2FHJA

Crystal structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
296
structure length
296
Chain Sequence
MEINGVEIEDTFAEAFEAKMARVLITAASHKWAMIAVKEATGFGTSVIMCPAEAGIDCGYVPPEETPDGRPGVTIMIGHNDEDELKEQLLDRIGQCVMTAPTASAFDAMPEAEKEDEDRVGYKLSFFGDGYQEEDELDGRKVWKIPVVEGEFIVEDSFGITTGVAGGNFYIMAESQPAGLQAAEAAVDAIKGVEGAYAPFPGGIVASASKVGSKQYDFLPASTNDAYCPTVEDNELPEGVKCVYEIVINGLNEEAVKEAMRVGIEAACQQPGVVKISAGNFGGKLGQYEIHLHDLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formylmethanofuran--tetrahydromethanopterin formyltransferas
publication title The structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
pubmed doi rcsb
source organism Methanopyrus kandleri
molecule tags Transferase
total genus 77
structure length 296
sequence length 296
chains with identical sequence B, C
ec nomenclature ec 2.3.1.101: Formylmethanofuran--tetrahydromethanopterin N-formyltransferase.
pdb deposition date 2005-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01913 FTR Formylmethanofuran-tetrahydromethanopterin formyltransferase
A PF02741 FTR_C FTR, proximal lobe
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhjA02
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhjA01
2FHJD 1M5HA 1FTRA 2FHKA 2FHJA 1M5SA
chains in the Genus database with same CATH superfamily
1K1QA 1N5YA 4NMXA 2Q1LA 3IM8A 2QSWA 1VK3A 1YRXA 1WEXA 2IBOA 4G6VB 1JNZB 5JVGQ 3NBPA 2LEPA 2QTWA 2HZAA 4MKYA 2FGCA 1SC4B 1IR0A 2MMYA 2DB1A 4JV5J 2CADA 1EZZB 5GMDA 4DL7A 4C98A 1Q16B 4YDXA 3MM6A 2CJBA 3CCZA 3MEGB 1S9GA 4DL5A 3JSBA 4NLVA 3W3SA 4O3RA 3IWNC 4CZCA 1SJ1A 4WU3A 3X3UA 3CC7S 4OI2A 1HNIA 5J2PB 2IBKA 1L3UA 4NWBA 3ZZ0A 1Q8LA 5F0UA 5IQ6A 2QA1A 2W8KA 3OSNA 2CVEA 1LV5A 1YDLA 4KFBA 3L7OA 1H98A 1WORA 3R6LB 4A8FA 4E8UA 3D1HA 4B3RF 1TU0B 1SB6A 4NI2B 2HRYA 4AE5A 4KKOB 4HH1A 3TVYA 2DH8A 2AGOA 2NYHA 3DLEA 5A0YB 3MDFA 1Q5YA 1PC4A 5CXTA 2WZ1A 1RT2B 2HNZA 1U0SA 2PMZD 2BR0A 1FDDA 1DRZA 2R42A 4CNYA 4D3HA 4M5NA 2NUHA 5ETTA 4ZPDA 4LF4J 3I4HX 2R7RA 4EEYA 1N4LA 2NXEA 3T5HA 3UD5A 3VF0B 2ZZTA 2RJZA 2A6OA 4A8XA 1ZBTA 3W9JA 2QLBB 4KSEB 2B5JA 2GC8A 2GAHC 1KHWA 2FLNA 1XMQF 5A8WB 2LXUA 3CDWA 1NJXA 3OUYB 1UJ4A 3R6GB 2ZNZA 4ZN1A 2D3ZA 2CZ4A 2D7SA 4ID5B 4P74A 1RZMA 4CT9A 5AE2A 3GJTB 3ZO7A 1RAIB 1X4CA 1RWWB 2GZOA 2MZ1A 1RT3A 4D3GA 3MOJB 3IS9B 2R8IA 1VIOA 1TKZB 2GAGC 1RHQB 4A8YA 2QGFB 4J9RA 4H4MA 4MFBB 1V3SA 2IY5B 3M32B 1FKPA 2CQHA 3GYNA 5KTQA 3NGUA 2UUBJ 2C2DA 1NPRA 4P71A 1X5TA 1R8BA 3CJ2A 4DN0A 2BE2A 4ELTA 3DLKA 1Y4ZB 5HSPA 3POTB 4CLZA 4DSJA 1JLQB 2HS4A 3OW2R 2ILYA 5C2GA 3HHDA 1DURA 1YJVA 2CPJA 1Q82T 1GNKA 3BO4A 3T9ZA 4CYUA 1FJGF 4PYAA 3NG8A 2XYHB 4B9MA 3M2UA 2AW0A 4KYZA 4RBUA 2CA9A 5SZTA 1VGYA 3FEYB 1SH2A 5CYJA 4KTQA 4LIRA 2WVBA 4I2QB 4IRDA 4ANEA 2XZTB 3I56S 3M8QB 4WZMA 2O5DA 4JI2J 5KT7A 5EDWA 3FSIA 5HVGA 2ROPA 3SMZA 3KK3A 4K5RA 2HWHA 1UEUA 5K8OA 1M5HA 4Q0BA 4LMZA 2PDAA 1REVA 3CJ3A 3NNHA 1S6QA 4WFNQ 5DQGA 4USHA 2BYCA 3BR9A 4B9LA 1R6YA 2HHSA 2G0JA 1K8AT 1HI0P 4KBIA 4EGLA 1FWKA 4QWEA 3BN7A 2VONA 3C14A 2R7QA 3RR8A 2J0XA 3Q2SC 5CYQB 3K59A 5CHCB 5DDQC 3VCDA 3IG1A 1HIYA 2HGMA 4W92B 2W4DA 3BPDA 1VRTA 1KOHA 2ZBRA 2F8HA 5G0RA 1QUPA 2CJ9A 2VASA 1V5IB 4LJMA 1RBLA 4QWDA 2QMUB 3O5TB 4TU8A 3HJVA 3KLHA 3TVKA 1V5VA 2M88A 2GVZA 4ECWA 3CNQP 2XULA 1LEOA 5K8PA 2CJQA 5LOQA 2WVDA 4WWSA 1FK9A 4LT6A 4DV6F 1S1TB 4AD6A 4ECRA 2IRXA 2XWXA 3UN2A 2HKEA 2UVUA 3LO3A 2KXHA 4TVAB 3EDRB 2XMTA 2BDPA 2DIVA 3FJ2A 1HQEA 2E5LJ 1I5OB 1T95A 4QIEA 1NHKL 3GG1A 5JMNA 1MG7A 1V3ZA 2KFYA 2ADCA 4WF9Q 3QGIA 3DOMA 4EBDA 1BQNA 2KHCA 4KGZB 3VQSA 2ZH4A 1NU4A 3QSIA 1UFKA 1U47A 5FDLA 4I7FA 1M5VC 3Q0AA 3TUJC 3U02A 4J9VA 4PUOA 4DCOB 5DO2A 2PMHA 5CCMA 1RU1A 1KDNA 4WYWA 4ECUA 1OY6A 2KYZA 3ZTPA 2NREA 3SCKE 4E2FB 3BGRA 3MMCA 4WXOA 4RBVA 5IC6B 2PGCA 5DM6Q 1S10A 4RU9A 1ZTTA 4HDGA 2H48B 3DOKB 5A2QU 4P2FA 3DHWC 2ZUAA 4DPTA 2DNMA 1OJ4A 2ROEA 2WOMA 2QA4G 3EZOA 3ZTRA 2BANA 4G1IA 1Y3KA 2CJKA 2MY8A 4DN9A 2LA4A 1LK5A 2CQCA 1CS4A 2RDIA 2ZJPQ 2QLFB 4ZJLA 2VG5A 2H51B 2LXFA 3B4MA 4DR1J 5IFMA 4YB7A 2Q3PA 3PFOA 3LF0A 3IXQA 2XWYA 4HR2A 5C24B 1XERA 2EK1A 2UXBJ 3IA0A 1W25A 1VBXA 1IR1A 4U7CA 5JUMA 5LJ5Y 4BCAA 4X66J 2XSJA 5A76A 4DQRA 4O4RA 4QW8A 3H2UB 5GAHI 3LGHA 5HANA 3ILLA 4ED5A 1TK0A 4DS4A 2XHCA 3SSQA 1G2EA 3BM7A 2MPUA 1T94A 2CPEA 3PY8A 3ET6B 4DSFA 3C16B 4Q45A 1Q8KA 3VGSA 2CZVC 3H20A 4FKYA 3DMJA 1ZA1B 1FD2A 1EKRA 3LTOA 1S7IA 1OY9A 4OYPA 4NRUA 1MMLA 4DPUA 4OFZA 4KHPF 3NAIA 1N36J 2V8DA 3MEKA 2UUWA 5M2UA 1N88A 2EC2A 3QIPB 4F3MA 4JI5J 4CTAB 1IKXB 5EHHA 3Q2TC 4LF5J 1VQLS 3DRPA 2VZ9A 1SKSA 1ELOA 1U6BA 1AT1B 1BC6A 1QTNB 2RUGA 2YY3A 2VICA 1G1XA 3BBFA 1WEYA 2QX0A 1I6JA 2R8KA 3GSIA 1FRMA 4JI0J 4K59A 2J0SD 4WPAA 3KTQA 2OMOA 1SJQA 1S4FA 1RWXB 1SCJB 3G8TA 3RBZA 3ZZPA 1RAJA 1JJHA 2ZUGA 2KVIA 1PAUB 2XBPA 5FD1A 1WG5A 1U49A 2J7WA 4DR4F 3T1AA 5KT3A 4F4KA 4UY85 1RDRA 4NCGB 1OMSA 4ED6A 3CD0A 3FBEA 3PRBA 1FI4A 4CNZA 3T1HF 4WBFA 2MEWA 4RWXA 2DGQA 3W66A 3CCVS 3LWMA 2V67A 1QDUB 4M95A 1LWEB 3PYFA 3R5GA 3IR7B 1PGZA 1QLNA 4FXDA 3VV2B 1BD6A 2VV5A 3M6WA 1HI1A 4RNMA 3NAHA 1P8GA 2KXFA 3I32A 5D0HA 4GVBA 3P6YC 4LF7F 3MPDA 4JI6F 2LU1A 4WU2A 3BQ1A 4NCBA 4WKYA 1F9EB 3B4DA 4P9SA 2ZOMA 3N9UC 3IGNA 2CUYA 3KJVB 4B3SJ 1OYEA 2KG0A 3QJLA 4HHHA 3FUYA 2FB0A 1FEEA 2E7WA 2PN6A 3GJSB 2L9DA 4UZBA 2LP4A 1QVFR 1NK6A 2JEFA 2V9WA 4QWCA 2OMLA 3MGJA 3IBFB 3QRQA 2J7KA 3TJ8A 1C1CB 4NLDA 1SJRA 1OO0B 3F41A 4K4SA 2VFUA 4J9PA 1Q0NA 1Q1KA 2IAJA 3BSNA 1XNRF 4X4OA 4ICLA 1TUVA 2X1GA 2ATLA 1WC3A 4OI6A 5H9FJ 3N01A 4HDHA 4A8KA 1SC6A 1NRKA 4L3NA 1R8CA 2BMBA 1SJ3P 5T14A 3S6EA 1PO6A 3MTJA 1IKWA 2RIJA 2C28A 4OHYA 2FTRA 3H90A 1DLOB 3CDEA 3LW5C 1RB0A 3M8ZA 1BHNA 1WD6A 2YNGA 4GO7X 2QV6A 3R1HA 2X51A 2V0NA 3HSJA 1SC3B 3J81j 1JLFB 2AJ2A 5HL7Q 2DGTA 4G1PA 4ITSA 4PZVA 3J81U 2CPDA 1JK9B 2MKHA 1PYTA 3CT9A 1ZM9A 2AZ3A 2V4QA 3GIKA 3GV8B 1KONA 2GA7A 2BVZA 3NCPA 3G2XA 4RBTA 3FQLA 1FCAA 1N34F 4J7CA 5EGYA 1UEKA 2YNHB 3UDCA 4DV7F 4L3KA 3ENWA 2UUTA 4WE1B 2VA2A 2J7UA 3MPWA 2W7AA 1LW2B 3KLGB 2W1BA 1S6UA 1N6QA 2RH3A 3QIDA 2GGPA 4C8KA 2HG4A 4B02A 1YQHA 2Q6BA 1TV6B 2GNKA 2BJEA 2IRUA 2B43A 3BPSP 1PKUA 4JI7J 3DKDA 4X64F 4AFFA 1UVIA 5C42B 1EB0A 2HQCA 3WZ0A 1CJVB 1GH8A 3N5FA 3VAHA 5J1NA 4NOHA 4DS5A 3OTEA 4PWDB 1T05A 3DRSA 4O3OA 1S79A 4PEOA 3H5YA 2M9KA 4YHHJ 3T5KA 2DPJA 2LQ9A 2RUSA 2W8LA 1QSLA 2EC0A 4WFAQ 3CCSS 3NXZA 2DNZA 4C11A 1HD1A 4CT8A 1WF0A 1SVDA 4I56A 1YRUA 4DPXA 2KVQE 4QWBA 4X84A 3DGPB 1U1MA 1V9OA 4LSNA 3ETMA 3AOAA 1X31C 4IR1A 1XC9A 1YJ7A 2LMIA 3P8BB 2VIHA 3MM5B 1Q95G 1FT8A 1P9QC 3PW5A 1NKCA 3ZZYA 1A0OB 2J9EA 3G82B 2WW8A 4XDDA 4U6PA 1JJCB 3HVRA 3W7BA 3TA0A 2G4BA 2AEMA 1X9WA 3W2VA 1TMJA 3UCGA 2YX7A 2BOPA 3JS9A 3HCXA 4CO2A 2QYCA 4LR7A 2V69A 1WI6A 4JI3F 4Q44A 1RCOB 3GPAA 2ASYA 1FRKA 1S1WA 2ZH1A 1E6VB 2RKIB 1S9EB 1IKYA 2VJUA 1RHRB 2CDQA 3M2RA 5J2QA 1FXRA 5D77A 3K5NA 2W2QP 5ETMA 3BKFA 3J7YU 5T7LA 4RR5A 3UFCX 3TAMB 1PILA 5DJBA 4C8LA 3LQVA 2IRYA 4P6QA 1AZSB 5DG8A 2Y1LB 1ZM3A 3SV3A 4QIGA 1IJFB 4K8RA 4P72A 2XGPA 3H7HB 2MKYA 5L38A 4KHMA 1RTIB 1F9HA 1WOPA 2AT1B 2M0GB 4ECVA 1VHIA 2CXEA 1SJFA 4LF9J 2QLXA 4LBPA 1TL4A 2IMOA 2FVSA 2IYIA 4OI0A 1MWQA 3RB0A 4GRSA 4HHJA 2H4YB 5DRKA 1QAJA 1N33F 4GKJF 2VG6A 2B6AA 4RW7B 5GVQA 2JNJA 5D4OA 2R7XA 4NLSA 2E9TA 2DNNA 3T5JA 1B64A 4KRWA 4QW9A 2AYEA 4A8SA 3PZPA 1KRPA 4YB5A 3IFEA 2MKIA 4XO0A 3CO0P 1RAHB 2CWKA 4ZS6A 2X1BA 4DFMA 1Q81T 3DCAA 2VKZG 1WC5A 1FESA 3V6DB 2F4FA 5GAEI 1C1BA 2DNHA 2OH2A 3K89A 1HQUA 3R5CA 1PJ5A 4XAKA 3EJMA 5HBMB 2ZHBA 2BJ1A 4P75A 2VC0A 3FBCA 3CC4S 2L08A 3UI3A 2VHGA 2JRSA 2ALZA 4ANDA 1FE4A 2QA4S 2H5EA 3ITHA 3MEDB 3VTIA 3K7RA 1KFDA 4IG0B 4USWA 4YY3F 4TQSA 2D9OA 4XDCA 2NYIA 1S5ZA 2B9EA 2B9YA 3MUTP 3AQPA 3UVJB 2XZDB 3OR1B 1HWKA 3NCQA 4AUKA 3C6TA 5G4DA 1S4EA 2XHWA 4PYDA 2E7XA 1DTTB 4O3PA 3LPYA 4FPIA 2KHDA 1OSDA 2XMWA 4LFAF 2R4FA 2NPFA 4DV3F 3T1HJ 4Y0FA 2R7UA 3MXHP 2VBYA 3V4IA 1FKAF 4V19J 3B82A 4JI4F 3HSZA 1NKEA 3PKMA 1RAOA 3MCSA 1NDKA 1YLXA 3BF4A 1VLOA 4OHWA 4C4WA 2YKMA 1GFWB 3KK1A 2IM3A 3T1YJ 4LRFA 2DO4A 1C0UB 3KMQA 1H0HB 5IV3A 1F6TA 3VGUA 4NXNJ 4X65F 3M6VA 4LVNP 1JB0C 3EWGA 2OGUA 2DKOB 1IKVA 1N5QA 5GAGI 3FFIA 1YK9A 4EZ9A 4WXWA 2VFVA 1IWGA 5D4NA 5L46A 2O3DA 2DBBA 1XR6A 2D69A 3JQMA 3M9MB 3CJTA 5LMNF 3ILJA 1S57A 3FMBA 3HO1A 3NLCA 4YQWA 1RBAA 2QZ8A 1ZETA 4JYAF 3QT5A 2KT2A 3D4JA 1NSQA 4ILLA 2V9KA 3MR5A 1B70B 1PAEX 4DL2A 4RUHA 1HL6A 5L39A 3R7SB 3O1LA 5BYSA 1S1UA 1JLBA 1JXEA 1OY8A 2YH0A 1W26A 1FXDA 4BDPA 2X1AA 2RQ4A 5KFBA 3BYPA 3GSDA 2IVFB 4L73A 1Q53A 2D74B 1Q8BA 2WBMA 1N5YB 1R89A 3FVYA 3WC0A 4DDFA 2OEMA 1VI7A 4ZVHA 3QYYA 3NBPB 5DGBA 3B6BA 2E44A 2OFHX 4IYQA 2GCFA 1NK9A 4TXSA 2RDDA 2OD6A 4S0MA 4DOZA 1QUVA 5B0GA 2HHVA 3MM6B 4KT0C 1S9GB 4JV1A 4DV5F 2NZCA 3M8SA 2QL9B 3MI7X 3TZYA 3AD9C 5KFGA 1RKJA 1LWXA 3QQCD 1HNIB 1WDDA 3MF5A 1MU2A 2RQKA 3W64A 4OYIA 1ITPA 1H38A 3DI6A 5E2QA 4KFBB 2PI5A 4OX6A 2ZJQQ 3ICLA 1DY3A 5K8MA 4UOFA 1M5KC 1Y5NB 2AEFA 5DZ6A 5KFWA 1HNXF 3EGZA 1NO8A 4FKXA 2DNGA 3DLEB 4DI6A 1EX8A 1KNZA 1FDAA 3QPIA 2A6MA 4L75A 2HNZB 3S1TA 4NYPA 4NLRA 3W8GA 4Q43A 5E3CA 1M5SA 4BLGA 2HFZA 2ZVIA 5KFCA 3VQTA 1REGX 2JSXA 2HBZB 5F9NA 1S77D 2HHQA 2F4VJ 5KFPA 1R31A 4PPZA 5GMKa 2V68A 2WB4A 4FYWB 3UDLA 1NJIT 2ZOFA 2VB6A 3LGNA 3N6LA 1XMOJ 2BRKA 4OYOA 4V1Ak 1KQFB 2CPHA 3CO9A 1OSCA 2EBEA 3FRZA 4MAKA 1XJWB 2K3KA 1L5UA 3D7SB 2ZC4A 1F5CA 1SJ4P 4AXJA 1XBWA 2KM8B 4A8OA 4G65A 2RHSB 1FDBA 1RT3B 4JV2A 4NLYA 3MR2A 1HFEL 4IG3B 1JMTA 3EX7B 3TRGA 1FA0A 3GFYA 5LSRA 3DLBA 2ZVSA 4H4MB 2FJBB 4X4RA 4PWUA 3PX4A 2HURA 3CEDA 2MQNA 2UVRA 1FKPB 2NR0A 1PJ7A 4LREA 3M8YA 3QT8A 4DQPA 2H65B 1UL3A 1WOOA 2K7KA 1X4FA 4PXCA 5J2NA 3DLKB 1D9AA 2XG8A 3BYRA 1MW7A 4OLPA 4XPCA 4NASA 3PACA 1HBNA 3THPA 5HQLA 1HR0J 2JEJA 3DDKA 1CC7A 4O23A 2MQPA 4QPXA 2N7YA 4PG4A 4CYUB 1NSKL 4USMA 1TQLA 2W9BA 3FK4A 4CO3A 3M2UB 4NCAA 3MM7A 2BQRA 4B3MJ 5HMZA 4KC5A 1CQMA 3VAGA 2LQBA 4F04B 4E98A 2EI5A 2OPRA 2JJ4D 1KN6A 2K7JA 4AL6A 2QE5A 2IDLA 4R8UA 3DLHA 5DDPC 2ZDPA 4QR0A 5ETKA 4NZ0A 4ES2A 3KK3B 1AYEA 3GG0A 1Q4RA 9ATCB 2VA3A 2O67A 1UVNA 4Q0BB 2WVFA 5LMUJ 1IBCB 1REVB 1ZM4A 4XPEA 3Q8VA 4CLLA 4QYZJ 4ZHRB 3PEJA 2RNEA 1EJ7L 2WSEC 4K0KJ 1YRTA 3SQOP 3BZQA 2IIHA 3OQ2A 1PBAA 4MT1A 3C14B 2CPFA 5HROA 2UUCF 4WFBQ 1KS2A 2I9SA 1KSPA 2GVDA 1QSSA 1CVJA 5CZXA 3O44A 2XLKA 4ED1A 1WG4A 2H54B 2IJFA 2EG1A 3D3BJ 4Y65A 3ZZTA 1VRTB 5K14A 2K8GA 4DV0J 2FYXA 1Z4UA 3K5LA 2L9WA 5G0RB 2V4RA 1RSCA 4B3TF 4F36A 3LAKA 1RAGB 2C2NA 3KLHB 2GVZB 2K06A 1X4GA 1Y5IB 2ATCB 2ZM6F 1FK9B 1RTHA 2JOQA 4USIA 3HPOA 5HVFA 2WTFA 1GMWD 3HI9A 1IM6A 3A3NB 3TAQA 2E5HA 1J5OA 2YKPA 2Z2LA 4B3OA 5L8RC 3DXSX 1H7XA 4PCQA 4F0KA 3FNNA 3DYAA 1HQEB 4AQYJ 3K58A 1H7WA 1LOUA 1OYDA 3KOAA 3WX8A 4DV3J 3QSYB 1LXJA 3H40A 5A6PA 2AJQA 2ZITA 4LVOP 4WK1A 1RT5A 4DQIA 4FN5A 3W61A 4HYKA 4DSKA 3D0HE 3QRRA 1BQNB 3ULHA 2YXLA 3RU0A 3FMWA 5FDLB 5DGAA 3P5BP 1YZ7A 3JTOA 2BV3A 4MKAA 2JX2A 4EWTA 2KKHA 3SEOA 5F8GA 2ZC3A 4PUOB 3BKUA 3IR5B 4PPDA 2G13A 2Z56B 4ATNA 5E3AA 3HVAA 2QG9B 3H98A 1NUEA 3KLVA 2B9WA 2FLOA 2AJ0A 2HHHJ 3CE8A 1NK7A 1RHMB 3F44A 3BGRB 3MMCB 1K73T 3CMES 3KUGA 5KFIA 2UVVA 1EKSA 2V4JA 3JXOA 2BRLA 3GV5B 2M70A 2DNKA 1U26A 4P7TA 1YJ9S 5D15A 2WOMB 3IBCB 3RJMB 4WIIA 4I68A 3EGWB 2BANB 2VH7A 3OTDA 2YWKA 3KG0A 4RW9A 4F25A 1CS4B 3GP9A 1SIWB 5CQGA 2VG5B 3OLAA 4DX6A 1BUXA 2MB0B 4UTGA 2FPHX 4OZNA 3WC2A 3L3CA 4F50A 4KH1B 4KB7A 4X4SA 4CIOA 4OZ5A 3NS7B 1NDPA 2QIFA 4JI8F 1N48A 4U67Q 3AHPA 2JFKA 4JUZA 1FNOA 2HFOA 1QTMA 3T9NA 3IN5A 2WVEA 1VQ8S 5HQ8A 2QEXS 3BQ0A 1S59A 1R0BG 4IQXA 3HFZB 2J6UA 4F67A 4YB1P 3G9CA 3QGGA 2MZJA 3AXMA 1RAAB 3SSRA 1MN9A 5H1SV 5KFUA 2DGXA 4TYBA 1FRIA 2MZRA 2VBXA 1U48A 5H9EK 4PR6A 2ZD1A 3I31A 3B8HA 2IM1A 4IDKA 1NPKA 3DMJB 1FKOA 1LWCA 2ZNYA 2NXJA 4F4WA 1U2CA 2HYIB 4I4BA 3HK2A 3HLUA 5FIIA 3GIJA 5A8KB 1SQGA 1CC8A 4ZDNA 1KKHA 5AXKA 2AQ4A 4FXVA 3DRPB 4C3KA 5ETSA 2AEJA 3UDVA 4LSZB 4ECTA 2CYYA 2FQQB 3RB3A 5B0AA 1DJ0A 3HFKA 3OHAA 1H73A 4CO0A 1RCXB 1BGXT 5IT0A 4NLGA 5IOLA 1R8HA 2N4DA 1TR0A 3DM2A 1TKTA 2GMLA 3TA2A 1GMVA 2D3OR 2OEJA 2XQCA 5AJ3J 2PEBA 4L74A 3IAM9 5D0GA 2VQFF 4CH1A 2K1RA 4BWJA 1HNVA 3ZFVA 1CJUA 2GS8A 4NRTA 5EWEA 2DXDA 3M9OB 4ZLPA 4DQSA 2F5GA 1ZA2B 1KP6A 1FRLA 3HJFA 3ZZOA 2P9GA 3OLBA 2Q66A 1K0VA 5E3PA 4NEZA 3CPWR 2CQ1A 5KFMA 4ILMA 1WHYA 4UOCA 4DR5F 4TLRA 1FEHA 1C4CA 2P6TA 3D9BA 2HS0A 4MK8A 4GVBB 3C8YA 3ZZRA 2V8VA 3O8WA 4QR1A 4IKAA 2V8HA 3D2WA 3I5CA 3IWLA 2HEKA 5D78A 4PG8A 3VR1A 3KHGA 3FZBA 1D8ZA 5J1PA 2CNNB 4NMLA 2R2TA 1KQSR 2E1AA 5F3TA 4QR2A 1GXUA 4LFCJ 1VQOS 1S0VA 2I0XA 3HHLB 1JQGA 3KFWX 2UUAF 1UETA 3RZAA 3W65A 3MTKA 2HAFA 3DRYA 3DU6A 4Z7YA 3UPFA 2CWXA 4X4TA 2Z2YB 3NMRA 4KR0B 2QN6B 5K20B 2VFSA 3SQGA 4OYBA 2IAJB 2ZBQA 1DBDA 1FNXH 4QWAA 4K50A 3KK2A 4ICLB 2B8QA 1T03B 1N54B 1NK8A 2RU3A 4OX9F 1UZHA 1N5TA 2ZE2A 1JLGA 5I3UA 1DFDA 3RBDA 3VAFA 4URQU 1IKWB 4TY9A 3CMQA 4ZVUB 2GIFA 1BQXA 2WBRA 2FC9A 2YNGB 1HHQA 4ZITA 1RYRA 1EARA 1G7CB 2UP1A 2C2OB 1FRHA 5AXNA 1XNQF 3NNCA 3CIMA 3KHHA 2RU9A 1YBUA 2HQFA 3W63A 2ZKTA 3I55S 1HQ2A 3R27A 1VFJA 3Q24A 4FYVB 2VQEF 3S8SA 2J6SA 3L7PA 3MCMA 3TNVA 3NMAA 2BACA 2VUGA 1UFWA 3QLHA 4ZVRB 1JLCB 1GTEA 5HVHA 3Q8PB 4DFPA 1H2TZ 3RAMA 2N82B 2HSEB 3OD2A 3R1LA 4CI0B 4QU6A 3DN9A 1NB2A 3Q8SB 3CJQA 4USJC 3BH7B 1F5AA 1N6QB 2DGWA 1FVQA 5KFKA 2GGPB 3HX9A 2UXCF 2FZKB 1DAXA 3HXMA 4ID8A 4ZVQB 4Z2XA 2QSFA 2L48A 4FBTA 4M1KA 3MUVP 3NGRA 4DX7A 1VQPS 4LF6J 2DHGA 1WC1A 1A7GE 4MYUA 3AJDA 2HZCA 4LR8A 3CJRA 2OIHA 1RT2A 4OYWA 5K5MA 2DR9A 2ZH8A 1T05B 1T02A 3ZNJ1 3DFEA 4NLOA 2BJ3A 3EGNA 5M2RA 3OL6A 1WHVA 1MNEA 2VBWA 2W2MP 1ZS6A 2V2KA 4L76A 3QBCA 4ZIWA 3R8YA 3PW2A 1WTFA 4YR3A 4CM2A 5EX3A 2DR5A 3PDNA 1NCLA 4OI3A 1Y5LB 3GIIA 4HTIA 4CM0A 5KFQA 5LL6d 2NS1B 4YDDB 3KXDA 5BR8J 2FJAB 1NM2A 4NLQA 2I1RA 4LSNB 1VCTA 4LUBA 1NK5A 3HSGA 1TUWA 1Z1ZA 3MURP 5CABA 1X5SA 1B0TA 4N8NA 2HMIB 4EO6A 2FHMA 2XY5A 5C25A 3J7YI 4FNIA 1CULA 2BA9A 4ZLNA 4NXMJ 5KOXA 3FBBA 2C2ZB 1HBUA 3DLGA 4A4JA 1HBMA 2PD1A 4C8NA 1FTCA 1D1UA 1D9DA 5DLGA 3W2VB 1YWXA 3CCMS 1VRQC 1IJEB 3P5TL 1NJWA 2F9DA 1S72S 1TAQA 1OQ6A 4IO1A 1VQ4S 3RUBL 3NOGA 1U6FA 2Y1IA 3LOUA 1IKYB 2HK3A 1TZ0A 4OV6A 4C0BA 5J2QB 2OSQA 1U1PA 3CJ4A 2KTQA 2KH9A 4URGA 3EMTA 2E9ZA 3BSCA 3LP0A 1JJ2R 4M5JA 5T7LB 4XTTA 4X4PA 3RGIA 4EBEA 3KG1A 2FUG9 3FRYA 3M1VB 1SV5B 1HKAA 3O2IA 5B0CA 2ASDA 1HPZB 2J9CA 2W2NP 3HD2A 3MD3A 2W7PA 2XI3A 5H9EJ 2U2FA 4NA1A 4F4AA 1CLFA 2IJRA 2LXIA 4IO9Q 3C15A 4WP8A 1XR7A 2DCUB 5HP1B 3MMBA 3TW0A 4DF8A 2A2DA 4LSLA 5C2CA 4E0DA 2W4CA 1RAEB 1YSJA 1RA6A 5D0RA 2VG6B 2B6AB 3VVTA 2KFZA 1IBMJ 2RF2A 2P9EA 5BYQA 2DIUA 3RW6A 2M2BA 1RISA 1MWZA 2KO1A 1DHMA 4DJBA 4ZA1A 1NSPA 5KFZA 2BJ7A 2GIRA 3MCNA 2R7WA 2C1EB 3PJ9A 4DL6A 3IAS9 1QAXA 8AT1B 2HHPA 4I6AA 2F9JA 1JXLA 4DR2J 1C1BB 1R3NA 1HQUB 2FHOB 3I0RA 2QA2A 2MYFA 4J5OA 3VHQA 1HBOA 4M94A 2WONA 2UU9F 4IOAQ 2ZWPA 2FHJD 4N5SA 3EVOA 1VC0A 1YHQS 3M9NB 3GFHA 4OZ1A 3A8EA 2GQQA 3K8VA 3ITHB 1PG5B 1E6YA 4ZOSA 3LP2A 1J5EJ 2IFXA 1N32J 2A0FB 1GMWA 1AW0A 1S6PA 4USVA 2IHR1 1HLWA 1Y0HA 2J6TA 4ECYA 4HHUA 4F3QA 5KFTA 3H4BA 4K5SA 3JTNA 1MMNA 5B0FA 4ETZA 1ZH5A 3DC2A 2EKYA 3MZIA 5HI7A 2C3OA 3JAMU 2AKWB 3BR8A 2HBQB 3GIMA 1SH0A 3V4IB 5HMYA 2KT5A 2DR6A 2VG7A 4ZCLA 2GJIA 2HBRB 1F1BB 1NDLA 3KKFA 2I6WA 3SIPB 1VQ5S 1W2IA 1TFYA 5IWAF 1X60A 1FDNA 4KH0B 2AHOB 1T9YA 3D6MB 1I51B 1WACA 4LF8F 3KK1B 3QRPA 2DO0A 4GMKA 5AXLA 1S1VB 3EPGA 2CZ9A 4OJHA 3TZXA 2Z8QA 3KYLA 2VJVA 4DUZJ 1DQAA 1AROP 1WKLA 4WP9A 5GADU 5HO4A 1IKVB 4DU7A 3BDPA 3CWJA 2ALYB 1T3OA 5CD4A 2CQ2A 1IUJA 1VHFA 1RABB 1RWKB 2B4UA 4EYHB 5D6GA 9RUBA 5KFYA 5KG6A 4DV4J 3N6MA 3VAJA 2HQIA 3PYDA 2PI4A 1JLEA 5IT9Y 3OTOJ 1KD1T 3J80U 1T7PA 3AY0A 1F2HA 1RTDA 1S1UB 2MKSA 1JLBB 4QOTA 3EVMA 1NEEA 3RYLA 3QZ7A 1BXNA 1SL2A 2DH7A 2JVRA 1HWIA 4ENOA 4DV1F 2J9DA 4W98A 4BWMA 2MKCA 3SZ2A 2DGOA 2E7VA 3MAQA 3NCRA 1FTRA 1I94F 4ZKAA 3RAQA 2DXFA 3RG6A 5C24A 3N0VA 3H8YA 2X3GA 1XNQJ 3GU0A 4O3QA 2C42A 2F8EX 2WVCA 3SXLA 3PYEA 3D5MA 3NOCA 1YVFA 2POKA 4FVCA 2VPXB 4DU8A 3DRRA 3J7ZT 5D0EA 1UA0A 2BKOA 1MU2B 3AOBA 1XN9A 1F2GA 3I9V9 1KQKA 4UF4A 3DI6B 1FHTA 3RRKA 3P4UB 1RXOB 2VFTA 1SKUB 3HHKA 4X4VA 3D0IE 3MECA 4P73A 3R7BB 3IC1A 4IUFA 5MAOA 3KWMA 1UWBA 2UXDF 3GMGA 3NEKA 3AT1B 2AU0A 2A3JA 2UZAA 2YX4A 3LPEA 4UUWA 3ZC4A 2UXCJ 2MGZA 1S1XA 5GAHU 3M8PB 1KLNA 1IBLF 1RT4B 4N8OA 1KBRA 1GXTA 3QNWB 4LQ3A 4DG1A 3G71S 1SUQA 2JHEA 2E1PA 3U1MA 4GKKF 4QYRA 3K0JA 2Y9HA 3UW1A 5H9FK 3ZTSA 4P2XA 4DR3J 3G6YA 1C0TA 4OHVA 2HQDA 2OSRA 5KT4A 4RPFA 4X62F 2DD8S 1TVRA 4DEZA 1IBKJ 4AYBD 3ZTOA 3KJNB 4MH8A 3T6JA 5FJ4A 4WFYA 1QD1A 4ZVFA 2CIMA 3VAMA 3EXYA 2QT7A 3SYZA 3HZGA 1HNWF 2CJXB 1TL5A 1B3TA 3I9ZA 3V4MA 2XI2A 4ZLLA 2YPYA 4HLBA 2GO9A 1X5PA 5D8HB 3BS9A 2CQDA 2U1AA 3EXCX 3FCWA 5E41A 4OIXA 1U4BA 1VQMS 2BUNA 2W2PP 3AAWB 2LU2A 5E7OB 2W01A 3BGUA 3MWBA 3JYTA 2GO8A 1RYSA 2CQ3A 3UR0A 4L72B 1R7IA 3HHEA 1HNZF 3SSSA 4CP5A 3KDNA 4ZLJA 2RQMA 5L1JA 4A48A 2HRUA 2LKZA 4OL8A 3KG4A 3KLEB 1VR6A 2W9CA 2IM0A 3KJVA 3L09A 5FLXY 3RB4A 4F7VA 1GX5A 1SQFA 2UV8G 2UVWA 1NDCA 4DCJB 1HBNB 5F41A 5EWFA 1DQ9A 4RU2A 4RW6A 1UW4A 1UP1A 1HMVB 4MTPA 4F2SA 3PVXA 5IQQA 3V5RA 2YQ3A 2MZSA 1ZYQA 3T19A 2W9BB 1UVJA 1S99A 2HVIA 1F5BA 1N52B 2Y1RI 2YWGA 5IC4B 4C9DA 4JI1F 2XY7A 5CH7B 3BREA 3CDAA 4PABA 1AXQA 2D3UA 3PIPQ 4DHVA 1C2PA 1T9TA 2OPRB 3K17A 3GCWP 3K57A 3A8IA 2P8IA 3HHNB 2PMWA 2FZGB 4KHRA 3M7VA 3M30A 2DHAA 4KPCA 3H0PA 3BJYA 3TEHB 2V34A 3MHYA 2PEHA 3CJ8A 1UJ6A 4LF1A 4C0HA 4C3LA 1RT7A 4MK7A 5F8LA 3QATA 2YH1A 1L3TA 1SPBP 1CJKA 4U95A 1GX6A 2RAQA 3EDQB 2P9CA 4JV5F 4CLTA 3ZZUA 2HK2A 3M6XA 3TO8A 1KOOA 5LT5A 1B7YB 4KQZA 5HROB 4HEA9 3TJ9A 2HZVA 4YP3A 2COLA 2GVDB 2YBVA 1VDHA 2BE9B 3OSPA 4HT5A 2N3OA 2JVOA 4EMDA 1EHWA 2FDNA 2OO4A 5K14B 4MJKA 4TY8A 1RLDA 4DUYJ 2MQOA 4F02A 2OD4A 4KV8A 4NX9A 2YNHA 4K4YA 2EEYA 4LQ9A 1RTHB 3V81B 2GMJA 3F0NA 3KJQB 1NJZA 2J5AA 3U1NA 1J5OB 2J0QD 4MKVA 2HVDA 4B3OB 1X4HA 2C22A 4C6AA 4RO0A 3DYAB 3R97A 4LF4F 2CDRB 2XS2A 1I1GA 2YTCA 3TQEA 4NA2A 1RADB 1NH8A 2CPIA 4PWDA 4CLPA 3S7RA 3M4XA 1RT5B 4HI1A 1R27B 3Q8UA 2WRMA 3C66A 2DEIA 3L9ZA 5EUHA 4ELVA 3ILIA 4R0EA 2FJEB 4XK8C 2IM2A 2XEXA 2AJ4A 1PSDA 2HNDA 2RSQA 4DSEA 4V19X 1LXNA 5IV4A 4B3RJ 2DTJA 3ZNUA 4C0OC 1B0PA 1R0AA 2CPZA 2V8GA 4NZ7A 3HKWA 3TARA 4I67A 4J9MA 4WJBA 3QAUA 3K5MA 3M05A 3CJSA 4P7VA 3KLFA 2FVRA 1XMBA 1H6KX 2V4JB 3MM5A 3OVBA 2L41A 3R5DA 2DT9A 1FFWB 1VYAA 4IH7A 3JSMA 3TUZC 1S49A 1PJ6A 3FDSA 2W9AA 2UUBF 4WFXA 4UY8T 1CPZA 4JV0A 4DL3A 4EK2A 4RW9B 5IZHA 1HHTP 2AJ1A 1QAIA 8RUCA 2OEKA 4ZP8A 2HNYA 4DX8H 4CH7A 1U8WA 1WNEA 1TL3A 2RKIA 2QMWA 7FD1A 1XMQJ 2OLWA 2N3LA 3QZ8A 3C6UB 3AD7C 2M8DB 4YEAA 2RHQB 3C46A 3TVZA 2MJNA 4GC6A 3CCLS 4WZQA 3DLLQ 4UZCA 5J1EA 1HI8A 2EFNA 4ZVPB 4YR0A 3CCJS 4Y2MA 1N5SA 3VGVA 3CIZA 4DF4A 4DSLA 5LXYA 4F0MA 2JL9A 3L95X 3HF5A 4Q5VA 5A8RA 4HH0A 1RTIA 1WHXA 4QBUA 2EXUA 2JLEA 1F0XA 4JI2F 5HN0A 3IBWA 4YMEA 3F73A 3PO5A 3RR7A 1VQ6S 2YQ0A 3CCTA 2R8JA 8ATCB 2FJXA 2ZD1B 2FJVA 4EZ6A 3BGFA 4IDKB 4ED8A 2YKOA 1T9UA 1FKOB 2KJWA 1LWCB 2QYGA 3AH6A 4I64A 4F4YA 3QGPA 2LEAA 4QQBA 2YNFA 2XO6A 1NK4A 1BWVA 2KI2A 3MEEA 5E3QA 4ER8A 3OR2A 2ASJA 3WIUA 4ZN3A 4ED3A 2OTJS 2FHJA 2ZFHA 1LWFB 3RTVA 1FNMA 2B51A 2J9DE 1FJGJ 4RW4A 3VAIA 3G86A 1YIJS 4Z7CA 4M5DA 4K4WA 4PXEA 3BO2A 3DM2B 1TKTB 3N5BA 2WSFC 3GLJA 4WTOB 1ZTWA 1U2FA 5GMEA 3GR1A 3OVSA 4OZ2A 3GFXA 2F65A 4NA3A 4OX8A 4C48A 3NWGA 1SH3A 2B0GA 3MUMP 2ZWOA 2K1RB 1HNVB 1CJUB 3UD3P 1AA1B 1WI8A 4ED2A 3QWUA 2XY6A 3Q83A 4Y3CA 3H2LA 2RRAA 4TKTA 2HIQA 2W7OA 4B9NA 2E5LF 2KFNA 1RK8A 4C7QA 5BXIA 4I69A 4OI4A 2AGQA 3GJRB 3FZ2A 1LKZA 2GQ2A 3GILA 4FNHA 2DRAA 2D9PA 2IC3A 2ZZNA 2RMLA 2DXEA 2O66A 3HZEA 4RKUC 3R5BA 1L3KA 2AIRB 1RHJB 2NUUG 1BQMA 1UEVA 2EBGA 3MR7A 5KFLA 3D68A 3C2PA 1EETA 2XB2D 1B99A 4KY3A 3PG9A 1XIQA 3LALA 2DCLA 4F4ZA 1SXLA 1U1LA 2LLZA 2QLWA 2OFGX 4DV6J 3R9LA 5KFJA 3AJ1A 3WDOA 1TL1A 3V6JA 2BQ3A 4O3SA 3DU5A 3WIVA 3A1YG 4PQAA 2HHUA 3PKYA 3HHLD 3KK2B 1KLMA 5K9FA 3NWRA 2P5VA 1IWAA 5KFRA 3U1LA 2EG2A 1FX2A 2ZE2B 4DL4A 1GMUA 2E29A 4U7UD 1EP4A 4FBUA 5I3UB 2ADBA 3PTWA 1B0VA 3T5LA 2Y1JA 4DR1F 4LFBF 3E51A 3VAKA 1RWOB 4CLUA 3PHTA 2MTLA 3HFVA 2MHEA 2I2YA 4KE5A 3PNIA 2UXBF 1WC6A 1UCNA 4PG7A 2BKNA 2E5IA 4QJVA 4X66F 2BEFA 1EQMA 4RX6A 1S76D 1R0CB 1TKXB 3RBEA 5F8MA 1JKHB 4N7TA 4EO8A 4K4VA 4ZP7A 2CNKB 4MMOA 2FJDB 4R25A 2ZBIA 2VBZA 1VJWA 1G6BA 1LNQA 3QLHB 2E1CA 4ANCA 2H5IB 4J91A 3AXKA 4FYDA 3G96A 1Y3JA 2AJFE 3CCWA 5DM7Q 2GFFA 1N36F 2GHWA 2OPQA 1WC4A 2ZHAA 1PYSB 2RQCA 1NSAA 1Z2LA 5KFFA 1KVIA 4JI5F 1D0EA 3MPUB 3P3DA 3EZ5A 4LF5F 3FSXA 1SL1A 3V6KA 4ZCIA 2CRLA 3ZXWA 3DGVA 4OX7A 5A2QY 4UT4A 3WBZA 3GV7B 1BY9A 1T8EA 3HHLC 3TUIC 3AJ2A 3SFUA 4JI0F 1YJNS 2WHOA 4HL9A 2PSZA 4CDIA 2XCAA 4O44A 4O4GB 4PXBA 2J8SA 2R7VA 3O6QA 5IM0A 4DLEA 2BW7A 4Y28C 1P9YA 2EVZA 2H3EB 3CC2S 3A4TA 2MSTA 4KHPJ 1GAOA 1M0SA 2V2ZA 2X7IA 1NHVA 4URSA 3O3LA 5F8IA 5HLFA 3OTBA 4QYZK 3JSRA 5ETPA 1U1OA 7AT1B 2ZEJA 4ZPWR 3FGVA 2RRNA 1NLKL 1NHUA 1N56A 5C25B 5DDOC 1CULB 5MLCV 1HBUB 1UW9A 3DLGB 4P52A 2AZ1A 1HBMB 3TANA 3OXFA 3GE9A 4NZ6A 4IG3A 1R8AA 3DDIA 5B0BA 4F4XA 4OLOA 3RAXA 5KFSA 4JB8B 4B3SF 2JC1A 3QT6A 3QJJA 1NZ8A 3G8QA 4R0JA 3DDNA 2MLYA 3K8WA 5I42A 4DR4J 5KFHA 3J7Z5 4DFKA 1RACB 2KZZA 2ERRA 3TI0A 3LP0B 3ISZA 5KFOA 3FKBA 3NRBA 3IM9A 3CGIA 1UKUA 3D3CJ 2OUGA 3NY0A 3CDBA 2ACMA 1X4EA 2CQGA 1RJJA 2EFOA 1J27A 2FHKA 1XR5A 2H4WB 4RZRA 3OL7A 2ROGA 3BN4A 2YWEA 4B9SA 3PJXA 2XMJA 2M8HA 4WIQA 1TK5A 4LF7J 4KPYA 2J76E 1TL7A 2X1FA 2WSCC 3C15B 4JI6J 3MMBB 1GQEA 4LSLB 2VPYB 1HYSA 1S97A 5D3GA 3E2EA 1TTHB 1JLAA 4FPRA 2R8HA 1H2UX 5C7PA 4DX5A 2RF2B 2KU7A 3R5JB 3I0SA 3SDEA 3TX0A 1NNDA 2RRBA 2VPWB 3A8JA 1CBKA 1VIXA 3WHIA 4NYZA 1UA1A 2Z2ZA 3D66A 4J9OA 3FSYA 4M5HA 3R7NB 1Q78A 1IN0A 2RT3A 4ZHRA 1RP5A 2B7BB 2L3MA 3I0RB 4TN2A 2VKRA 1XNRJ 2H9ZA 1RA7A 3MR6A 1HBOB 3CCES 4AL7A 2WONB 4Q8EA 3WQPA 3OV7A 1VQKS 4H4OA 1F60B 1X4DA 2W24A 1H72C 2OPPA 4GC7A 1WF1A 2Y0BB 1FX4A 2YKQA 1E6YB 3UN3A 3LP2B 4A8WA 1NB7A 3W8PA 1U24A 1WWHA 5LJ3Y 4M63A 4MIBA 2XM3A 2OPSA 3KNGA 1WG1A 1S6PB 4MIWA 4AL5A 3DOLA 1OQ3A 1N8RT 1BWEA 3KNAA 4JI7F 3UD4P 1AUDA 4QU7A 2G1HA 4RJVA 1HA1A 2MQQA 4ZP6A 1S12A 4I2PA 4U96A 4ED4A 1U45A 3KJFB 3H4DA 5GADI 2BBEA 2DR8A 4K4TA 3CDUA 4YUDA 2XMMA 3HMJG 2VG7B 2RVJA 1UVLA 4PKDB 2GJFA 4WFZA 4X4QA 4YHHF 1ICEB 4P2SA 1S0NA 4UUXA 5KFDA 2CG4A 2AWZA 5LM7E 1BMQB 1VMBA 3ETOA 3SCLE 2ZJRQ 1FE0A 3KHLA 4G3IA 2UV8A 2JLFA 1A6LA 3TZWA 1F3FA 4USKA 2R2UA 4H4KC 3OVAA 4DUTA 1N34J 2GW8A 4OZLA 4CH0S 3GONA 4DQQA 3IO1A 4RUAA 3NS6A 4DV7J 2YWWA 4A8QA 1YZ6A 3BV8A 1KHVA 1QAYA 2BW2A 2VOOA 4Z37A 4FVMA 2HBYB 5CZVA 2OP5A 1U02A 4YS2A 3IMQJ 1X9MA 3J81Y 3CCQS 2V2QA 1WELA 3AOCA 1KC8T 4LR9A 3MM8A 2QO3A 4YN3B 3EICA 4X64J 2JZ5A 1RBOB 1RHKB 2NSBA 5HK4A 2EFVA 5KT5A 2AYBA 1YX2A 5KG7A 4R5PA 2EKNA 2JDJA 1JLEB 2ZZMA 3W60A 2EFGA 2B5JB 5E3RA 3CUNA 3W2WA 2W2OP 1RTDB 2PA3A 1WEZA 2JLGA 4N76A 2HLUA 2ABYA 4IQMA 2HFSA 4NLWA 3LP1A 3A3PB 1RTJA 4O3NA 5HJYA 1Q86T 2HHTA 4NLUA 4N56A 4FP9A 2WCXA 3BB5A 3NS5A 4LFBJ 3LA0A 3OL9A 1U2RA 1VQYA 2VDIA 4QZVB 2EK6A 2BXJA 4ZPVR 3HD1A 3HT0A 2EW9A 4LF9F 4FF4A 4U8YA 2DR7A 3G6ES 1HD0A 2XZWA 3KLIA 1AFJA 3DRRB 2NCKL 4NYOA 1HARA 1U0HA 2EPIA 3TX8A 2BE2B 2XNRA 1HW9A 2F7VA 4DPYA 3FEZA 2DY1A 1YKWA 1VRUA 4JI3J 2HWTA 2DRBA 3I96A 5AXMA 2Z58B 2R3VA 3A13A 1R8PA 2XLJA 4ZIVA 5B0DA 5KT6A 2FC8A 3MECB 2FVPA 2YWHA 5U47A 3K5PA 3CCRS 1UWBB 3GYXB 3EUNA 5A8KA 3HP6A 3VWSA 1UVKA 3OPKA 4A47A 2IMWP 2XC9A 4QIWD 2CKWA 2MGZB 1S1XB 2G2OA 3TA1A 2XMAA 1HW8A 2A2CA 4CLKA 4F2RA 4DR7F 1HWUA 3QT7A 1OIAA 2KXNB 4RNHA 1AUSL 4CLYA 4DG1B 1SUQB 3P49B 5CA5A 2V8PA 1D3WA 3QJPA 1YITS 3K2YA 3DLJA 1C0TB 5B09A 1RE1B 3IGVA 5SUHA 3W9IA 1TVRB 2OAUA 1R6VA 1ULRA 1N33J 4GKJJ 4KAIA 2V94A 2IA6A 1G4CA 4PG5A 1RTZA 1S6QB 1Y00A 3UWTA 4HVZA 1TK8A 5DDRC 4K4UA 1X0PA 4M5MA 3QFWA 2FY1A 1IM4A 4EYIB 2YVSA 4Q2LA 2KYXA 3BBCA 4OV1A 3FC9A 1UTAA 1CQNA 5L1LA 3GB0A 3DHXA 3BSOA 2CJAA 2CNOB 1FFGB 3TJAA 5CD4H 3IG1B 4ZCKA 3OFFA 3MMAA 3NNAA 2PFFB 3GZ7A 1F9FA 2DNPA 2NXNA 3T1YF 2C2RA 3TQ1A 3GFZA 2CQPA 3JYTB 3P96A 1GTHA 1GEHA 2PFDA 3MCOA 4DL0C 3MAAA 4RW8A 3AFGA 2YKNA 4JP8A 2FD2A 5F0WA 2N7CA 3U27A 3CULA 4NXNF 2PT0A 1DTQA 4PQUA 4YY3J 2YNIA 1VISA 1Q7YT 2W9CB 1N0UA 1ZAXA 5BJRA 3MM9A 1CSJA 4CLFA 3U7JA 1HWLA 3HHLA 4WP3A 4RW6B 4LFAJ 5KG2A 2K3IA 3KUEA 2KJVA 3BO3A 1W2BR 4C8OA 2ZBCA 4ECSA 3DOMB 4JI4J 1H3DA 5E5NA 4OZ3A 5HJXA 3BGLA 2CAJA 1QE1A 1T03A 4I7FB 4DV2F 3RB6A 1QJHA 2HVEA 2WW4A 3UCUP 4ES3A 3M30B 4P10A 1KR4A 1VK8A 3EVWA 4X65J 1YJUA 4IFYA 2QL7B 3PR4A 1Z2ZA 1PCAA 1RT7B 2QRRA 3PRVA 5E33A 1CJKB 3EE3A 1LW0A 4M5IA 4C3MA 1H2VZ 4WTYA 2FZCB 3H59A 4UQTA 5LMNJ 2DYAA 3ENVA 1X9SA 3AB2B 2R9LA 4JYAJ 1S0MA 4UQGA 1U1RA 2AX1A 3MOZA 3RBXA 5ADZA 3NP5A 3IWXA 1DQ8A 3T41A 4TY8B 1RT1A 1MWYA 3VGTA 4TQRA 3HM9A 2ILZA 1JLCA 3TUPA 1URRA 4KV8B 3UNYA 2B8PA 3K5OA 5KFAA 2KT3A 2I5JA 4JBCA 5DETA 4GO5X 2XYPB 1JIHA 2ZDOA 4USUA 2XSJB 3C3LA 1FJ7A 3HDSA 4Y34A 4KIAA 4NLPA 2JEIA 1T9VA 1FFSB 3QO9A 1M1GA 1SQEA 3PR5B 2GX8A 2CVIA 4X4UA 5CYMA 2RS8A 3S01A 2F4VF 3CJ5A 1WSVA 4YB6A 1Q7LB 2D3O1 1Q79A 4DV5J 3D28A 5M2PA 3AODA 1EIYB 1XMOF 1VQ7S 1T11A 3D0GE 3M2VA 3G4SS 1K9MT 2A10A 1RAFB 4UOGA 3CJKA 4C8YA 1O6XA 2A18A 2OELA 1UZDA 3FEXB 3I82A 2MQLA 2FIUA 2MZTA 2IPOB 4Y2IA 2HNDB 4ERDA 3CD5A 1R0AB 1HNXJ 2XYGB 1RWMB 4OJ1A 5LXRA 1NAQA 3ENAA 2C3MA 1ZZNA 3LGMA 3KLFB 1UWAA 1KFSA 2ZBPA 2F8MA 2HMIA 4OJ3A 1F3VA 5KT2A 1Y9OA 3JSMB 3N6NA 5J2MA 3CMAS 2OTLS 4K2XA 4IFVA 4CO5A 2A1BA 4KO0A 3PW4A 2OI2A 1O51A 5ETNA 2M3DA 1URNA 1RQ0A 4N77A 1Y11A 2GV1A 1MROA 1FJCA 2HNYB 2B4VA 4RNNA 4MK9A 2DGVA 1TL3B 2NXUA 2B9XA 2G9OA 3OL8A 1ZAVA 2MJUA 1HR0F 1M5PC 2M7SA 4JOUA 2CFXA 4C8ZA 3PHEA 1M1KT 5J1EB 2Z2MA 1IQZA 4L6V3 4F0HA 1W7WA 3PX6A 2Z57B 4WYLA 4B3MF 3IRXA 4H4KA 3CB4A 3M1VA 1SV5A 3KUHA 4IH6A 2FLPA 1QY7A 3MFHA 1HPZA 2HIYA 1M1HA 5A8RB 3EZUA 1D8YA 1EQ0A 1WUUA 2E1MC 1S7HA 2AMCB 4X4NA 4F3OA 4MIAA 2MLZA 3D6FB 2E9RX 4RNOA 2EFQA 1YJRA 3LUYA 5HAOA 4ZVGA 3SCJE 1FRXA 5HP1A 4TU9A 5HATA 4KGKA 5IT4A 4I0WA 2ZH9A 5LMUF 4LRBA 4M5LA 1NPPA 2YNFB 1RT6A 1OS5A 3V2UC 2YKAA 3JSYA 1CJTA 4P2MA 4CO4A 4H54A 4EU0A 3EPIA 5K8NA 4G1QA 2HPUA 3MEEB 4K0KF 1Y7PA 3OR2B 4HACA 1ZPWX 4C8MA 2MZQA 3PFEA 3CJ0A 1PYOB 3HVTA 4RW4B 3BQ2A 4M5DB 2YX1A 3HSDA 2AF6A 6AT1B 1U8SA 4BS2A 5DG7A 4ECQA 3G6XA 4U8VA 3OT9A 1GXLA 4DR7J 4DV0F 3F56A 2BM1A 2V2VA 1OWXA 3CXCR 2XS7A 3E01A 1SKRA 1TUGB 3E3XA 4I6YA 1UJ5A 2ACYA 2VODA 2DHXA 5CAAA 3GWCA 3TYTA 4PG6A 1D9FA 3I87A 2KL8A 3WX4A 1H74A 1JWWA 1XEZA 1P27B 3PW0A 2BE7D 3Q23A 2MQMA 2V50A 1GT8A 5L9NA 4DFJA 4K7QA 4AQYF 3OJSA 2HAIA 4J9LA 1YBAA 2FVCA 2KB2A 4CLSA 2FGOA 3MEGA 2UUCJ 5I3PA 5IS2A 2IC3B 2HFNA 1PIEA 2C3UA 5J2PA 2XCPA 1KTVA 4ZVTB 5AT1B 1IVZA 4IOCQ 3TR5A 4J9SA 4F26A 4DXLA 2QLJB 3PX0A 1BQMB 1X8DA 2R7SA 4B3TJ 1S1VA 4NI2A 3OXLA 4KKOA 2RB7A 1EETB 2IDEA 2CG8A 2AGPA 2HHHF 4FS1A 2KDOA 3VALA 2C2MB 3MD1A 5A0YA 2LQ5A 2ZM6J 1XTZA 3QMQA 3DRSB 2BABA 2XO7A 4BC7A 3T3FA 1TL1B 1EAYC 3MPYA 4ED7A 1CG2A 6FDRA 4ZPCA 3PV8A 1XQIA 3UN5A 2BJ9A 1KLMB 4F8RA 4ZVSB 4WKRA 1ZAWA 4PWWA 4C11B 3Q22A 2P6SA 2QFIA 1MN7A 1JX4A 3MFIA 3BSAA 2J0WA 3NL0A 1SC1B 1YJWS 1EP4B 3SCIE 4Y00A 1CEZA 2YWFA 1QVGR 5A8WA 4DV2J 1SKWA 1T9WA 2N4CA 1VC5A 1UPMB 3EGVA 2B56A 3OUYA 3PXGa 4CCHA 3NKYA 4ID5A 5RUBA 2DISA 1R43A 3Q89A 1NMEB 2R7TA 2HRTA 1QM9A 1JJ4A 3IS9A 2LCWA 2ZHOA 4DMZA 4ECXA 3PM9A 4LBHA 4TU7A 1TKZA 2H1YA 3G87A 1SBRA 4MFBA 1ACMB 4GVLA 3M32A 3OFHA 1S1WB 4KGVB 3FBFA 2RILA 3PO4A 1UPPA 2Q6CA 1WKJA 3M2RB 2FJWA 2OPQB 3GJQB 1BE4A 2Q43A 2DNRA 2G2YA 2YQ1A 5KG5A 3POTA 1JLQA 2C2KB 4MKBA 1K47A 1VBZA 3LANA 5AE1A 3C19A 3PW7A 4J9UE 1RUSA 4OYZA 4Y2KA 2BQUA 2R2RA 4FYXB 4JI8J 3OTCA 3MPVA 4C2MA 5F9LA 3X1LB 4FYYB 2RE1A 3M8PA 4RL1A 4HI2A 4I1TA 2DITA 2IVMA 1S6OA 4M5GA 4ZVOB 1VS3A 1RT4A 4RWWA 4OJGA 2DY9A 3AD8C 4O44B 3OFEA 4X2BA 3OJUA 4I2QA 3IP0A 5AJ3F 3FCHA 4FDFA 3M8QA 4U7UK 5IM0B 1KTQA 3Q86A 2Y3YA 3RRHA 3H5UA 4QPTA 1XK8A 1VBYA 3HKZD 2MKKA 5DQIA 2J8AA 3JB9k 5HLFB 3RRGA 2LA6A 4NEYA 1O0PA 3M8WA 4RUBA 1ZOTA 1YG0A 1KEKA 3QGHA 3N28A 4OZJA 3I5BA 2G1DA 1Q5VA 5CYQA 2Z4PA 3B54A 2HVZA 2V6AA 1NXIA 5KG1A 5IXUA 5DZ7A 5ETLA 5KFVA 4BHQA 4TYAA 2M4MA 2XMVA 3TWZA 2QJ3A 3SI8A 3W62A 4LBIA 2AV5A 4ZPBA 5HMXA 3R2CJ 2IVYA 1RWNB 3C6TB 2I38A 3W9HA 4B17A 4AXIA 3D6HB 2VQFJ 1HHSA 1RWUA 5KAKA 5EX0A 4LFCF 1YTYA 5I42B 3THTA 4OQJA 2CQ0A 5DG9A 1S9FA 2DPIA 4O0NA 4O0IA 4DPOA 3KLEA 1YGYA 1S1TA 1YJTA 3CCUS 1KVKA 2HFUA 1U6ZA 1HMVA 4DR5J 2DEJA 1U7LA 2YKMB 1VQSA 4DZDA 2VF3A 1KWMA 5L1KA 4ETXA 3PJWA 3SFGA 4CO1A 4RUCA 1TL7B 4OMFG 3HVWA 2PIIA 2Q79A 1L3SA 4NLTA 1HYSB 4W4MA 4CRJA 5D3GB 2JEGA 2BOAA 1JLAB 2DGUA 1RLCL 2LYVA 3NGKA 4K2JA 2GMHA 4KJIA 3FFIB 4OZ0A 4B9VA 3I0SB 1X5OA 1IQTA 2YPZA 3SDEB 1U09A 3NGDA 4N47A 3PCOB 2I8EA 2XMKA 4DSIA 3ENQA 4DR6F 2UUAJ 1V6HA 2C3PA 2E5GA 1L3VA 2HGNA 3GQCA 2NXCA 2LECA 3KHRA 3DOKA 4W90B 4PRFA 2B3TB 3GTYX 3Q8QB 4QIFA 3AA8A 1ROFA 1RGVA 3ISND 1WC0A 4H4OB 7FDRA 5CCLA 3Q8RB 2OPPB 2LDYA 4OX9J 5L1IA 2XSFA 4YR2A 3G6VA 1WOSA 1WKKA 1TKDA 3M8RA 2OPSB 2E66A 1NKBA 1P6TA 4HTJA 3DOLB 1UFLA 2Y0SD 2HGLA 4IH5A 1U25A 4Y6IA 2HVHA 2Y8YA 3V6HA 4LF6F 4I2PB 2DNOA 3V81A 2VC1A 1VOMA 5I4MA 2O1PA 3JQJA 4ALZA 1FJEB 4ZP9A 4B08A 5E0OA 1UMJA 3PYGA 4ZVEA 5ETVA 3ET6A 2VQEJ 2C2EA 3D1QA 5F3ZA 2F40A 2HLTA 2RD5C 3PRDA 3C16A 2VOPA 1VQNS 2MKJA 2VL1A 4LRAA 1MMDA 1NH7A 4OYXA 4ZJOA 1C4AA 4IOBA 1SI9A 5BR8F 3R2DJ 5BYRA 3QIPA 4DWIA 4QCLA 3H42A 1FF2A 3IR6B 3HULA 4CTAA 3H5XA 1IKXA 1XWLA 2R2SA 2BZ2A 3UE2A 3TZZA 4DLGA 1S0OA 4B9TA 3MM8B 4I6WA 1X7VA 4ILRA 2Z30B 4BC9A 4NXMF 4EBCA 2L9NA 1WDTA 4J90A 1N0VC 2QMXA 3IRWP 2NQPA 4R5PB 1WF2A 4OYMA 2ZH5A 5KFXA 3ISNC 3W2WB 4ECZA 4FXWA 1ZM2A 2XTJP 1OPZA 1VJQA 5F8HA 3UCZP 3LP1B 3W5ZA 4NCGA 1RTJB 2DHHA 2XMUA 1U1QA 3A12A 5KG4A 2KG1A 2EWHA 3EM1A 3VVUA 1WTBA 1LWEA 1LK7A 2BJDA 4DZ6A 4FF2A 2HQGA 5EWGA 3QWPA 1JXVA 5I3QA 3TEGA 3C6UA 1X0FA 2F1FA 3DRXA 1I3OB 1YI2S 4CQ1A 4MYTA 2PO4A 2OJ3A 4U9RA 3TP2A 2PE8A 3MAHA 4FF3A 1RI7A 2DNLA 3KLIB 3W1YC 2XLIA 4IR9A 5KOWA 3GIRA 1ZPVA 1U0HB 3D6TB 1IBMF 3MR3A 5J2NB 2HWIA 1O8BA 2MY7A 1T0TV 4HT7A 1VRUB 2O01C 3CD7A 1AFIA 2HHWA 4A8MP 3M6UA 3NGTA 2MXYA 2E5JA 3UNGC 2G2ZA 2WB1D 3LAMA 3JTPA 1ZZFA 1WJ9A 1S48A 1T9XA 2QL5B 3A3OB 4DR2F 2B4OA 2ZKUA 1C1CA 2MHNA 3CD6S 4AT1B 4ZPTR 3MM7B 2VFRA 3TOQA 5DQHA 3GYGA 4OYAA 1KVJA 1LWFA 3LWLA 3D54A 1LFWA 5EN1A 1N5VA 3BKTA 2LQ8A 1RWPB 2CQBA 3FCVA 2DVIA 4R8UB 1DZ5A 1J5EF 2RS2A 1N32F 4J9NA 3HT3A 1DLOA 4CWBA 1MSWD 1DARA 4M5KA 4ES1A 3ADAC 2APOA 1JLFA 4Y2CA 2DGSA 1D09B 5ITHA 1WSRA 3AB4B 1X4BA 2B7CB 4K4XA 1M90T 3UDEA 3D1OA 4ED0A 4NE9C 4EFAC 4BBYA 4NLXA 1B4SA 2CNLB 3NGSA 4IRCA 5F8NA 1B7FA 3BBBA 5ETQA 4KGMA 1QSYA 2KM8C 2KRBA 1K44A 3I5AA 3MMAB 1K0TA 1G3OA 3R5AA 5IT9U 2Z0GA 2UU9J 2DRDA 2CQ4A 3I6PA 3MAAB 3GR0A 4RW8B 2YKNB 2HW3A 2LQJA 4WE1A 1KQGB 2IJNA 1PBUA 2HS3A 2K2PA 1DTQB 2FVQA 1LW2A 4PQUB 4DUZF 1T3NA 1TELA 3KLGA 2JH3A 4Q7AA 2NLWA 2YNIB 1Q8IA 3BDEA 2HFVA 4A46A 4YOEA 1O5JA 4PAAA 2V5HG 5ETOA 3H25A 1TAUA 4PXDA 1SIZA 2M52A 3H5SA 3P45B 1TV6A 2DJWA 1IR2A 4NPOA 1OPIA 2E1RA 2MDAA 3MM9B 2FLLA 2KRRA 5JJBA 5DLFA 5D4PA 5C42A 1APSA 1CJVA 1TP7A 2DNYA 4LIWA 2NZ4A 3ILOA 4LRDA 2QFJA 4DV4F 1UAWA 2AYGA 1FWLA 3RW7A 3OTOF 2BX6A 1NBEB 4J9QA 4HKQA 4OHZA 5IWAJ 2WK4A 1PC5A 2ZOGA 1QE1B 2CPXA 3L4BC 2VPZB 2ASLA 4NL5A 4LF8J 2NSCA 5LSLA 2VDHA 1J2VA 4WCEQ 1FWPA 5D4LA 4FF1A 2G0IA 3DGPA 5HQMA 4IFYB 3DXBA 1WHWA 2BKPA 5T41A 1GK8A 2BJ8A 2LVWA 2AYMA 3ZZZA 1LW0B 3JAMY 1LQ9A 3H2VE 3CSKA 2FY8A 4ZK7M 3AA9A 2D1CA 2XGQA 2AP6A 2WAQD 3SV4A 5L9XA 4DR6J 2DHSA 1U1KA 1TKXA 4YFUA 3G82A 1K1SA 4ZPAA 4K4ZA 1JKHA 2OKQA 5C5JA 1TFWA 1P1TA 3B78A 3BEGB 2ZH3A 4EI2A 3OFGA 2NPIA 3W5YA 2MSSA 4FZVA 5A6WA 2Y8WA 1RT1B 2QC3A 1E6VA 4OHXA 1S9EA 2VD3A 5F8JA 2D41A 4QIVA 4DV1J 4UOHA 5DS7A 2I5JB 2F63A 4IRKA 4DCPB 4RLEA 1YBTA 1FD8A 3TAMA 3CW2C 1FERA 1I94J 2LEBA 1SL0A 1AZSA 2B4PA 1NJYA 2XNQA 2CJYB 1U1NA 2R7OA 3QO9B 2PC6A 3LH2S 2MLXA 2P2CB 1RU2A 1IXKA 3BGOP 1FVSA 1X4AA 5CYMB 3R3TA 2X3DA 3J80Y 2HQ3A 4DR3F 2IYGA 3N79A 2XS5A 5KFEA 2OHDA 5JXSA 2IA0A 4OI1A 1TMMA 4O4GA 3M2VB 1IBKF 1RKIA 6FD1A 4RW7A 1Y10A 4DBQA 3CJKB 2C3YA 3ONQA 3UQSA 1HWJA 5HMWA 5FLXU 1LFPA 3I4PA 4DPWA 1JNRB 2JWNA 4Y2AA 3VZHA 2UXDJ 1RHUB 2SXLA 2ZH7A 2W25A 3V6DA 1VLYA 3GCXP 4J37A 2GHVC 3D67A 3ELHA 4KGXB 3CTRA 3G8SA 3DNCA 5HBMA 1IBLJ 2MQ8A 3OXGA 4LF2A 2GQCA 5J2MB 4TNOA 2ZH6A 3CF5Q 4IFVB 3ZTQA 3SBMA 4KO0B 4GKKJ 3MMJA 3MEDA 2F3JA 3W5XA 1UVMA 3EYZA 4B9UA 2RDJA 4IG0A 2R8GA 2GHPA 1FXLA 1MROB 3UVJA 2KZMA 1MLAA 3CVKA 4X62J 4USTA 2PA8D 2AD9A 2JFDA 3OR1A 4CLWA 3BH6B 2M5YA 1NK0A 1VBKA 4M8LA 5GAEU 1DTTA 5ETRA 4UW2A 4J9KA 1FRJA 1V3RA 2DNQA 3E8OA 2KN4A 1A9NB 4Q8FA 1HNWJ 3PEHA 1FO1A 3OHBA 3IRXB 2CQIA 2LFVA 4WK3A 3THVA 4LRCA 5B0EA 2CPYA 4ZCMA 3J7AN 3Q8YA 3JQKA 1VC6A 4EUVA 2EFPA 3T6BA 3UO0A 4ELUA 1C0UA 1NZAA 2W4PA 3J7A1 4N41A 3FQKA 5B7WA 2DH9A 3AQOA 1HNZJ 3OBIA 4TLQA 1BLUA 3A8KA 3L7UA 3N4WA 4ZMMA 4FS2A 3TAPA 1RT6B 2BM0A 1RWVB 1AB8A 2GIQA 1CJTB 3SQGB 3US5A 4G1QB 2ZH2A 4C97A 3PIOQ 5B08A 5LSOA 5KG3A 4HACB 2GJ2A 5KFNA 2HHXA 2AX0A 2JC0A 3UR3C 2H5JB 4Q2MA 2VU5A 2LDIA 2G0CA 3HVTB 5AE3A 4ZJQA 4RNFA 3QAEA 5JVHQ 4XIUA 4JI1J 3QFHA 3KDOA 1JLGB 2DK2A 5KG0A 3KMSA 1M5OC 5THWA 1P1LA 4DUYF 5GAGU 1VQ9S 3E01B 3VZIA 2V63A
chains in the Genus database with same CATH topology
5HROB 2KM8B 4HEA9 1K1QA 2M3DA 1URNA 1RQ0A 1N5YA 4A8OA 4N77A 2Q1LA 2QSWA 4YP3A 1VK3A 1YRXA 1FDBA 2COLA 2GV1A 1MROA 1WEXA 1FJCA 2IBOA 4G6VB 3OSPA 1RT3B 1JNZB 2HNYB 2B4VA 4NLYA 3MR2A 1HFEL 3NBPA 4HT5A 5JVGQ 2N3OA 2LEPA 2JVOA 4RNNA 4MKYA 2FDNA 4IG3B 1JMTA 4MK9A 2OO4A 5K14B 3EX7B 2DGVA 4MJKA 4TY8A 1TL3B 2NXUA 2FGCA 1FA0A 3TRGA 3GFYA 2B9XA 2G9OA 5LSRA 3DLBA 2ZVSA 3OL8A 1IR0A 1ZAVA 2MMYA 4H4MB 2MJUA 2FJBB 2DB1A 4X4RA 1HR0F 2MQOA 1M5PC 4F02A 2OD4A 2M7SA 4KV8A 4PWUA 4JOUA 3PX4A 4NX9A 2YNHA 4DL7A 4C98A 3CEDA 1Q16B 4YDXA 2CFXA 2MQNA 3MM6A 2UVRA 1FKPB 2CJBA 2NR0A 4C8ZA 3PHEA 1M1KT 4K4YA 5J1EB 3CCZA 3MEGB 2Z2MA 1S9GA 4DL5A 3JSBA 4LQ9A 1IQZA 4L6V3 4NLVA 4DQPA 4O3RA 3W3SA 3IWNC 4CZCA 1SJ1A 3PX6A 1UL3A 2K7KA 1RTHB 3V81B 4WU3A 4WYLA 2GMJA 3X3UA 1X4FA 3CC7S 3IRXA 4H4KA 4OI2A 4PXCA 4B3MF 3CB4A 1HNIA 5J2PB 5J2NA 2IBKA 3DLKB 1NJZA 3M1VA 1D9AA 2XG8A 2J5AA 3U1NA 1L3UA 4NWBA 1J5OB 1SV5A 2J0QD 4IH6A 2FLPA 3ZZ0A 1QY7A 3MFHA 1Q8LA 5F0UA 1MW7A 5IQ6A 4B3OB 2QA1A 1HPZA 2W8KA 4OLPA 5A8RB 3OSNA 1X4HA 2CVEA 2C22A 1LV5A 4XPCA 4KFBA 3EZUA 3PACA 1D8YA 3L7OA 1HBNA 1H98A 3DYAB 4LF4F 3THPA 2E1MC 1S7HA 4A8FA 4X4NA 2JEJA 2XS2A 4F3OA 1I1GA 2YTCA 3DDKA 4MIAA 4E8UA 4NA2A 1CC7A 1NH8A 4O23A 2CPIA 2MQPA 2E9RX 3D1HA 4B3RF 4RNOA 2EFQA 1YJRA 4QPXA 1SB6A 4PWDA 2HRYA 2N7YA 3LUYA 4KKOB 4AE5A 4PG4A 4ZVGA 3SCJE 4HH1A 1FRXA 3TVYA 2DH8A 3S7RA 4TU9A 5HP1A 3M4XA 1TQLA 2AGOA 2W9BA 1RT5B 4CO3A 3DLEA 4HI1A 5A0YB 4KGKA 3MDFA 1PC4A 3M2UB 5CXTA 1R27B 5IT4A 4NCAA 3MM7A 4I0WA 1RT2B 2ZH9A 2HNZA 2BQRA 5LMUF 2PMZD 5HMZA 4KC5A 1CQMA 2YNFB 1RT6A 1FDDA 2LQBA 2WRMA 3VAGA 2BR0A 4E98A 3C66A 5EUHA 4ELVA 1OS5A 3V2UC 2EI5A 2YKAA 3JSYA 4CO4A 4H54A 4R0EA 4EU0A 2OPRA 2FJEB 3EPIA 2JJ4D 5K8NA 1DRZA 4XK8C 2IM2A 2XEXA 4G1QA 1KN6A 2HPUA 2AJ4A 2K7JA 4CNYA 4D3HA 3MEEB 2NUHA 1PSDA 4K0KF 1Y7PA 4ZPDA 3I4HX 2HNDA 2RSQA 4DSEA 4AL6A 2QE5A 3OR2B 2R7RA 4R8UA 1ZPWX 3DLHA 4C8MA 4EEYA 2MZQA 3PFEA 5DDPC 2ZDPA 1LXNA 4QR0A 1N4LA 3CJ0A 4V19X 4JV2A 2DTJA 3T5HA 4C0OC 1B0PA 1R0AA 3VF0B 4NZ0A 4ES2A 3HVTA 2CPZA 4RW4B 3KK3B 3GG0A 2RJZA 3BQ2A 2V8GA 4NZ7A 4A8XA 3HKWA 1Q4RA 4M5DB 1ZBTA 2YX1A 2AF6A 4KSEB 3TARA 2VA3A 2O67A 1U8SA 1UVNA 2B5JA 4I67A 4Q0BB 4J9MA 4BS2A 4WJBA 5DG7A 3QAUA 2GC8A 4ECQA 3K5MA 3G6XA 1REVB 1ZM4A 3M05A 4P7VA 2FVRA 3KLFA 1KHWA 1XMBA 1GXLA 1H6KX 2V4JB 4XPEA 3MM5A 4DV0F 3OVBA 3F56A 2L41A 2FLNA 1XMQF 4QYZJ 3R5DA 2DT9A 2BM1A 4ZHRB 5A8WB 3PEJA 2RNEA 4IH7A 3JSMA 1OWXA 2WSEC 2LXUA 3CXCR 3TUZC 2XS7A 1YRTA 3BZQA 3E01A 1S49A 3OQ2A 1SKRA 3E3XA 4I6YA 3CDWA 2CPFA 1NJXA 3FDSA 1UJ5A 3OUYB 1UJ4A 2W9AA 2UUBF 2ACYA 4WFXA 5HROA 2VODA 2UUCF 2ZNZA 4UY8T 4WFBQ 1CPZA 1KS2A 4JV0A 2I9SA 2D3ZA 2DHXA 4DL3A 1KSPA 2CZ4A 2D7SA 4RW9B 4ID5B 5IZHA 3GWCA 4CT9A 1HHTP 3TYTA 2AJ1A 5AE2A 1QAIA 1QSSA 4PG6A 1CVJA 5CZXA 3O44A 1X4CA 2XLKA 1D9FA 4ZP8A 2MZ1A 4ED1A 1RT3A 2HNYA 3I87A 1WG4A 4D3GA 4DX8H 3WX4A 3MOJB 3IS9B 2IJFA 4CH7A 2EG1A 2R8IA 1JWWA 4Y65A 3ZZTA 1VIOA 1VRTB 5K14A 2K8GA 1TKZB 1XEZA 1P27B 1TL3A 1Z4UA 2RKIA 2QMWA 1WNEA 3K5LA 3PW0A 2L9WA 7FD1A 3Q23A 2MQMA 1GT8A 2N3LA 2OLWA 5L9NA 4A8YA 5G0RB 2V4RA 4H4MA 4J9RA 4DFJA 4AQYF 3OJSA 3QZ8A 3C6UB 2HAIA 4MFBB 1V3SA 4J9LA 2M8DB 4B3TF 4YEAA 3C46A 3M32B 1YBAA 3TVZA 2FVCA 2MJNA 2KB2A 3LAKA 1FKPA 2CQHA 3GYNA 4GC6A 2FGOA 3CCLS 4WZQA 3DLLQ 5J1EA 3MEGA 1HI8A 5KTQA 2EFNA 3KLHB 4YR0A 2C2DA 3CCJS 1X4GA 1X5TA 1Y5IB 2ZM6F 1FK9B 1R8BA 1RTHA 2JOQA 3CJ2A 4USIA 4Y2MA 3HPOA 2WTFA 5I3PA 1N5SA 5IS2A 2IC3B 4DN0A 2HFNA 3HI9A 2BE2A 4ELTA 3CIZA 2C3UA 3TAQA 5J2PA 4DF4A 4DSLA 3DLKA 2XCPA 1KTVA 5LXYA 2E5HA 1J5OA 1Y4ZB 2YKPA 3POTB 4IOCQ 4DSJA 2JL9A 2Z2LA 3TR5A 4J9SA 3L95X 4B3OA 5L8RC 3HF5A 4F26A 5A8RA 4Q5VA 3DXSX 1H7XA 4HH0A 1JLQB 4PCQA 2HS4A 3OW2R 3FNNA 1RTIA 3DYAA 1HQEB 2ILYA 3PX0A 1WHXA 3K58A 1BQMB 4QBUA 1H7WA 3HHDA 1X8DA 2JLEA 1DURA 1F0XA 2R7SA 4JI2F 5HN0A 3IBWA 1S1VA 1LOUA 4YMEA 3F73A 1YJVA 3PO5A 3KOAA 3RR7A 1VQ6S 3CCTA 2R8JA 2FJXA 2CPJA 2ZD1B 1LXJA 3H40A 3OXLA 2FJVA 1Q82T 1GNKA 4KKOA 3BO4A 4EZ6A 2RB7A 1EETB 3BGFA 2YKOA 4IDKB 2ZITA 3T9ZA 5A6PA 4ED8A 2AGPA 2HHHF 1FJGF 4LVOP 4FS1A 2KDOA 1FKOB 2KJWA 1LWCB 4WK1A 3NG8A 1RT5A 3VALA 3MD1A 5A0YA 4B9MA 4DQIA 4FN5A 4DSKA 4HYKA 3M2UA 2AW0A 3AH6A 2LQ5A 4I64A 3D0HE 4RBUA 5SZTA 4F4YA 1BQNB 1XTZA 3QMQA 3QGPA 3ULHA 2LEAA 3RU0A 4QQBA 2YNFA 3DRSB 3FMWA 1VGYA 2BABA 5FDLB 2XO7A 5DGAA 3FEYB 4BC7A 3T3FA 3JTOA 1SH2A 1TL1B 2BV3A 4MKAA 2JX2A 4EWTA 5CYJA 2KKHA 3SEOA 5F8GA 1NK4A 4KTQA 4LIRA 2KI2A 2ZC3A 3MPYA 4PUOB 4I2QB 4ED7A 4IRDA 1CG2A 3MEEA 3IR5B 6FDRA 4ZPCA 3PV8A 5E3QA 4PPDA 3OR2A 2ASJA 2G13A 3I56S 4ED3A 3M8QB 4WZMA 1KLMB 2O5DA 4ATNA 5KT7A 4F8RA 2OTJS 5E3AA 2FHJA 3HVAA 2ZFHA 4WKRA 1LWFB 1ZAWA 3H98A 5EDWA 3FSIA 3RTVA 1FNMA 4C11B 3Q22A 2B51A 2P6SA 3KLVA 2J9DE 2ROPA 2B9WA 2FLOA 2AJ0A 3SMZA 4RW4A 3KK3A 3CE8A 3VAIA 1JX4A 1NK7A 3G86A 3MFIA 3F44A 1YIJS 3BGRB 3MMCB 4K5RA 2HWHA 1UEUA 4M5DA 4K4WA 1K73T 3BSAA 2J0WA 5K8OA 3CMES 3NL0A 1M5HA 1YJWS 1EP4B 4PXEA 3SCIE 4Q0BA 3BO2A 3DM2B 1TKTB 2PDAA 4LMZA 3N5BA 4Y00A 2WSFC 1ZTWA 5KFIA 1REVA 1CEZA 1U2FA 2UVVA 3CJ3A 3GR1A 3NNHA 2V4JA 3OVSA 2YWFA 1S6QA 2BRLA 3GV5B 3GFXA 2M70A 4WFNQ 1QVGR 2DNKA 5DQGA 4USHA 2BYCA 3BR9A 5A8WA 1SKWA 4B9LA 1R6YA 1U26A 4NA3A 4OX8A 4P7TA 2HHSA 2N4CA 1YJ9S 1VC5A 1K8AT 2WOMB 1HI0P 4KBIA 3NWGA 1SH3A 4EGLA 4WIIA 2B0GA 4QWEA 3MUMP 4I68A 2K1RB 3BN7A 3EGWB 2B56A 1HNVB 2BANB 2VONA 2R7QA 2VH7A 3OUYA 3OTDA 3RR8A 2J0XA 3Q2SC 5CYQB 3PXGa 3K59A 2YWKA 3UD3P 4CCHA 3NKYA 5CHCB 3KG0A 4RW9A 4ID5A 4F25A 2DISA 1R43A 5DDQC 3VCDA 3IG1A 1WI8A 4ED2A 1SIWB 5CQGA 2HGMA 3QWUA 2XY6A 2VG5B 2R7TA 3OLAA 4W92B 1QM9A 1JJ4A 3IS9A 2W4DA 4Y3CA 2LCWA 3H2LA 2MB0B 2FPHX 4OZNA 2RRAA 2ZHOA 4DMZA 3L3CA 3PM9A 4F50A 1VRTA 4ECXA 3WC2A 4TU7A 4TKTA 1TKZA 1KOHA 2HIQA 2W7OA 2F8HA 4KB7A 4X4SA 4CIOA 5G0RA 4OZ5A 1QUPA 2CJ9A 2E5LF 2VASA 4B9NA 2KFNA 1RK8A 1SBRA 4MFBA 4C7QA 4LJMA 4QWDA 3M32A 4I69A 3OFHA 1S1WB 4OI4A 2AGQA 2QIFA 3O5TB 4JI8F 3FZ2A 4TU8A 2RILA 1LKZA 3TVKA 4U67Q 3KLHA 2GQ2A 1N48A 3AHPA 2M88A 3PO4A 4ECWA 2JFKA 3GILA 4JUZA 2XULA 1FNOA 2HFOA 5K8PA 1QTMA 2CJQA 4FNHA 3T9NA 3IN5A 1VQ8S 1FK9A 2DRAA 2Q6CA 5HQ8A 2QEXS 3M2RB 2FJWA 2D9PA 3BQ0A 2IC3A 4LT6A 4IQXA 2OPQB 4DV6F 2RMLA 2ZZNA 2O66A 3HZEA 4F67A 2J6UA 1S1TB 2Q43A 2DNRA 4YB1P 4ECRA 2IRXA 2XWXA 5KG5A 3POTA 3G9CA 3QGGA 2MZJA 2UVUA 4RKUC 3SSRA 3LO3A 3R5BA 1L3KA 2KXHA 1JLQA 5H1SV 2XMTA 2DGXA 5KFUA 4TYBA 2BDPA 4MKBA 1FRIA 2DIVA 3FJ2A 1HQEA 2MZRA 2NUUG 1VBZA 1BQMA 1UEVA 2VBXA 3LANA 1U48A 2EBGA 5AE1A 3PW7A 1T95A 4QIEA 5KFLA 4PR6A 3C2PA 2ZD1A 3I31A 4Y2KA 3B8HA 3GG1A 2BQUA 2R2RA 2IM1A 4IDKA 1EETA 2XB2D 1V3ZA 3DMJB 3OTCA 2KFYA 1FKOA 3MPVA 1LWCA 2ZNYA 2ADCA 4C2MA 5F9LA 3LALA 3QGIA 3DOMA 4WF9Q 4F4WA 2DCLA 2HYIB 3X1LB 4EBDA 4F4ZA 4I4BA 2RE1A 1SXLA 1U1LA 2LLZA 3M8PA 2QLWA 1BQNA 3HK2A 2KHCA 3HLUA 4HI2A 2DITA 4I1TA 3VQSA 2OFGX 5FIIA 3GIJA 2IVMA 1NU4A 1S6OA 2ZH4A 5A8KB 1U47A 5KFJA 5FDLA 1VS3A 1RT4A 3AJ1A 3WDOA 4RWWA 4I7FA 4OJGA 1TL1A 1M5VC 3Q0AA 3V6JA 3TUJC 4O44B 2BQ3A 1CC8A 4ZDNA 3U02A 4O3SA 3DU5A 3OFEA 4X2BA 3OJUA 4PUOA 4I2QA 3A1YG 4PQAA 2HHUA 5AXKA 5DO2A 5AJ3F 3PKYA 3HHLD 2AQ4A 3KK2B 3FCHA 4FXVA 2PMHA 5CCMA 3DRPB 3M8QA 1KLMA 4U7UK 5IM0B 1KTQA 5K9FA 4WYWA 4C3KA 2P5VA 3RRHA 4ECUA 4ECTA 2CYYA 3RB3A 3H5UA 5B0AA 1DJ0A 5KFRA 3HFKA 2KYZA 2NREA 4QPTA 3SCKE 3U1LA 3OHAA 2EG2A 1XK8A 3BGRA 3MMCA 4CO0A 1BGXT 2ZE2B 1VBYA 4DL4A 2E29A 3HKZD 4WXOA 5IT0A 4NLGA 4RBVA 1EP4A 1R8HA 2N4DA 2PGCA 1TR0A 5DM6Q 2MKKA 1S10A 4RU9A 4FBUA 3DM2A 1TKTA 5DQIA 5I3UB 1ZTTA 4HDGA 2ADBA 2GMLA 1B0VA 2J8AA 3DOKB 3TA2A 3T5LA 3JB9k 2Y1JA 4DR1F 4LFBF 3E51A 3DHWC 2D3OR 3VAKA 5HLFB 3RRGA 2LA6A 1O0PA 2DNMA 1ZOTA 2ROEA 1YG0A 2WOMA 2QA4G 3IAM9 2VQFF 4CH1A 2MHEA 1KEKA 3QGHA 2I2YA 3N28A 4KE5A 4OZJA 3PNIA 2UXBF 3I5BA 2K1RA 4BWJA 2BANA 1HNVA 2G1DA 4G1IA 3ZFVA 1Y3KA 4PG7A 2CJKA 5CYQA 2MY8A 2Z4PA 4NRTA 4DN9A 5EWEA 2E5IA 4QJVA 2HVZA 3M9OB 4ZLPA 4X66F 4DQSA 2LA4A 1LK5A 5KG1A 5IXUA 4RX6A 2CQCA 2RDIA 2ZJPQ 1S76D 5KFVA 1TKXB 3RBEA 5F8MA 4BHQA 1FRLA 1JKHB 2VG5A 3HJFA 3ZZOA 4EO8A 2P9GA 3OLBA 2Q66A 4K4VA 4TYAA 1K0VA 2M4MA 5E3PA 2XMVA 3CPWR 4ZP7A 3SI8A 2CQ1A 2LXFA 3B4MA 5KFMA 2AV5A 4ZPBA 4ILMA 5HMXA 5IFMA 1WHYA 4MMOA 4YB7A 2Q3PA 4UOCA 2FJDB 2IVYA 3PFOA 4DR5F 3LF0A 3IXQA 3C6TB 2I38A 4R25A 2XWYA 2ZBIA 2VBZA 4TLRA 5C24B 1FEHA 4AXIA 4B17A 1VJWA 1G6BA 1HHSA 1RWUA 5KAKA 5EX0A 1XERA 4LFCF 3QLHB 2EK1A 1YTYA 2E1CA 1C4CA 3IA0A 2P6TA 1W25A 1VBXA 5I42B 3THTA 4U7CA 4FYDA 2HS0A 4OQJA 4MK8A 3C8YA 3ZZRA 5JUMA 5LJ5Y 3G96A 2CQ0A 2V8VA 4BCAA 5DG9A 1Y3JA 2XSJA 1S9FA 2AJFE 4DQRA 3O8WA 4QR1A 4O4RA 2DPIA 3CCWA 5DM7Q 2GFFA 4QW8A 4IKAA 4DPOA 2V8HA 4O0IA 3H2UB 3KLEA 1N36F 5GAHI 3D2WA 2GHWA 2OPQA 2ZHAA 4ED5A 3UCZP 3I5CA