4AI6 A;  2X49 A;  3HXS A;  2YNX A;  3TRP A;  4D73 B;  4POB A;  1R26 A;  2F51 A;  1UVZ A;  5EVO A;  1O81 A;  3IOS A;  1JLW A;  4F9Z A;  1K3O A;  4TN8 A;  3HJO A;  5E4W A;  1HD2 A;  2OA7 A;  1TI1 A;  2XBI A;  1EWX A;  3TDG A;  2XPD A;  1TP9 A;  4XS4 A;  4J57 E;  4Q5N A;  3IA1 A;  1WOU A;  4MZB A;  1XWA A;  2HYX A;  4XS1 A;  4IP1 A;  2FHE A;  2A4V A;  3KXO A;  2HI7 A;  3QFB C;  4EDZ A;  4ISD A;  1KNG A;  2UZ8 A;  3UBK A;  2ALB A;  2M80 A;  4K7I A;  1WRY A;  2KP1 A;  3DRN A;  1ZL9 A;  4MP4 A;  1M9B A;  1AXD A;  4HZ2 A;  2ZNM A;  3IK7 A;  3D6I A;  5LCZ A;  3ED3 A;  1S3C A;  2HZE B;  2YWM A;  4RUV A;  3LW9 A;  4LA1 A;  4ML1 A;  1PL2 A;  1ERU A;  3GYK A;  4ZL7 A;  4AJ6 A;  3KP9 A;  2VD1 A;  1E6B A;  3C8E A;  3CXG A;  4PNF A;  2OKA A;  3LOR A;  1GNE A;  2P0G A;  4K5S A;  4EXJ A;  5E59 A;  2LST A;  2I3Y A;  3KTL A;  2MMO A;  4Z2U A;  4NV2 A;  2R5G A;  5D9X A;  2TRC P;  1MEK A;  3D0Z A;  5FWG A;  1XW9 A;  4XS4 B;  4JBB A;  2IL3 A;  4MDC A;  4OO4 A;  1U3I A;  2H6X A;  1WE0 A;  2L5O A;  4KGI A;  4IJI A;  2Z9S A;  2F8F A;  4PX1 A;  2DJ2 A;  2PVQ A;  2VLV A;  1X9S B;  2A4H A;  3TJB A;  4O7H A;  3M8N A;  2VCW A;  1PN0 A;  2MMZ A;  4RQX A;  3LQ7 A;  2B1K A;  2HSN A;  2VD0 A;  2C0F A;  3QD9 A;  2GLR A;  2VO4 A;  5ECO B;  2F8A A;  2TIR A;  3GMF A;  5IMA A;  2YJH A;  4MPG A;  2DML A;  4Z2T A;  2X8H A;  1GRX A;  1M2B A;  4KX4 A;  1N8J A;  2FGX A;  3W8S A;  3VI5 A;  1SVM A;  1UA5 A;  2FY6 A;  3ZYW A;  3C1S A;  4W66 A;  2R0C A;  2VL3 A;  4POL A;  2YWN A;  4USS A;  6GSU A;  3DVW A;  5DJL A;  1WJK A;  1EP7 A;  2CZ3 A;  4WEY A;  1OKT A;  5ID2 A;  5EPF A;  4F2I A;  5HR0 A;  3G7Y A;  3L78 A;  20GS A;  5CAX A;  4CY6 A;  1NM3 A;  4IEL A;  3ERF A;  5IMD A;  4MF6 A;  5D96 A;  4EIP A;  2H6Y A;  3VK9 A;  4DSS A;  6GSV A;  2CVK A;  3L9U A;  1GWC A;  2WDU A;  5B6N A;  1SKS B;  3KZQ A;  4LL4 B;  1SYX A;  2C8U A;  3AY8 A;  1X9M B;  1TXU A;  4JR6 A;  5AIX A;  4K2D A;  5B8B A;  1SKW B;  3CRT A;  3VLN A;  3A2V A;  2YAN A;  1WWJ A;  2LEG A;  4BWQ A;  1NSW A;  3US3 A;  4ECB A;  1YF1 A;  2HSN B;  4Q5R A;  1SEN A;  3QCP A;  1GP1 A;  14GS A;  2JU5 A;  2B5X A;  2LKU A;  3TKS E;  4KB3 A;  1FVK A;  3IC4 A;  5COH A;  5LNK e;  5J9C A;  2P5Q A;  1GSE A;  3TRQ A;  4E8H A;  2H19 A;  1FHE A;  4GLT A;  1PRX A;  2N5F A;  4MLY A;  5FHI A;  1A2M A;  3D4T A;  2H1G A;  4YAV A;  2EIQ A;  3HVX A;  1YQ1 A;  3HZ4 A;  5IMF A;  3FK8 A;  3HJM A;  2GZP A;  5JWQ B;  1J08 A;  3MNG A;  4EF0 A;  1ILO A;  2O7K A;  1TW9 A;  4HZ4 A;  5J9B A;  4QL7 A;  3F6F A;  2WB9 A;  5ID2 B;  1ERV A;  2GQL A;  3FEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...