2FHJA

Crystal structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
296
structure length
296
Chain Sequence
b'MEINGVEIEDTFAEAFEAKMARVLITAASHKWAMIAVKEATGFGTSVIMCPAEAGIDCGYVPPEETPDGRPGVTIMIGHNDEDELKEQLLDRIGQCVMTAPTASAFDAMPEAEKEDEDRVGYKLSFFGDGYQEEDELDGRKVWKIPVVEGEFIVEDSFGITTGVAGGNFYIMAESQPAGLQAAEAAVDAIKGVEGAYAPFPGGIVASASKVGSKQYDFLPASTNDAYCPTVEDNELPEGVKCVYEIVINGLNEEAVKEAMRVGIEAACQQPGVVKISAGNFGGKLGQYEIHLHDLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formylmethanofuran--tetrahydromethanopterin formyltransferas
publication title The structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
pubmed doi rcsb
source organism Methanopyrus kandleri
molecule tags Transferase
total genus 77
structure length 296
sequence length 296
chains with identical sequence B, C
ec nomenclature ec 2.3.1.101: Formylmethanofuran--tetrahydromethanopterin N-formyltransferase.
pdb deposition date 2005-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01913 FTR Formylmethanofuran-tetrahydromethanopterin formyltransferase
A PF02741 FTR_C FTR, proximal lobe
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhjA02
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhjA01
2FHJA 2FHJD 1M5SA 1M5HA 2FHKA 1FTRA
chains in the Genus database with same CATH superfamily
1WHYA 2FHJA 1HBOB 3HVAA 2BE2B 4USHA 4ILMA 2ZITA 3B82A 2E1MC 3G71S 3QLHA 5CQGA 5CXTA 2QL7B 3OPKA 2JVRA 3IBCB 1ZBTA 2X1FA 4YR2A 1OPIA 2B8PA 2MZ1A 4MK7A 3DRSB 2VBXA 2B4OA 5EDWA 2JL9A 2HHXA 4NEZA 5D3GA 4RNOA 1JKHA 2FJVA 4FVCA 4NLSA 5F8IA 1GAOA 3I4HX 3UVJB 3AQOA 4LF1A 3GSDA 1X4BA 2OH2A 2CJXB 1UW4A 3SFGA 3C66A 3MTKA 4OYWA 2E5LF 2FVSA 2GV1A 5CYMA 1CG2A 2C1EB 3TVZA 3MM5A 1LWFB 3MGJA 3QIDA 1UAWA 2GS8A 2FQQB 3K17A 4CO5A 1KHWA 4YR0A 1S48A 4NLOA 3OL8A 2IY5B 2N4CA 1ZAVA 1ZH5A 2PFDA 3K59A 1HNVA 4I6AA 2MKKA 2M88A 1CJUB 2RHQB 4NZ6A 1TKXA 5B09A 1FE0A 1CS4B 2DHXA 4GVBB 1EETB 3M1VA 1SIZA 3EJMA 4JI3J 2BOAA 5B0EA 4G1QB 2ABYA 3NGTA 4AD6A 2RUSA 3R2CJ 4P52A 3M7VA 5DG8A 3VALA 2I6WA 2ZC4A 2YWKA 3N28A 2Q3PA 1D9FA 1X7VA 3KLGA 3N01A 1GEHA 5IS2A 3LWLA 3RRKA 4HHUA 3K58A 3QATA 4B9VA 2WRMA 3EVWA 3TP2A 1HQUB 3GU0A 2DGWA 5C24A 4NASA 1NMEB 4TYBA 1P27B 4H4KC 4JI5F 3I0RA 1ZA2B 1N54B 4ZOSA 1CJKB 3DN9A 4LRFA 4WXOA 4Q44A 5KFTA 3TYTA 3QFHA 2GFFA 3R97A 3I0SA 2MKSA 2LQ9A 4ZVFA 3VAHA 1WI8A 1WG1A 1S49A 5IQ6A 5EWFA 4NZ7A 1D1UA 3S1TA 1Z2ZA 3DM2A 3CJQA 3CD5A 1LWCB 3QT8A 1NM2A 3CCLS 1RSCA 2GIRA 1BQMA 3R5JB 3M8PA 3I87A 2Y9HA 4OIXA 1FX4A 3IP0A 3KLFB 5IM0B 3NLCA 2I8EA 4IKAA 3KKFA 3PW2A 2ASJA 1Y00A 4ENOA 1QAXA 2HZAA 4J91A 4ZVRB 2Z57B 2CJ9A 2B7CB 3ZZYA 3MURP 2CQHA 2C2ZB 3H40A 4AQYJ 3C6TB 2UXCJ 3PO5A 4ZN1A 3OXLA 2VOOA 2NUHA 2PMHA 5BYQA 3KK2A 1KS2A 5KFIA 3GPAA 5C5JA 1FVSA 2Q6BA 5DJBA 3A1YG 2ADBA 2LVWA 1KHVA 3OFEA 5KT7A 4BBYA 1VLYA 3VTIA 2Z2ZA 2CWXA 2J9CA 2VH7A 4L3NA 4OYZA 2BACA 4DS5A 3QWUA 1CJVA 4R5PB 1X0PA 2J8SA 1TK8A 1FK9B 2HRYA 5E3RA 1Y5IB 4ZVTB 3ENVA 1MU2B 3RB6A 3MCMA 3IG1A 3DLEB 4P6QA 5D4NA 2FVQA 1TKTB 3DRRA 5FDLB 3DOLB 1FTCA 1K44A 3IN5A 3BKTA 3WQPA 1HI1A 1U1KA 2DY9A 4UOFA 1FO1A 5CCMA 2CPFA 4N8NA 3RTVA 1ROFA 4JV5J 1NO8A 2V4JA 4DS4A 2NZ4A 3HHLB 3MF5A 4UOCA 2HIQA 4KHRA 6FDRA 3PIOQ 3SMZA 2Q66A 2HNZA 3ZXWA 4FF2A 4Y2CA 4MAKA 4X65F 4IRKA 1FXLA 3LO3A 2ZH7A 2C2NA 3NNHA 2ZOGA 1NJWA 2ZHBA 2ZE2A 4C8YA 2J7KA 1T9TA 3IO1A 4MIWA 2XO7A 2AU0A 3CDBA 4LBHA 1VQ5S 2IA0A 4DQIA 1RWUA 4DR3J 3BEGB 5DQGA 2GGPA 3IAM9 3T5JA 3DOMB 1NEEA 4ZVHA 3LP1B 1YRXA 5IXUA 4M5DB 1YRTA 1QTNB 4ED8A 1VOMA 1SVDA 1NZ8A 3CPWR 3MMBB 1DY3A 2AP6A 1OY9A 4IQXA 1RT6B 2H5JB 4OV1A 4USMA 4ZLJA 2ZNYA 3AXKA 3TAQA 1GK8A 2FJXA 4CWBA 1VQ4S 4FDFA 1DQ9A 3HP6A 1OO0B 2A2CA 4IFVB 1MROB 4PXDA 4ZVEA 1X4FA 4URQU 3Q8RB 4TYAA 5A0YA 3WC0A 2OPSA 4KTQA 4HTJA 4UUXA 2H3EB 2LEAA 4M5KA 3LALA 5E7OB 1WI6A 5IT4A 1KQSR 4FF3A 1X4CA 2BJ9A 4Q8EA 1HLWA 4CLUA 5M2UA 1R0BG 3SQOP 1VC0A 5GADI 4U8VA 3UD4P 2F3JA 3PW4A 2AMCB 4Q2MA 4EI2A 3P6YC 2W8LA 4QWEA 3EGWB 3HFKA 4DQQA 3CJRA 3MPVA 3DLHA 1WF1A 4B3TF 5D8HB 4Y65A 5HI7A 2QJ3A 5ETOA 3DNCA 3EVMA 1NKCA 2O1PA 3FRZA 1S10A 2YY3A 5JVGQ 1NK0A 2ZH2A 2WB4A 1I94J 1SXLA 4J9KA 3HHEA 2B3TB 4ANDA 4PABA 4DX8H 1YITS 2W8KA 2PA3A 1HARA 1K0VA 4MK8A 3G9CA 2E7WA 3D0GE 1X9MA 1DZ5A 5E3PA 3TZWA 4WJBA 1S6QA 2X3DA 4AFFA 4RUBA 2MQ8A 2ZDOA 3D7SB 3OHBA 2E5JA 4X62F 2CYYA 5JXSA 5L9XA 3VR1A 2M4MA 2J76E 4LFAJ 2GMHA 4V19J 2R8GA 4LFBF 1Y11A 3NCRA 4KFBA 4Z37A 2R7RA 2NXNA 1HWIA 3CCUS 1ZTTA 2IC3A 5J2NB 4JI2J 3JSRA 4DMZA 3MD1A 1BUXA 4EYHB 2P2CB 2YNIA 5LMUF 3ITHB 1YLXA 3BKUA 4KPYA 1RABB 1VQKS 4KIAA 4KR0B 3JTNA 1U1NA 1UFLA 3ZFVA 3MR7A 4FYYB 2AEMA 2IJNA 2XS7A 4AUKA 3MM7A 2UVRA 1F2GA 2DNKA 1UZHA 3C15A 1JK9B 3P45B 2XB2D 3KUHA 4Z7CA 4RJVA 4F2SA 2LKZA 2DO0A 4YS2A 1HYSB 2HBZB 3DLGA 2BUNA 3TA0A 3UDVA 1MWYA 5F8MA 2PSZA 4F7VA 5DQHA 3FBFA 2X1AA 1FKPB 5A76A 4DV7J 2V34A 2FLNA 2VQEF 1C1CA 4JI7F 3AOCA 2X1BA 2YNFA 2DO4A 4CYUB 3ZTPA 2B9XA 1YJTA 1S1XB 2KDOA 2V9KA 3CDAA 3NG8A 2VJVA 4NMLA 3GV7B 1QAYA 3WX4A 4C11A 4B9UA 2UUWA 1FERA 1UFWA 3KLHB 2Z56B 1XMBA 4O4GA 4FXDA 1P8GA 5THWA 1UL3A 3VGUA 2M70A 2L41A 3MXHP 1ZETA 2DIUA 2DGSA 2DBBA 2LYVA 1YBTA 2DXFA 1NUEA 4JI0F 1T9WA 3B54A 1F2HA 3ZNJ1 1LFPA 3Q8YA 4NRTA 1QTMA 1RQ0A 5K8MA 4N5SA 4RBUA 1KQKA 1I51B 2DYAA 2AYGA 5D4LA 4FBUA 3MMCA 3C8YA 4KSEB 1S1UA 1HQEA 4J5OA 2YKMA 1V5IB 1C0TB 2VC0A 2HW3A 3MFIA 5AXMA 2QSFA 3PJWA 1U45A 4EWTA 4CDIA 3UDLA 2VHGA 1K0TA 1N5VA 4F4XA 5KT3A 4CI0B 2DXDA 2XSJB 1F1BB 1SH3A 1SL1A 3F41A 3BJYA 4O3QA 1U7LA 1ZYQA 4K4ZA 5DGAA 2H9ZA 5KG7A 1NJYA 2ZH4A 3VGTA 3KG1A 1ZM4A 4WFNQ 4LF4F 2IMOA 5F8GA 1HNWF 3UCZP 4E2FB 4KB7A 2HVZA 4PG5A 3C19A 2YXLA 2FLOA 2E7VA 5HMWA 1L3UA 1PGZA 2DEIA 5DO2A 3G8TA 4M5NA 5K9FA 4DG1B 2YH0A 3WDOA 2HHHF 1RTIB 1Q7LB 2LMIA 2RUGA 3PR4A 2BM0A 2BMBA 1VRTB 1WDTA 1ZM9A 1H2VZ 4WP3A 1Q82T 3FFIA 3D28A 3GE9A 2VDIA 5L46A 5ETTA 2Z30B 2F4VF 4WFAQ 3EE3A 5L38A 3NGKA 1R8AA 2B9YA 4KHMA 2QN6B 2NR0A 2WONA 1VBXA 3PW5A 5DZ7A 2B4PA 1RT1B 1DTQB 3E01B 1JLGB 1T0TV 3OR1B 3THVA 1IKVA 1IR2A 1T3OA 5AE2A 3JSMB 4CLYA 4LF8F 1RTDA 3OTOF 4OX7A 1LXJA 3P49B 1JLBB 5HROB 1Q95G 1NK4A 1Q86T 2FVPA 1R27B 4ZLLA 3KJQB 2V67A 2P9CA 4YOEA 2ZKTA 4K8RA 4CO2A 5B7WA 4QWDA 1SQEA 2LQ8A 3VAMA 5U47A 2R8JA 3CF5Q 1XJWB 1Q7YT 5RUBA 3MM8A 5I42B 4KQZA 4OL8A 2M2BA 2JC1A 5JVHQ 1PYTA 3DOKB 4CT8A 4ELUA 2XS2A 3M2VB 3PYDA 5L39A 2CZ4A 3S8SA 4K2XA 3RBXA 3FSYA 4OI4A 2HRTA 3ISND 1HPZB 3JQJA 1U47A 2BE7D 4N56A 2NXCA 4B9LA 3RAQA 2C2MB 5HLFA 2AZ3A 4NCGB 3MM9B 1UETA 3MUTP 2AV5A 3CNQP 5F9LA 2VC1A 2C2DA 3OBIA 4PXCA 3HZGA 2R7OA 2UXDF 3M2UA 5C42A 1N8RT 3OTDA 1WD6A 4JYAF 1Z1ZA 5HJXA 5C2GA 2AJ0A 1X5TA 4ZIVA 3CIZA 3B6BA 4NL5A 5KFSA 2QLBB 1ZS6A 3RBEA 2BRLA 2HFUA 4X66J 2HMIA 3JYTA 3UN3A 3DXBA 5B0AA 4ELTA 1J5OA 3N5FA 3BBFA 3D54A 2X3GA 3GB0A 2KRBA 5HMXA 2DGOA 2CPJA 3DDIA 3BZQA 2YKQA 1RHUB 4V19X 3DU6A 3NGRA 4A48A 3JTPA 2CXEA 3GR1A 2OPQB 3VAGA 4U95A 3Q0AA 2I0XA 3GJTB 5CH7B 1F9EB 1NKBA 3ISZA 1XMOF 1S6OA 1Q78A 1JXEA 4CM0A 1MG7A 2JSXA 3TZZA 4DL0C 4DQSA 3G4SS 5L9NA 1ULRA 4ZJOA 4PUOB 4UTGA 1H2TZ 2DH7A 4K0KJ 1NK6A 4NEYA 4DUZF 2XNQA 4YEAA 2FD2A 4RKUC 3T1HJ 4O44A 3JQKA 4HDHA 5L1JA 1YWXA 3T5HA 1HNXF 1DTTA 2M8HA 3G82A 1OIAA 3PW0A 2ZBRA 1MSWD 2QZ8A 2CJBA 3NGDA 4WIIA 4EGLA 1UEUA 1X0FA 2Z2LA 2FIUA 2QLJB 3D1QA 2ZJRQ 2AIRB 3I56S 4K4TA 4GO7X 1DLOB 4MK9A 1WTFA 4AL6A 3I96A 2KM8B 1AT1B 2CZVC 4U7UD 2ZH6A 3KK3A 1UJ4A 5KFHA 2LXUA 5JMNA 2UUAF 2ALYB 4LF9J 5KFLA 4PQUA 5HQLA 4WWSA 2QL9B 4LR7A 2CA9A 3O44A 2XO6A 2VBZA 3UVJA 2K2PA 5KT2A 2RAQA 2KYZA 3O2IA 1QDUB 3PYFA 3H5YA 1UWBB 3TVYA 2F5GA 4ECQA 4DL5A 1FRXA 4F04B 4OJHA 3J7AN 5ITHA 1Y9OA 1EB0A 3WX8A 3HCXA 1Q8KA 3HO1A 3MR2A 4QWAA 2R42A 2B9WA 2VBWA 2C22A 1UA0A 1U09A 1VC6A 2UUBF 3FUYA 1QY7A 4LF7J 4RW8B 2ZH3A 4DR6J 5DM7Q 4YB7A 2V2ZA 1FT8A 1G4CA 4OYXA 1U6ZA 2KTQA 1P9QC 2ZC3A 4LUBA 4RW4B 1JXLA 4CIOA 2HFOA 2DGTA 4G6VB 1VRQC 3EGZA 4N41A 2BANA 1X9SA 5CYQB 2HQDA 1T8EA 2DCUB 4RW9A 1EKSA 2KG1A 1UCNA 3OLAA 2QX0A 3PHEA 3CSKA 1YJUA 4EFAC 5LOQA 2LQ5A 1IJFB 2ZBPA 3D68A 1OMSA 3NS5A 2RILA 3W2VB 3W66A 5FJ4A 2MY8A 3VF0B 4IO9Q 2NCKL 2JEIA 1REGX 2FHKA 4DV0J 4KJIA 1SC6A 3CXCR 3FEYB 1SJ1A 3POTA 2OPPB 3EZOA 5F0WA 2CQ0A 1PBUA 2ZJQQ 2FZGB 2GVDB 4DL2A 2OLWA 4QIFA 2KJVA 2XMVA 1U2CA 2AGQA 5K14B 4OI2A 3L7PA 4J9UE 1SUQA 4LF6J 3MECA 1HNIA 2XBPA 5A2QU 2A0FB 2OPRB 3W8PA 5G0RA 3QRPA 1XK8A 4O3OA 3G6ES 2BJEA 4DR7J 5CAAA 3PKYA 5DDQC 2NLWA 1LK7A 1NJXA 1URRA 3F56A 3F44A 1S76D 2U1AA 3Q8QB 2Y1RI 4OYMA 1KN6A 6FD1A 1YGYA 3NOCA 5AJ3F 3BGRA 3V2UC 1O0PA 1YRUA 5ETQA 4RW7B 4FKXA 1IBMJ 3VHQA 1RT4B 1XIQA 2MLYA 3QBCA 3KLFA 5GAGU 4PYDA 4IDKB 4DN9A 3SXLA 3KG4A 4QWCA 1WELA 2HNDA 2DB1A 2XY6A 3VAKA 3JAMY 4KYZA 5KFVA 3O8WA 1S0VA 4TQRA 3AFGA 4J9QA 1FNXH 2JWNA 1MN9A 2EG2A 4W4MA 1GH8A 2W9CB 3NRBA 4JI1J 2Z0GA 2WTFA 1D8YA 3B4DA 4X4RA 3QRRA 2B5JB 5FLXY 2VKZG 3WIVA 4CQ1A 2LU1A 3ZTOA 1EHWA 4KC5A 3UFCX 2ZVIA 1M5HA 1Q0NA 5L1KA 2MKCA 1B0PA 3IR7B 1YBAA 4WF9Q 5BXIA 3IS9B 2ATCB 4ILRA 4YY3J 3RW6A 4R25A 4LREA 4LMZA 2DGVA 1HHQA 3NS6A 2Y1JA 1MU2A 4O3NA 4TLQA 5IOLA 3T1AA 2DHGA 4USWA 3DU5A 3FZ2A 1XNQJ 2OJ3A 1RWWB 3GIKA 3D3BJ 2PMWA 2V4QA 2QV6A 4CT9A 3NXZA 3QJPA 1G1XA 2YVSA 4QR2A 3P5TL 2DD8S 5IV3A 2IIHA 3UCUP 3W2WB 3PKMA 3RRGA 3ET6B 2YBVA 2HFVA 5IWAJ 5EX3A 1VR6A 3VAFA 1X5OA 2J6TA 1F9HA 2VPYB 3DHXA 1G7CB 3NY0A 4DSLA 3NKYA 3IAS9 1B64A 4QQBA 1DURA 2RDDA 1RCOB 3IWNC 4NLWA 2KVIA 2E7XA 2IMWP 4M5JA 4I2QA 5CZVA 2OAUA 1U4BA 1ZA1B 2LXIA 3OVBA 4QW8A 3ILIA 4L73A 3TI0A 5K8OA 4WTYA 1YTYA 1LW2A 4JI6J 3EXYA 1RWXB 1J27A 5D6GA 2GVZB 5KG0A 3J7A1 1X4DA 4H4MA 2RNEA 2XQCA 2WSEC 3QSYB 1KOHA 2I2YA 2BYCA 1WC5A 3TX0A 5HMYA 2GNKA 4J9VA 4OLPA 1GX6A 2C28A 2DVIA 4FPRA 3CJTA 1JJ2R 2VOPA 4DUYJ 3K0JA 1ZPVA 3G87A 1HBUA 2XZWA 2QEXS 3KJFB 4Q43A 3EDRB 1FI4A 5DDRC 4J9SA 3DGVA 3RR7A 7AT1B 1RWOB 1FRKA 5C25A 5A8KB 2WSFC 3K8WA 2DNPA 4MYTA 1EP4B 1F3FA 2VG5A 1KFSA 1WUUA 3LTOA 1I5OB 1YBUA 3UCGA 1TAUA 5H9EK 2V50A 3CEDA 4BC7A 5I4MA 2CG8A 2GC8A 1H72C 2W2PP 3A12A 5HBMB 4RX6A 4JI3F 2IJRA 4QCLA 3FJ2A 5CCLA 2XMAA 2PFFB 4YB6A 2DNLA 2NREA 3AA8A 3MEEB 1UVMA 1IM6A 1U2FA 2QYCA 2W2OP 1EJ7L 4EBEA 1E6VB 1S9FA 1TL7B 2RIJA 3CJKB 2RQKA 2DISA 5GMKa 2HFNA 1WDDA 4K5SA 3UNGC 4LSNB 3GG1A 2H5IB 1O5JA 3AB4B 4WXWA 4F26A 2MJUA 3ZZTA 1CEZA 3KOAA 2HGMA 2KZMA 1R6YA 3G8SA 1HBNB 1YJ7A 3M6XA 3CUNA 1OY6A 4CO3A 1T9YA 2W7PA 3HSZA 3BGUA 2ZHOA 1KD1T 4CLFA 1WC1A 2NXUA 1RT5B 1VK8A 3TA1A 1U6FA 3I6PA 2IPOB 2UVWA 4LSLA 4ANCA 3G96A 3J80Y 1S6PB 4ITSA 2UU9J 3CB4A 4OX6A 3MUVP 1WKJA 5H9FK 4WE1B 3UQSA 1FFGB 4USIA 4Y3CA 1P1LA 3GJRB 1HMVA 1KR4A 5J2PA 4QYZK 1NJIT 4U67Q 4PWDB 1FNMA 4NLRA 2HNYA 3K5PA 2QFJA 3EPGA 2SXLA 1Q81T 3BM7A 3NNAA 3GONA 2YNHA 4BHQA 2FLPA 4YDXA 5CHCB 4RL1A 3EICA 4AQYF 2ZM6J 1NSKL 4X4QA 2UXCF 2MQMA 4ZHRB 4ZJLA 4NXMJ 2AF6A 4ZLNA 2NQPA 2GAHC 4E98A 3R7NB 2R7UA 1AZSA 2PIIA 1PO6A 2CJKA 4CLTA 1XR6A 2C3OA 2KKHA 4ID5B 3UO0A 2DR5A 4HH0A 3UR3C 4LT6A 1RTZA 3CC4S 4EMDA 1RKIA 3H2VE 2PN6A 1HIYA 5H1SV 2ZOMA 3DHWC 4J9RA 2CPDA 4X4VA 1VBKA 4ICLB 3D66A 3QQCD 4Q0BB 4HACA 4OHWA 3D5MA 3N6MA 3T3FA 3MM6B 3QO9A 4NLXA 1KDNA 1UMJA 2MKJA 4A8YA 3KFWX 2HBRB 1I1GA 4DZ6A 4BDPA 2JVOA 3SCLE 5SUHA 4JV5F 1E6YA 1NNDA 1HW9A 5IT9Y 1HQ2A 1FKPA 1GXLA 1W2IA 2MJNA 3GTYX 3TANA 5HO4A 2PT0A 4LRDA 4NLPA 3QFWA 2YKNB 2J0QD 1XNRJ 2RT3A 2EFQA 3PIPQ 2ZZMA 4A8FA 4J9NA 4OZ0A 3O3LA 4NA3A 2RJZA 4Y2AA 2KFYA 1UEVA 3U02A 3GIMA 3DRPB 2XMMA 1S9EA 1JLCB 3TEGA 4WP8A 4DR3F 2E9TA 5GAHU 2ZBIA 1X4HA 4I67A 1UVKA 1EAYC 4DL6A 5CZXA 4C98A 1TL4A 4DSEA 4ZPTR 3A4TA 3M30B 2QC3A 3Q22A 2POKA 2XMKA 1N6QA 5BYSA 1RKJA 2MDAA 2F9JA 2HVDA 1SBRA 4KY3A 5I3UB 4H4OB 1RBAA 4OHVA 1TVRB 3VGVA 2HK2A 1BY9A 2FGOA 1D9DA 3S01A 2QMUB 1LW0A 2IDEA 2CQIA 2OIHA 3NAIA 1B7FA 2AYMA 2RKIB 4DX7A 1TUWA 1TV6A 1U1QA 3OL6A 1MWQA 2WHOA 3AB2B 2CIMA 3ETMA 3ONQA 3E2EA 2MKIA 3AOAA 4RPFA 4ZVPB 3CIMA 1X5SA 3TRGA 3MR5A 4CO4A 4TU9A 2MZRA 3AY0A 3WC2A 3MTJA 4F4WA 1NK8A 3NP5A 2R7TA 1NSQA 1VI7A 1XEZA 2ZH8A 4JI8J 3R5CA 1X4GA 2J8AA 1QE1A 2R2RA 1QSSA 5ETSA 1KLMA 3HVRA 1SJFA 3FNNA 2EKYA 2BX6A 2Q43A 4QR1A 2XSFA 3BH7B 3UWTA 3CC7S 3OJSA 3BPSP 2CPXA 2GQCA 2CQBA 3FQKA 2DTJA 3JS9A 3T5LA 4KH1B 4DFPA 4I2PB 3UW1A 1KWMA 1AFJA 4O0IA 3HHLD 3GJQB 1I94F 3UPFA 4DL3A 4DCPB 4BC9A 3HD2A 4ZCMA 3L95X 4P10A 1IKWB 1LK5A 3Q8VA 4O3RA 1RAJA 3SQGB 3CC2S 5KG1A 1UVJA 2W1BA 3G6XA 1KSPA 4WFYA 1KRPA 4M5GA 2AGOA 1JLFA 5DRKA 2K1RB 3J81Y 4Y2MA 4LFAF 2JEFA 3CGIA 5GAHI 2HHVA 2ZOFA 3TAPA 2MZQA 2HK3A 2VU5A 2XYGB 3TJ8A 4EBDA 5E0OA 2OSQA 5EX0A 1W25A 1S1TA 4JI2F 1YI2S 4L74A 4L76A 2QLFB 3MWBA 3VQSA 2XLKA 2HQGA 4GKJJ 1AUSL 3ZC4A 4FN5A 3AH6A 4ANEA 3FVYA 2RB7A 2A6MA 3CDUA 3TZYA 2G2ZA 5F8NA 3M6VA 5E2QA 4L75A 3IXQA 3CT9A 5SZTA 2J9DA 1F5BA 4KO0A 1LWEA 2WCXA 1M1GA 4YDDB 3Q83A 2DHSA 2QA2A 3NBPA 1PJ5A 3TARA 2R7WA 2XYHB 4K4XA 4JB8B 2FGCA 3R1LA 2KT5A 1T03A 3ULHA 1FDNA 3WIUA 1W2BR 3KLEB 4QBUA 1ZM3A 4R0JA 2GHPA 1RT2A 2CQ2A 2BE9B 4K4VA 1T7PA 2W25A 1H3DA 3ZNUA 4DPOA 4A8SA 4IFYB 1QAJA 4WKRA 5B0DA 4DV7F 2OTJS 1VRUA 3LGHA 1S0NA 2CPYA 2VUGA 1WSVA 5IT0A 5CABA 1T11A 1GQEA 4LBPA 1KVKA 3OFGA 4DR5J 2DNYA 2ZWPA 1M5VC 1YX2A 4C8OA 2V2QA 4JBCA 4MFBB 1DJ0A 3KLVA 3GQCA 4ALZA 2J9DE 4TQSA 1HBMA 3M8QB 4B3MJ 1NRKA 1RHQB 4UZCA 3L7UA 4W90B 1SCJB 4WCEQ 4IR9A 1RBOB 1SKSA 4YHHJ 1IN0A 4KT0C 3LPYA 1RYSA 3HJVA 2F65A 3OD2A 1NHKL 1U1LA 1MMNA 4IH7A 5B0GA 4YP3A 1MW7A 2W2NP 4NYPA 3IM9A 3MOJB 1RT7A 3PR5B 3BR9A 1WEXA 3HK2A 2DHHA 2CRLA 1G6BA 2EPIA 3QT7A 5GAEI 1FESA 1F5AA 4P2XA 4F25A 4KV8A 2HBQB 2K06A 5KFPA 1VJWA 3GMGA 5DLGA 2J7WA 5F8JA 4F3QA 4ZPDA 1FDBA 1C0UA 1JLAB 4RUHA 3J7Z5 2F8EX 2VB6A 2IBKA 2PEBA 2W9AA 3CD0A 2HGNA 2I5JA 2UXBJ 3PEHA 3PEJA 3KK1B 3H2UB 3R27A 3CCMS 1H2UX 1S1WB 1N5YA 4Q5VA 3HHKA 3CCJS 2ACMA 4B3OB 4ZVUB 5B0BA 3HVTB 2XLJA 1MMDA 2WSCC 4YUDA 1PBAA 2BKOA 3A3NB 3M9NB 1V3RA 5F3ZA 1REVA 2VG6A 1T02A 1RDRA 4YFUA 2CVEA 3BO2A 1RA6A 2V63A 3QLHB 2LDYA 4V1Ak 5AE1A 3Q86A 1CVJA 2F40A 3DLKA 5KFXA 5BJRA 2IM0A 3C3LA 4NLVA 5KFUA 3A8KA 5IV4A 5D3GB 1JKHB 4RW4A 2QIFA 2BW7A 3AQPA 2V6AA 1EKRA 2R2TA 3MEDA 4IH6A 5HQMA 1TKZA 4EK2A 1Q79A 2K8GA 4D3HA 4K2JA 2XEXA 3I9V9 1JMTA 1FD2A 2AQ4A 2FC9A 2O3DA 3QGIA 2FUG9 5KFNA 4F0HA 3UE2A 5CYMB 5C7PA 4TVAB 2O66A 4PG8A 4MMOA 3R2DJ 2PD1A 2ZEJA 3QGPA 5B0CA 4DBQA 2VASA 1Q5YA 1CPZA 2BR0A 1HNZJ 2CWKA 1F6TA 4QZVB 3DRYA 3SV3A 1ZAWA 5DETA 5EGYA 2EK6A 3D0IE 2KVQE 1YJWS 2QA4G 1U2RA 4PYAA 1HNVB 2HLTA 1C1BA 3V4IB 3CCWA 3IR6B 1U0SA 2E9ZA 1NU4A 3M1VB 3ZTQA 3JXOA 5L8RC 5BR8J 5LL6d 2W24A 4OYPA 1DAXA 3DMJA 3MCSA 1TZ0A 1HA1A 1NSPA 3KLGB 4DV6F 3HSGA 2BDPA 4X64J 2EEYA 4A47A 1IBCB 1TL5A 5T7LA 3R8YA 5C24B 4HEA9 4OX8A 3W3SA 3I0RB 2WBMA 3P8BB 4X66F 1S99A 2VA3A 2HWIA 4C0OC 2VPWB 3VZIA 8ATCB 4URSA 2HZCA 2QT7A 1SV5A 2R7QA 3MEGA 3I0SB 3J81j 1NSAA 2RQ4A 3OUYA 3T41A 4KGKA 1RTJA 4WZQA 2V8PA 4KBIA 5KOWA 4CH0S 1IXKA 1N52B 3FQLA 2V68A 1VYAA 1JNRB 4USTA 1RT3A 2HGLA 2J5AA 4KPCA 1BQMB 3M8PB 5LMNJ 3LQVA 3GCXP 2BJ7A 3GFYA 4HDGA 4X62J 2PE8A 1Q53A 3IWXA 4XO0A 2ZKUA 2A6OA 4JV1A 2ERRA 1ZAXA 2C42A 4K0KF 3R5DA 2WB1D 4ZLPA 1S7HA 4LFBJ 1BGXT 4UOHA 1GX5A 3T1HF 2VONA 3H20A 3KK2B 3AOBA 3GLJA 5EWEA 4J9LA 3S7RA 2OI2A 2NS1B 3V6DA 3BDPA 2X1GA 3V6KA 1VQ7S 1RHJB 4UQTA 1RU1A 2VJUA 3GG0A 4TY8B 2WW8A 2EKNA 1N5TA 1BMQB 2RQMA 4ZPAA 1F0XA 4A4JA 3I32A 1RWMB 2YWWA 1KC8T 3DRRB 1WSRA 1NPRA 4CTAA 2JLFA 2NPFA 5E3AA 2MKYA 2NXJA 4PWUA 3QRQA 4XDDA 3W9HA 3LANA 2EFGA 3VGSA 3K89A 2V4JB 3D1HA 5FD1A 2FYXA 2L48A 4FPIA 2YKPA 1VQSA 3NS7B 2E5IA 2H51B 2ZD1A 5HN0A 3LP2A 1AXQA 1YDLA 1H6KX 2ZBQA 3N79A 1XN9A 1IVZA 1S9GA 2G1DA 1H7XA 4LF7F 4KGVB 2ZE2B 1UW9A 1TL1B 2P5VA 4PQAA 4DR2J 4DR6F 3DFEA 5A8KA 3W63A 1GMWD 4C0HA 2MQOA 1WC4A 3KUEA 4X84A 2YKAA 4DPWA 1WNEA 2OD6A 2GGPB 2FJWA 4ZK7M 1UPMB 4DLGA 2CNLB 4NLTA 2JEJA 4XDCA 5E33A 4I0WA 3BYRA 9RUBA 4DV1J 5HBMA 3KXDA 1VQMS 1NJZA 4QIGA 5LXRA 3X3UA 1S6UA 3GV5B 4NLUA 1L3KA 2E9RX 3X1LB 3HLUA 1XC9A 2DR7A 4WK3A 2O01C 5H9EJ 2VBYA 3A3PB 4ETZA 2PGCA 4DV2J 4DFKA 2RU3A 3LOUA 1N33J 2CNNB 7FD1A 2BKNA 3EM1A 1Z4UA 2PDAA 4AXIA 4C4WA 4DV0F 2IVFB 2IAJA 1KFDA 4ZITA 3UD5A 2MKHA 3ELHA 5GADU 4W92B 3RRHA 4FNIA 1U1OA 1OPZA 1K73T 2ZZNA 2KJWA 4LF6F 1UA1A 2KHDA 5A0YB 1WG4A 3I9ZA 2OPSB 3QPIA 1SJRA 4WYWA 4IRCA 2OP5A 4U9RA 3VV2B 1YKWA 3LAKA 4ER8A 1RT5A 4DR7F 5KFAA 4UW2A 3HX9A 3MR3A 3C46A 2B56A 2BJ1A 2X51A 3QSIA 3L09A 1BE4A 4WTOB 1IBMF 2BVZA 4X4PA 1SQFA 2DNMA 2HS3A 4ZP8A 3KHGA 4DV5J 1WHWA 2ALZA 2QLWA 3R9LA 2FC8A 2ILYA 3QNWB 4I64A 1Y0HA 5KG3A 3W5ZA 5H9FJ 1IR1A 4ZIWA 2E1AA 1XMQJ 4F4AA 3V81A 5F8HA 1PG5B 4QYZJ 4JI1F 3LGNA 4DZDA 2M8DB 1XQIA 3M32A 4DUTA 3B4MA 3EVOA 2KXHA 3GIRA 4YN3B 4M5LA 4OI0A 3SYZA 1RAGB 4FXVA 3D6HB 4X2BA 1TMJA 4UQGA 3CJ0A 3DLJA 3NCPA 1JLEA 3LWMA 5HVFA 4LVOP 4M63A 5L1LA 1FX2A 5F8LA 4FS1A 1U0HA 5ETRA 3BN7A 4GC6A 4YY3F 4C8ZA 2OD4A 2JRSA 4TY9A 2AX0A 3H5SA 3BYPA 1U49A 3Q8UA 2Y1LB 2DT9A 2A18A 5LSLA 1L5UA 4CLWA 1QVFR 3I82A 2IVMA 1D0EA 3UN5A 1RLDA 2KZZA 1IKXA 1PSDA 1S1VA 2CPZA 3J7ZT 2EFNA 2AJQA 3GSIA 4KFBB 1NK9A 4NI2A 2CG4A 4FYXB 2R4FA 4RR5A 5IWAF 4NA1A 2YNIB 2RRNA 3MOZA 2YKNA 4C9DA 1F3VA 3KNAA 4DR1J 2IM2A 4MKVA 2WVBA 4ZPWR 3ZZRA 4WU3A 1PAEX 2ZUGA 1HWKA 2ILZA 1IQTA 4FYVB 3U1LA 2PI4A 3T1YJ 3KWMA 5JJBA 2M3DA 2FJDB 4O4RA 2BQUA 4JI6F 4F02A 3MM7B 4RLEA 1URNA 2QMXA 4GVLA 2FJEB 4ECXA 2QO3A 2Z4PA 1FEHA 1SC3B 3M6UA 4OI3A 2L9NA 3PV8A 2YX7A 4PEOA 2DNOA 3ADAC 2XZDB 1RISA 4IG3A 4JYAJ 5A8WA 4ECUA 1WORA 4IH5A 2HHWA 3PDNA 4PG6A 1JLQB 1S0MA 5DLFA 1UP1A 2ROEA 2LFVA 2HHUA 5IZHA 4OHYA 4DN0A 1C1CB 5K20B 4FYWB 4ZPBA 5AXLA 2YNFB 3D2WA 5EUHA 3AHPA 4DUYF 2BXJA 2YTCA 4PCQA 1B3TA 3AAWB 2UV8A 1TFWA 1D9AA 4C11B 2N7CA 1NZAA 4P9SA 3IRWP 3CE8A 1N56A 2OGUA 1M5OC 4O4GB 4DPYA 4USUA 2RS2A 1HD0A 4ED4A 3I5AA 5KFEA 1R8PA 2DGQA 3HKZD 2JNJA 3G6VA 4Z2XA 2YNGA 3PRBA 2CNKB 2OMLA 2HS4A 2OSRA 1R43A 3PNIA 2G4BA 2XMUA 1VDHA 1QUPA 2M7SA 3EYZA 2FJAB 5HATA 3HPOA 5GVQA 3IFEA 1MNEA 1FHTA 5KFKA 3P5BP 2B9EA 1WHVA 1QAIA 2W9BA 4MKAA 1DHMA 1V9OA 2KXFA 2CJQA 2Z58B 1NHVA 2YQ0A 3MMCB 1S1UB 1PAUB 1RGVA 4GMKA 2YKMB 2CDRB 2HIYA 5KG2A 2O67A 3SSQA 4FKYA 2MZJA 4NMXA 2B6AA 2GHVC 3KDOA 1SPBP 4NLGA 1TAQA 5I3PA 4ZMMA 4HYKA 1GXTA 4OZLA 4OLOA 4RNHA 3OR2A 4R8UA 4KGXB 2EFPA 3LP0A 5D0HA 2UU9F 1OYDA 2DRDA 1HFEL 3FGVA 1PJ7A 8AT1B 7FDRA 4OHZA 5HQ8A 3FKBA 4ZVGA 3DDNA 4N76A 2E1CA 4A8XA 3CJSA 2NXEA 5FIIA 4HR2A 3JTOA 4DF4A 3H5XA 1JJHA 2ZDPA 2BJDA 4X4SA 2ZUAA 2EBEA 3QZ8A 2LA4A 1M1KT 4DPTA 5J2QA 4MIBA 2RF2A 3LUYA 2ZM6F 1X4AA 1UJ6A 3OTEA 3OSPA 3FFIB 4WK1A 4NXMF 3W5XA 2MSSA 1NB2A 5HJYA 1Y3JA 1CULA 2J6UA 3DGPA 1R6VA 4FNHA 2G0CA 3PYEA 4WU2A 2WONB 3QYYA 2AZ1A 2DIVA 3SDEB 4ES3A 3HT3A 2V0NA 3MMAA 4ZA1A 1IKVB 5IQQA 1SJQA 2VL1A 1AW0A 3U7JA 1NH8A 1D09B 1YZ6A 2XNRA 3FEXB 2RH3A 1RTHA 1Q8IA 2W2QP 3MPUB 2WVCA 4OX9J 4QU7A 1VHFA 5KFBA 3FC9A 2GIFA 1LXNA 1IUJA 1FKOB 3KLEA 5ADZA 2XLIA 1FJCA 3G8QA 2OELA 3CTRA 2DR8A 3MM8B 2NYIA 1LNQA 1OWXA 5DDPC 1APSA 2MLXA 2H4WB 3EZUA 3AD7C 4CNZA 2QG9B 3O1LA 3C6UA 5DS7A 2BEFA 4BLGA 1YJ9S 1XNRF 2GCFA 2DPJA 1YQHA 3GJSB 1B99A 4WFXA 2OTLS 2VG7A 5F0UA 3GV8B 1Y5LB 4CM2A 3N5BA 4IYQA 2UVUA 2DRBA 1EQMA 1MWZA 3EMTA 2UUCJ 4DLEA 1FEEA 2V94A 3G2XA 3HDSA 5AJ3J 2VFSA 1M5PC 2X7IA 1OSCA 4AXJA 2BZ2A 8RUCA 1ZPWX 4CLPA 1U25A 3TUPA 3M2UB 5C42B 2IRYA 1TUGB 3THPA 5A8RA 5DM6Q 1TK0A 5KFZA 5J1EA 4RBTA 4DSKA 3BQ1A 1IM4A 2V5HG 3JYTB 2HMIB 3W9JA 4ZKAA 1JNZB 1J5OB 1RZMA 2J0XA 2N3LA 4LF2A 4C8NA 1HWJA 3KUGA 1SL2A 2ZJPQ 3TZXA 3K5OA 4M5HA 2IHR1 4K4UA 2JJ4D 1FFSB 1FF2A 3PCOB 1IBKJ 3QGHA 4I7FA 3ZTRA 4WIQA 5F41A 3BGOP 2KFZA 2IA6A 4D3GA 1EIYB 3VAIA 3I4PA 4KRWA 3MR6A 5L1IA 2VFVA 3MAAB 2Y3YA 1AYEA 1GXUA 2D7SA 2AYBA 5HL7Q 2WVEA 1KVJA 3I5CA 2XY7A 5KG4A 2OEMA 3R5AA 2VQFJ 1IBLF 4O44B 1N36J 3OFHA 4A8OA 2HHSA 4DFJA 4J9MA 3R5BA 3SCKE 3PO4A 4JI8F 1KTVA 4Q8FA 3N0VA 4B3SJ 1Y5NB 4DDFA 4DWIA 1DTTB 5C2CA 1CBKA 2W4PA 3K8VA 3QIPA 2ZHAA 3ZO7A 2LECA 3MPDA 3PXGa 5AXKA 4QWBA 1ZZNA 1UFKA 2D3O1 3ISNC 2P6TA 3TJ9A 2R9LA 2JH3A 3H90A 3TW0A 1T3NA 4K4SA 4K59A 3HD1A 4PPDA 3KK3B 1DQAA 2GZOA 5HMZA 4PQUB 1WHXA 2OUGA 2GMJA 3CDEA 4KGZB 3KJVA 3CULA 4DR4J 3LH2S 3M2RA 2YKOA 2C2EA 2E1RA 2DNRA 3KHLA 3IRXA 5EWGA 5J2MA 3SV4A 3Q2TC 1NDPA 3MPWA 2HYIB 1V5VA 4F50A 4O0NA 1S12A 1L3SA 4IG0A 1J5EJ 2F4FA 1TQLA 2MGZA 1ZTWA 2XTJP 3IM8A 1WOSA 3PW7A 4EBCA 2DNGA 2MSTA 3T9NA 3CD7A 2PA8D 4GKJF 1CJTB 1RAOA 3V4IA 1X4EA 1R3NA 1NPKA 3SZ2A 2YQ1A 4NCAA 1YIJS 4CH7A 1Q4RA 2YWEA 5GMEA 3H98A 1U1PA 2BANB 2CQGA 4MYUA 4RW9B 3H25A 1QM9A 2UV8G 2XC9A 1CQMA 1N32J 3T9ZA 4HHHA 2G9OA 3V6HA 3HULA 4JI4J 3L7OA 4A46A 4OYOA 1FRHA 4FZVA 3TAMA 2MQQA 4X4UA 3BBCA 4LIRA 1HBOA 2BE2A 2FB0A 3GILA 4WYLA 1DQ8A 3W60A 3POTB 3FBBA 3RYLA 2ZH9A 3DRSA 3RB0A 3CJ2A 1SUQB 3MECB 1HNIB 4LFCJ 2F9DA 2P8IA 6AT1B 1FJGJ 2GIQA 2C3MA 1BWVA 5G0RB 3M9OB 2AWZA 2JLEA 2LQJA 2D9OA 3E8OA 5M2RA 4DR5F 2B43A 2MY7A 1FRMA 3W7BA 4F4ZA 4QJVA 4K50A 1Y7PA 2JHEA 3BGRB 2XHWA 2Z2MA 1YSJA 4HTIA 1RWVB 3WZ0A 1LWFA 4G3IA 2F63A 1U02A 2JX2A 4B3MF 1FDAA 3D1OA 3N4WA 4OV6A 3K5MA 1IQZA 4N47A 4YHHF 1QUVA 3WHIA 2HNDB 2QSWA 2XY5A 3HMJG 4O23A 3N6LA 3RU0A 2G0IA 1L3TA 1UVNA 3PACA 1PIEA 2UUTA 4LF5J 2DXEA 1WF2A 2AKWB 3H7HB 1CJUA 4B17A 1RAHB 2FY8A 3R3TA 3FRYA 5J1NA 3IGNA 4QPTA 3RBDA 2G13A 3UDEA 4IOAQ 1CS4A 2HFSA 4GVBA 3NAHA 1EETA 5JUMA 3RJMB 1WKKA 2XM3A 4Z7YA 4HT5A 4TY8A 1RCXB 4JUZA 4G1QA 5E3QA 5F9NA 3T6BA 2FTRA 3P4UB 4L72B 4YQWA 3QZ7A 3KMSA 1RWKB 5D4OA 4ZPVR 1V6HA 1GTEA 1RHMB 2K3KA 3IR5B 2DCLA 2V8GA 2CQ4A 1H38A 2EVZA 3QAUA 3HI9A 1HQUA 2UXBF 4USVA 2BV3A 2LEBA 3BO4A 3RR8A 5HSPA 3SBMA 2N82B 1CJKA 5CD4H 4WPAA 1HD1A 1UTAA 4N7TA 2EG1A 3RBZA 1X9WA 5IFMA 1RWNB 1T05B 2DRAA 3GP9A 3FSXA 1GNKA 3JQMA 1OSDA 2RDJA 3GYGA 1WTBA 1B0TA 4ZVSB 2YX4A 2JFKA 3MDFA 4K4YA 3CMQA 2VPXB 2BJ3A 4I2QB 1LWCA 1SQGA 2GQ2A 2HURA 2BA9A 3GYNA 1TP7A 3TUIC 1TL1A 5CA5A 1FWPA 4WBFA 4NPOA 2RRBA 3T5KA 1LW2B 1T9XA 5IM0A 4R0EA 2ZBCA 2VODA 3DKDA 4H4MB 2R2UA 4WP9A 1B70B 4PXBA 1IWAA 2PO4A 3C6TA 4QW9A 3I5BA 3NEKA 2QLXA 4PKDB 2GAGC 3CDWA 5MAOA 2Y8YA 3IMQJ 1QJHA 2J9EA 1S57A 3SSRA 4QIWD 2IRXA 3EDQB 1WWHA 2RDIA 4DX5A 5E41A 2MPUA 3OT9A 1U48A 1R0CB 5LJ3Y 1A6LA 1HBUB 2EFOA 1HNZF 1JX4A 2MZTA 4Q2LA 3W5YA 1PKUA 4R5PA 2QFIA 4NX9A 3OHAA 1FK9A 4UOGA 1HR0J 5C25B 4H54A 3PFOA 2N3OA 4RNNA 1SH0A 3DLEA 1U8WA 2VG5B 1NBEB 1U1MA 1TKTA 5FDLA 3ENQA 3DOLA 1ZOTA 3CCVS 2D3UA 1BQNB 1R8CA 4P73A 2VA2A 3CO0P 4X4TA 2KYXA 3AODA 1VQYA 4I56A 4HI1A 4KHPJ 2DR6A 1ACMB 5BR8F 2YWHA 1RA7A 2MXYA 3HHLA 1D3WA 4FF4A 1O6XA 3JSBA 4NLQA 4OZ2A 4P71A 4MJKA 4F4KA 1VQOS 4B9MA 4OYIA 1AB8A 4B02A 1O51A 1H74A 2KXNB 4X64F 3BO3A 1FKAF 1TL3B 4M8LA 1NDCA 4ZVQB 1N88A 2YWGA 1QSLA 1ITPA 1R7IA 2W7AA 4DV4J 3KJNB 1SH2A 1N34J 1GMUA 4F36A 2IM1A 3BGFA 4PR6A 3OW2R 2XS5A 3JB9k 4I6YA 4TNOA 1UKUA 4DF8A 5E3CA 2DKOB 1FA0A 4L6V3 3R7BB 4LQ9A 5KFJA 3TA2A 1NDKA 2LP4A 3DOMA 1AFIA 2GO8A 4JV2A 2HWHA 4LRAA 2KHCA 3LP1A 3VQTA 1FFWB 3ZTSA 1FVQA 3PTWA 4M5DA 4LSLB 3AD9C 2FHJD 4RZRA 3OXFA 1R89A 1UJ5A 3LPEA 4Y0FA 2GX8A 3SCJE 3MMBA 2HVEA 2PMZD 1HMVB 5J2PB 3H8YA 2AEFA 5LMNF 3MAHA 2FY1A 1RT6A 1YHQS 3BQ2A 2HNYB 3BV8A 3TJAA 3EGNA 1JXVA 4NLYA 2MZSA 4LRBA 3VCDA 4XIUA 4DPUA 3UDCA 2YNHB 3THTA 2BJ8A 2UP1A 2UVVA 3Q89A 1OJ4A 2HAFA 2AW0A 4G65A 1XERA 3LF0A 4IFVA 1MROA 2EC0A 3PG9A 3EGVA 3RZAA 2CZ9A 4GKKJ 1XBWA 2VFRA 3FBCA 1K8AT 1VS3A 5DQIA 2I1RA 2ACYA 1AZSB 2F8HA 4UF4A 3PVXA 2ZH5A 3QAEA 2KI2A 4ZCKA 3PX6A 2IYIA 4C3KA 4OQJA 1U1RA 2D1CA 4OJGA 4C8LA 3K2YA 4UZBA 2AGPA 5J1PA 2VF3A 4NZ0A 3TOQA 3OJUA 4C3LA 1IWGA 2ZWOA 4HACB 3AD8C 5A2QY 2AJ2A 1PCAA 3MCOA 3QO9B 3DRXA 5DGBA 5A6PA 2OMOA 4N77A 1RACB 3BB5A 2FVRA 2MHEA 4YMEA 4I69A 3BKFA 3NNCA 3P96A 2ZFHA 1E6YB 2KO1A 4DEZA 4NLDA 3QGGA 2XMTA 1JLQA 4WFZA 4B9NA 4RWWA 2HFZA 1W7WA 2B7BB 3BH6B 4HLBA 1LOUA 4OI6A 3TQEA 4EU0A 4ED5A 2DEJA 2J7UA 4RUCA 2LLZA 5K8NA 1M1HA 4TN2A 3PJXA 4OZ5A 1VQ6S 1S9EB 4DR2F 4UY85 1H7WA 3CWJA 4LRCA 1RUSA 4PXEA 1N4LA 2R3VA 3CJ5A 4UT4A 4BS2A 2G1HA 2CDQA 1PYOB 5KAKA 1S5ZA 1ZZFA 1WEYA 1KOOA 3I55S 1LEOA 4EZ9A 4DV1F 4S0MA 4ERDA 4HHJA 5KG6A 4RNMA 3QT6A 3U27A 2KL8A 3SSSA 5J2NA 3HHDA 2DNNA 1N6QB 4F4YA 4DQRA 4WFBQ 3FCHA 4HKQA 2EWHA 2CUYA 1MMLA 3ITHA 4DU7A 2BQRA 1C2PA 4DV2F 3BS9A 5KFMA 1N33F 2MHNA 3K7RA 2LXFA 4KE5A 1L3VA 2XYPB 4QYRA 2CFXA 3HKWA 1WOPA 1WC6A 1SC4B 1FJEB 4PPZA 1LW0B 3T19A 1U26A 1F9FA 4FVMA 1N0VC 2QMWA 3G6YA 2VZ9A 3HT0A 1S0OA 1TV6B 1SIWB 1XR7A 3ZZUA 2B4UA 2H5EA 2XI2A 2CQ3A 1HYSA 1WC3A 1IKYB 3W65A 2EBGA 1NCLA 4ECRA 2HEKA 2HSEB 4DV3J 2HQCA 4MIAA 1HWUA 2YH1A 2XI3A 3KDNA 2C2RA 3PY8A 4QR0A 4DV5F 2CKWA 2MLZA 3FEZA 1HW8A 2R7SA 3PYGA 4CYUA 2H4YB 1QE1B 4CH1A 1S1XA 2OFGX 1KLMB 3W1YC 1XMQF 3FZBA 2K7KA 4NXNJ 1CC8A 4K7QA 5LT5A 1C4CA 5T14A 3KLHA 1TR0A 4CCHA 3AJ2A 1TU0B 4B3RJ 5IC4B 3D4JA 3OQ2A 4ZCLA 2WVDA 5HP1B 4URGA 1N48A 4OMFG 4P7TA 1GMVA 3SDEA 1BC6A 4F0MA 3MMJA 4U96A 2AX1A 4YB1P 2YPZA 4OI1A 3CCES 1S97A 1QVGR 2HVIA 2ADCA 3M8SA 1R0AB 3VVUA 3W62A 1JLFB 5LM7E 4OZJA 2CPEA 3DLBA 4DU8A 2KN4A 5KTQA 3NL0A 1VIXA 3BSAA 4EZ6A 1FKOA 3TO8A 3TWZA 4DI6A 1G2EA 1TTHB 1C0TA 3NWRA 1SKUB 2XWXA 3H59A 5EHHA 2V4RA 2HHTA 3EZ5A 2NZCA 2WZ1A 1H98A 4F2RA 1S1TB 2VDHA 2RRAA 2H54B 2VV5A 2XSJA 4RW6B 1SI9A 4DSJA 3FK4A 4DR1F 4XAKA 4USKA 4FS2A 1FD8A 3Q23A 4MKYA 1XTZA 4QIVA 4TLRA 3T1YF 1DARA 3NOGA 1CC7A 2B51A 4E0DA 3PHTA 4KO0B 1LWEB 3UR0A 1M5SA 3DI6B 2FHOB 1P1TA 4ATNA 3H5UA 3NBPB 2HAIA 4DG1A 4K5RA 1RTIA 1VLOA 1T03B 3C16B 5ETMA 4DV6J 1VRTA 1OQ3A 1U24A 2RU9A 4Y6IA 3L3CA 1RT2B 3FBEA 2EC2A 9ATCB 4KKOB 4I4BA 4ZP7A 4UUWA 4NE9C 2BW2A 1CLFA 1JQGA 2BBEA 1YJVA 4AL7A 1VRUB 3KYLA 4OHXA 5KFFA 3A8JA 1YK9A 4C97A 5D0EA 3CCRS 1RT1A 3BDEA 2VKRA 2L08A 3JAMU 4FYDA 1DTQA 4U7UK 4P2FA 3E01A 1JLGA 3OR1A 4DL7A 2VICA 3B8HA 3JSMA 2D9PA 2A1BA 1SJ4P 3ETOA 3AJ1A 3HHLC 1YG0A 2WW4A 2ZVSA 3HXMA 5KT6A 2Z2YB 2FHMA 3TR5A 2E5LJ 2C2KB 1JLBA 3GIJA 5HROA 1YJNS 5FLXU 4O3SA 4DQPA 4FXWA 4QPXA 4GC7A 5GAEU 1VQ8S 1HBMB 3RAXA 3MEKA 3C14B 1WKLA 1N5QA 1YJRA 1B7YB 3OVSA 1O8BA 1HI8A 5AE3A 4GRSA 3MAAA 5I42A 4ZCIA 3KNGA 4OFZA 3GFHA 2OKQA 3DOKA 4RBVA 4ZP6A 3OLBA 3M2VA 2EXUA 1RAAB 4EUVA 3H2LA 4OJ3A 1M0SA 3MD3A 1RT7B 3PM9A 1HPZA 2CVIA 4ZJQA 4Q7AA 1BXNA 2V2VA 2V8DA 3IC1A 3EPIA 5DDOC 1FRLA 4NCGA 1CSJA 3MM9A 5EN1A 4ZS6A 4KV8B 3AA9A 2HS0A 2DITA 3Q2SC 2C3PA 3RG6A 2WVFA 3VZHA 1W26A 2E5HA 3M6WA 1R8BA 1FRIA 1IJEB 1C0UB 1S4EA 2JOQA 3DYAB 3BSCA 2R8HA 1JIHA 2ASYA 2I5JB 5G4DA 2CQ1A 2L9WA 2ASDA 1GMWA 4JI5J 1N5YB 3HM9A 3K5LA 2G2YA 1SB6A 5KOXA 2RVJA 2GQQA 4AE5A 1VC5A 4XPCA 4DJBA 1REVB 2VG6B 2OPQA 2RHSB 2GJ2A 4OZNA 4AT1B 2LEPA 2WAQD 1FCAA 3KLIB 3D0HE 4ECVA 5B08A 1FXDA 3DLKB 2ZH1A 1QLNA 2EI5A 1FWKA 4IO1A 1CJTA 4A8WA 1X31C 3BSOA 4PUOA 2BRKA 5HAOA 5K5MA 3ICLA 1R8HA 3MEDB 1RE1B 3NMRA 3V5RA 1OY8A 1TKZB 2MYFA 2XCPA 2P9GA 2HLUA 2KT2A 1UVIA 3A13A 4ZDNA 2RMLA 3E3XA 1VK3A 2IBOA 1EX8A 4DHVA 2C2OB 3S6EA 4OX9F 3MI7X 2D69A 1JJ4A 3DCAA 2ZNZA 2XMJA 2DH9A 2HVHA 3PZPA 4DSIA 5LSOA 4ES2A 4IOCQ 1Z2LA 2AJ1A 4E8UA 5ETLA 1DLOA 1RADB 3CMES 4ECYA 4OJ1A 3N9UC 4JP8A 1RK8A 2V8HA 1C1BB 3M05A 2H65B 4NA2A 3W61A 1TKDA 2LA6A 3NGUA 4Y2KA 3QJLA 1WEZA 1RB0A 2LU2A 4FF1A 3MAQA 4G1IA 2RS8A 1ZM2A 3ILOA 4OZ1A 5KFQA 3M9MB 1NAQA 4CO1A 2UUCF 2HRUA 1UWBA 4PWWA 4RUAA 4K4WA 4ED1A 1KEKA 3HFZB 1S79A 3K5NA 1M5KC 3PRVA 4UY8T 3DMJB 2WOMB 4DFMA 5A6WA 5D4PA 4X65J 4ECWA 3H4BA 5AXNA 3J80U 2CQDA 5T7LB 4M94A 3H42A 4M1KA 4RW8A 4F0KA 2E44A 3PRDA 2DNHA 4LR9A 3ENWA 1SV5B 3MEGB 3MUMP 2D3OR 3OUYB 2GO9A 3BGLA 1VQLS 1RTJB 3FCVA 3LAMA 5CYQA 1RBLA 2BOPA 2EW9A 1IBKF 2XWYA 4F8RA 1RT3B 1FJ7A 4TU8A 2G0JA 1RAFB 3GCWP 1LFWA 1RI7A 3MM5B 1S59A 2OO4A 1FDDA 2Y8WA 3W2VA 2QA1A 1NDLA 2R7XA 2NPIA 1DBDA 2RE1A 3D6MB 2N7YA 2YX1A 1V3ZA 1VCTA 2QA4S 5E5NA 2YQ3A 4YR3A 1SKRA 2VFUA 1GTHA 2OPPA 4U8YA 1BHNA 2AT1B 2QE5A 1KLNA 3ILJA 2GVDA 2BM1A 2VQFF 5K14A 4JV0A 1N36F 2F8MA 2GHWA 3BF4A 4QOTA 4USJC 1T05A 2E1PA 4Y34A 4B3SF 5DZ6A 2OPRA 3V6DB 1TKXB 2IFXA 1QSYA 1T94A 5DG9A 2V9WA 3BR8A 1RHKB 3LA0A 2WK4A 2D74B 2MQPA 2APOA 2ATLA 2YPYA 1B4SA 4IR1A 5M2PA 4BCAA 4OYBA 1DFDA 1DRZA 1VQNS 5IT9U 4RW7A 2PEHA 1KTQA 1RAEB 3M8RA 1RT4A 3RGIA 2OEJA 2DGUA 3EXCX 5HVGA 3CJ3A 1VFJA 3NGSA 4CLLA 1C4AA 4IDKA 4CTAB 1WC0A 3IWLA 2NSBA 5HK4A 3KTQA 4B3TJ 4C6AA 5LXYA 4F3MA 4ILLA 4DR4F 2W9CA 2EFVA 2B5JA 2LQBA 4ZPCA 3TUZC 3CJ8A 1JB0C 2ZD1B 4J90A 3GWCA 1NK7A 3LP2B 2Y1IA 4ECZA 3BPDA 4DSFA 2GA7A 3M4XA 3DLLQ 2GJFA 3MHYA 2KB2A 1S9GB 3DM2B 1MN7A 1J5EF 3IS9A 3OVAA 5GAGI 5AT1B 3HZEA 4HL9A 4CLZA 3IBFB 3OSNA 3RB3A 3BN4A 3CVKA 1PJ6A 1BQNA 1Q16B 1RJJA 1EQ0A 2IM3A 3RUBL 3JSYA 4YB5A 4Y2IA 3L4BC 3NWGA 3SIPB 1VMBA 1BWEA 4B08A 3T6JA 4TXSA 1SC1B 4CNYA 3PJ9A 3IA0A 3W2WA 1N32F 3ET6A 3CCQS 4JI4F 3HSJA 2IVYA 5D0RA 5LMUJ 3SI8A 3DDKA 2FLLA 1K1QA 3R1HA 2Q79A 1H73A 4DXLA 1TL3A 2IAJB 3NMAA 1Q5VA 2DNQA 1CJVB 3SEOA 4GO5X 4RNFA 4M5MA 2IYGA 1HI0P 3LW5C 4ES1A 1N0UA 3IG1B 3H0PA 2K7JA 4EO8A 1NB7A 1VQ9S 2QGFB 4LFCF 1VGYA 1FJGF 4LF9F 2MTLA 1XWLA 3UD3P 3EX7B 2DNZA 2GVZA 1JWWA 3HSDA 5I3QA 1HHTP 1T95A 1CQNA 2HG4A 3FCWA 4DCOB 3R6GB 1P6TA 1SL0A 1RLCL 5KFOA 3ZZZA 2B0GA 2FZKB 3FMWA 1RP5A 1V3SA 1VQPS 2HWTA 2HNZB 2VQEJ 4JI7J 5KFCA 1NKEA 1KBRA 4ZVOB 4DX6A 2FVCA 1PILA 2EK1A 5D15A 1KKHA 3V81B 1F5CA 3TX8A 1RWPB 4F67A 4CLSA 4LF5F 3RW7A 4ELVA 4C0BA 3M32B 4X4OA 1EP4A 2DGXA 1YZ7A 4TU7A 3MZIA 4LJMA 2DK2A 5KG5A 1TELA 3M8YA 2DPIA 3WBZA 3GZ7A 3J81U 2BKPA 5LJ5Y 2GJIA 1JLEB 5LSRA 4C2MA 4ETXA 1KP6A 1JJCB 4CLKA 4OZ3A 4JI0J 2OFHX 5KFGA 3R5GA 4NYOA 1U0HB 4B9TA 2U2FA 2IDLA 3D9BA 3MEEA 2CJAA 4A8MP 3A8EA 2PI5A 1E6VA 2W4CA 5CYJA 4HVZA 2AJ4A 1TL7A 1FE4A 4W98A 3CJKA 4P2MA 2DY1A 1NK5A 4LSNA 1NLKL 5HANA 4M5IA 1IKXB 2P9EA 2DR9A 1S1VB 3W64A 3ILLA 1AA1B 2I9SA 4IUFA 3QJJA 1EARA 5KT5A 3ENAA 2MEWA 1T9UA 2OHDA 1U6BA 4NI2B 2CJYB 3OL7A 2HZVA 3KHRA 3ZZPA 1HBNA 3BQ0A 4P7VA 5KFYA 3IBWA 2NUUG 1LQ9A 3CMAS 4C48A 1VISA 2J0WA 2LCWA 3M8WA 1VBZA 1U8SA 5HVHA 2MQLA 3K57A 2MQNA 1S6PA 4LF4J 4WE1A 4NOHA 1VBYA 1HNWJ 1GFWB 3D6TB 1TK5A 3MPYA 2J6SA 2HPUA 4PWDA 3J7YU 1Y3KA 1J2VA 1RHRB 2HHHJ 3R7SB 3HF5A 2XHCA 3W8GA 1A9NB 4IG3B 3B78A 2B8QA 3OTCA 2JLGA 5A8WB 3OXGA 2KU7A 1S4FA 3GYXB 4ZHRA 1NH7A 4J7CA 2KM8C 3CCZA 4MKBA 2KRRA 2F4VJ 1WACA 1K47A 2CAJA 2Z8QA 5KFDA 4ID5A 3L9ZA 3VVTA 2F1FA 1QD1A 2JZ5A 4ED0A 4P74A 1UWAA 4I68A 2QL5B 1A7GE 4CO0A 4J9PA 1HR0F 1S77D 4EYIB 4LF8J 3OTOJ 1HL6A 1GT8A 4ICLA 1S6QB 2COLA 1UZDA 1I6JA 4Q0BA 2UZAA 2D3ZA 1Q1KA 4XK8C 1X8DA 3MM6A 1XNQF 1Y10A 1P9YA 1X5PA 2FJBB 3FSIA 3CCSS 2YNGB 4KHPF 1IKYA 2CQCA 1PC4A 4DL4A 3FDSA 3OL9A 2MB0B 1K1SA 4KGMA 2VPZB 2KT3A 2HQ3A 2AHOB 2IC3B 1AUDA 3O6QA 2ROGA 4LSZB 3O5TB 3CCTA 4BWJA 4XPEA 4C7QA 1IBLJ 4F3OA 1HWLA 2CPIA 2Q6CA 2VIHA 2W9BB 4NCBA 2L9DA 4G1PA 4I1TA 2MMYA 1RAIB 1EZZB 4DV4F 2BQ3A 3H4DA 3ZZ0A 1N34F 4IQMA 3HFVA 1S72S 3DRPA 1VJQA 2W7OA 3KHHA 3ZZOA 3BBBA 1KQGB 2XGPA 3GIIA 1JLCA 1XR5A 4FBTA 1T9VA 4PG4A 4P75A 4N8OA 2B6AB 4CZCA 1MLAA 3HJFA 3OFFA 1UEKA 3C15B 5HP1A 5GMDA 2UXDJ 3OR2B 3DLGB 4R8UB 1PYSB 2E66A 2R8KA 1A0OB 4XTTA 3LP0B 2I38A 2IJFA 3M30A 1BQXA 4KH0B 1OS5A 4PZVA 4B9SA 4ED6A 1TFYA 4JOUA 3E51A 2M52A 3US5A 4U6PA 3PFEA 2RD5C 2K3IA 1RXOB 2HHQA 3KMQA 1R0AA 5I3UA 4H4OA 1TVRA 5KFRA 1M90T 3J7YI 2L3MA 3V4MA 4ECSA 2YWFA 5J2QB 2RF2B 3D3CJ 4RO0A 4H4KA 3D6FB 1XMOJ 1KQFB 3HHNB 2RKIA 2AD9A 1UPPA 3VWSA 2V69A 4GKKF 3LGMA 3GR0A 4RW6A 1CULB 5D77A 2C3UA 3DGPB 2AJFE 2M0GB 4Y00A 1OYEA 2V2KA 3R6LB 3DC2A 4O3PA 2HQFA 4C3MA 4M95A 3SCIE 3CJ4A 3MMAB 1UVLA 4LBIA 2QTWA 2KG0A 4LQ3A 2E29A 4DUZJ 2M5YA 4A8KA 2F7VA 3UI3A 2R8IA 2VFTA 2JFDA 3NCQA 4J37A 1RTHB 3PX0A 3DI6A 3QMQA 2DJWA 1LWXA 2FPHX 2KH9A 4NYZA 2CNOB 4NWBA 1SJ3P 1HNXJ 5CD4A 5DG7A 5IC6B 4ZN3A 4FP9A 3AT1B 2XCAA 4TKTA 3VAJA 3C16A 3Q24A 5D0GA 1HQEB 2D41A 3IGVA 4ECTA 3TUJC 3BREA 2KFNA 4ID8A 1NPPA 1TMMA 2A3JA 4PG7A 3V6JA 4KKOA 3SFUA 2Y0BB 4I2PA 3C6UB 4KAIA 3MCNA 3P3DA 2HHPA 4DOZA 2CADA 4RU9A 1VHIA 2UUAJ 4P72A 1OQ6A 3I31A 1IKWA 1KVIA 4RWXA 2VG7B 3BSNA 3OTBA 4Q45A 2QYGA 1YVFA 3SQGA 3F0NA 1FXRA 2PC6A 4MTPA 3M8ZA 1Y4ZB 1ELOA 2DH8A 5F3TA 3G86A 3A3OB 4WZMA 2ROPA 3C14A 2K1RA 2W4DA 3Q8SB 3HVWA 2IRUA 2O5DA 1FWLA 3PX4A 2Y0SD 4AYBD 3UNYA 1I3OB 1S7IA 2UUBJ 2NYHA 5A8RB 2WBRA 2H1YA 2XG8A 1FNOA 5J1EB 5D78A 1WOOA 1K9MT 3D67A 5T41A 1Q8LA 3FMBA 2RSQA 3A8IA 2JDJA 5ETPA 3GFZA 4I6WA 2XGQA 3EUNA 1WG5A 5ETNA 2AEJA 4IRDA 5MLCV 2JEGA 4CP5A 5BYRA 3U1NA 3TQ1A 4QU6A 3MFHA 1B0VA 4C8KA 2P6SA 5B0FA 2M9KA 2XULA 4EEYA 3Q8PB 4X4NA 2GW8A 1RTDB 4I7FB 2ASLA 1LKZA 2A10A 2FZCB 3TNVA 4L3KA 4U7CA 3OV7A 1Q8BA 3CW2C 1NHUA 1HKAA 2GMLA 1N5SA 1PC5A 3DYAA 2CPHA 3CD6S 1LV5A 2NSCA 1TUVA 4DPXA 4C8MA 1AROP 4J9OA 3EWGA 4DV3F 2XZTB 1WF0A 2R7VA 2C3YA 1RU2A 2E5GA 4IFYA 1H0HB 1IR0A 1X60A 2H48B 4RU2A 2A2DA 2Q1LA 1G3OA 1VIOA 4WKYA 1HHSA 5HLFB 2HBYB 3F73A 3QIPB 2J0SD 4NXNF 5ETKA 3KLIA 4Y28C 4B3RF 2FDNA 3GFXA 2XMWA 4ED7A 2JC0A 1ICEB 4MFBA 4HH1A 3UN2A 3M8QA 1RYRA 2R2SA 2AYEA 2CQPA 4IOBA 2W2MP 2BABA 3QWPA 2OEKA 4QIEA 3QT5A 1FRJA 5KT4A 1BLUA 3KJVB 2N4DA 3KG0A 4NRUA 3M2RB 2RQCA 4HT7A 2W01A 4P2SA 3U1MA 1R31A 3IRXB 5ETVA 4MT1A 4A8QA 5J2MB 4MH8A 1WJ9A 1SKWA 2LDIA 3CO9A 4ED2A 1KNZA 4IG0B 2VD3A 3TEHB 4CRJA 4AL5A 3RB4A 2MGZB 2QRRA 5KFWA 3TVKA 2ZZTA 2V8VA 1JLAA 3AJDA 3RAMA 1F60B 2G2OA 4BWMA 4LIWA 4ZP9A 1D8ZA 3DXSX 3AXMA 3N6NA 3C2PA 4OYAA 5K8PA 4PRFA 3KK1A 2HKEA 4DCJB 1S1WA 2HQIA 1FTRA 4ED3A 2DHAA 4HI2A 4LVNP 1NXIA 3W9IA 4B3OA 1BD6A 2B4VA 3HVTA 4PAAA 4EO6A 1KONA 2WOMA 4LR8A 3TAMB 3G82B
chains in the Genus database with same CATH topology
1WHYA 2FHJA 4NLWA 1HBOB 2E7XA 2KVIA 3H5UA 2IMWP 2M3DA 3HVAA 2HAIA 3NBPB 4I2QA 4DG1A 3BJYA 2BE2B 2FJDB 4K5RA 5CZVA 2OAUA 1RTIA 4USHA 1U4BA 4ILMA 2ZITA 4O4RA 3B82A 2E1MC 2LXIA 2BQUA 4JI6F 4F02A 1T03B 3MM7B 4RLEA 3QLHA 5CQGA 3G71S 4QW8A 3OVBA 5CXTA 1URNA 3OPKA 2QMXA 1VRTA 1OQ3A 2JVRA 1U24A 3TI0A 5K8OA 1ZBTA 2FJEB 2X1FA 2RU9A 4WTYA 4ECXA 4YR2A 2QO3A 1OPIA 4Y6IA 2Z4PA 1FEHA 2MZ1A 3L3CA 1YTYA 1LW2A 3M6UA 4OI3A 1RT2B 2L9NA 4MK7A 3PV8A 3DRSB 3EXYA 2YX7A 2VBXA 2DNOA 2B4OA 5EDWA 2JL9A 2HHXA 4KKOB 1RISA 4I4BA 4ZP7A 4IG3A 5D6GA 5KG0A 3J7A1 1X4DA 4UUWA 5A8WA 4H4MA 2BW2A 4ECUA 1CLFA 5D3GA 4RNOA 4IH5A 2HHWA 1JKHA 2FJVA 3PDNA 2RNEA 4FVCA 2BBEA 4PG6A 1YJVA 4NLSA 4AL7A 2WSEC 1VRUB 3KYLA 1JLQB 1S0MA 4OHXA 5F8IA 5DLFA 5KFFA 1UP1A 2ROEA 1GAOA 3I4HX 1KOHA 2HHUA 3AQOA 2BYCA 4C97A 2I2YA 2W9AA 3CCRS 5IZHA 4OHYA 3GSDA 1RT1A 1X4BA 4DN0A 2OH2A 3BDEA 1C1CB 2VKRA 2L08A 1UW4A 4FYDA 1DTQA 3SFGA 5HMYA 2GNKA 3C66A 4ZPBA 5AXLA 2YNFB 4U7UK 4OLPA 3MTKA 3E01A 1JLGA 3D2WA 3OR1A 5EUHA 1GX6A 4DL7A 3AHPA 2C28A 2DVIA 4DUYF 2E5LF 2FVSA 2GV1A 5CYMA 2BXJA 1CG2A 3B8HA 3JSMA 4FPRA 2D9PA 2A1BA 1SJ4P 3ETOA 1JJ2R 2VOPA 3TVZA 3AJ1A 3HHLC 2YTCA 1YG0A 4PCQA 3MM5A 2ZVSA 3AAWB 1LWFB 3HXMA 5KT6A 2FHMA 3MGJA 3TR5A 3GIJA 1JLBA 3K0JA 1ZPVA 2UV8A 1HBUA 2XZWA 5HROA 3QIDA 1YJNS 4O3SA 1TFWA 2QEXS 4DQPA 1D9AA 1UAWA 4C11B 4Q43A 2N7CA 1NZAA 5DDRC 4FXWA 4QPXA 3IRWP 3CE8A 4GC7A 1N56A 5GAEU 1VQ8S 1HBMB 4J9SA 3RAXA 3MEKA 3RR7A 1M5OC 4O4GB 4CO5A 1KHWA 1N5QA 1YJRA 4YR0A 1FRKA 5C25A 5A8KB 2RS2A 1S48A 3OVSA 1HD0A 1O8BA 2WSFC 3K8WA 4NLOA 1HI8A 3OL8A 2DNPA 4MYTA 1EP4B 3I5AA 2VG5A 2N4CA 1ZAVA 5AE3A 5KFEA 1KFSA 5I42A 1R8PA 2DGQA 3HKZD 3G6VA 1ZH5A 4Z2XA 4ZCIA 3K59A 3KNGA 1HNVA 4I6AA 4OFZA 2YNGA 3GFHA 3PRBA 2MKKA 2OKQA 3DOKA 3UCGA 1TAUA 4RBVA 2M88A 2OMLA 3CEDA 2HS4A 2OSRA 4ZP6A 1R43A 3M2VA 4BC7A 3OLBA 5I4MA 4NZ6A 2GC8A 3PNIA 2G4BA 2XMUA 1TKXA 4EUVA 5B09A 5HBMB 3H2LA 4RX6A 4JI3F 1QUPA 2M7SA 1FE0A 4OJ3A 1M0SA 3MD3A 3EYZA 4QCLA 2FJAB 3FJ2A 2DHXA 5CCLA 1EETB 3HPOA 2PFFB 1RT7B 3IFEA 4YB6A 5GVQA 3M1VA 2DNLA 2NREA 3PM9A 1SIZA 1HPZA 2CVIA 4Q7AA 1MNEA 1FHTA 5KFKA 3AA8A 2V8DA 3MEEB 3IC1A 1WHVA 1QAIA 3EPIA 5DDOC 2W9BA 4MKAA 1DHMA 1V9OA 5B0EA 1FRLA 1UVMA 1U2FA 2QYCA 4G1QB 4EBEA 1E6VB 2ABYA 1S9FA 4NCGA 2KXFA 2CJQA 1NHVA 1CSJA 3MMCB 3MM9A 5EN1A 5DG8A 2RIJA 1S1UB 3CJKB 3VALA 2ZC4A 2RQKA 4ZS6A 1RGVA 2DISA 2YWKA 3N28A 4GMKA 2Q3PA 5GMKa 2HFNA 1D9FA 2YKMB 4KV8B 3AA9A 2HS0A 4K5SA 3UNGC 4LSNB 3GG1A 1X7VA 3KLGA 3N01A 5KG2A 2O67A 5IS2A 2DITA 3LWLA 1O5JA 3AB4B 4WXWA 4F26A 3Q2SC 2C3PA 3SSQA 3RRKA 3K58A 2MJUA 4B9VA 2MZJA 3VZHA 2E5HA 3M6WA 2WRMA 3ZZTA 3TP2A 1R8BA 1CEZA 1FRIA 1HQUB 2B6AA 3KOAA 2GHVC 1IJEB 1C0UB 4NLGA 1TAQA 2HGMA 2DGWA 2JOQA 5I3PA 2KZMA 1R6YA 5C24A 3G8SA 4ZMMA 4HYKA 4TYBA 1P27B 3DYAB 4H4KC 1HBNB 4JI5F 3BSCA 3I0RA 3M6XA 1N54B 4ZOSA 4CO3A 1GXTA 4OZLA 2R8HA 1JIHA 3CUNA 2ASYA 4OLOA 2I5JB 4RNHA 5G4DA 3DN9A 2W7PA 3OR2A 4R8UA 4WXOA 4Q44A 2CQ1A 2L9WA 5KFTA 3BGUA 2EFPA 2ZHOA 3TYTA 2ASDA 1KD1T 3LP0A 1N5YB 2UU9F 3HM9A 3K5LA 2NXUA 1RT5B 2GFFA 1VK8A 1HFEL 3FGVA 3I0SA 3TA1A 1U6FA 3I6PA 2MKSA 2UVWA 1SB6A 4LSLA 5KOXA 3G96A 3J80Y 2LQ9A 2GQQA 2RVJA 4ZVFA 4AE5A 1S6PB 4ITSA 1VC5A 4ECYA 3CB4A 4OX6A 1WI8A 7FDRA 4XPCA 3MUVP 4OHZA 3VAHA 1WG1A 4WE1B 5HQ8A 3UQSA 1S49A 4DJBA 4USIA 4Y3CA 1P1LA 5IQ6A 5EWFA 4NZ7A 4ZVGA 1D1UA 3DDNA 3S1TA 1Z2ZA 4N76A 1HMVA 1KR4A 3DM2A 5J2PA 2E1CA 4A8XA 1REVB 2VG6B 2OPQA 2GJ2A 3CD5A 4U67Q 4OZNA 1NJIT 4PWDB 5FIIA 1FNMA 1LWCB 3JTOA 4DF4A 3H5XA 1JJHA 4NLRA 2HNYA 2ZDPA 3CCLS 2LEPA 2WAQD 1FCAA 2GIRA 2BJDA 1BQMA 3K5PA 4X4SA 3KLIB 2QFJA 3M8PA 3EPGA 3D0HE 2EBEA 3QZ8A 4ECVA 2LA4A 2SXLA 3I87A 1Q81T 1M1KT 3BM7A 5J2QA 4OIXA 3NNAA 5B08A 2YNHA 4MIBA 1FXDA 3DLKB 2ZH1A 4BHQA 2RF2A 3KLFB 3LUYA 2FLPA 4YDXA 1QLNA 2ZM6F 1X4AA 1UJ6A 3NLCA 5IM0B 2I8EA 4IKAA 3KKFA 3PW2A 2ASJA 5CHCB 2EI5A 3OTEA 3OSPA 1Y00A 3FFIB 4WK1A 1QAXA 4NXMF 2MSSA 4IO1A 4AQYF 4A8WA 3BSOA 4PUOA 1Y3JA 2BRKA 4X4QA 5K5MA 2UXCF 3ICLA 2MQMA 4ZHRB 2CJ9A 1R8HA 2B7CB 3MEDB 3DGPA 3ZZYA 2AF6A 3MURP 2J6UA 3NMRA 2CQHA 3V5RA 1TKZB 3H40A 3C6TB 2MYFA 2NQPA 4FNHA 2G0CA 2XCPA 4WU2A 2P9GA 2WONB 4E98A 2R7UA 3QYYA 2PIIA 3PO5A 2DIVA 3SDEB 1PO6A 3OXLA 2CJKA 2NUHA 2VOOA 2PMHA 5BYQA 3KK2A 1XR6A 2C3OA 1KS2A 2HLUA 4ES3A 2V0NA 3HT3A 2KT2A 2KKHA 4ID5B 5KFIA 3MMAA 1UVIA 4ZDNA 2DR5A 4ZA1A 2RMLA 4HH0A 5C5JA 3E3XA 1FVSA 1IKVB 1VK3A 2IBOA 2Q6BA 3A1YG 4LT6A 5DJBA 5IQQA 3UR3C 4DHVA 1SJQA 2VL1A 2ADBA 3CC4S 1AW0A 2LVWA 3S6EA 3U7JA 1NH8A 1KHVA 1RKIA 4OX9F 3OFEA 2XNRA 3MI7X 3H2VE 4BBYA 5KT7A 3FEXB 2RH3A 1RTHA 2PN6A 1VLYA 1JJ4A 1Q8IA 3VTIA 3DCAA 5H1SV 2ZOMA 2ZNZA 2J9CA 2VH7A 2DH9A 2XMJA 3DHWC 4L3NA 4QU7A 2BACA 4J9RA 1VHFA 4DS5A 3QWUA 5KFBA 3PZPA 2HVHA 4DSIA 5LSOA 2CPDA 4X4VA 4ICLB 4R5PB 4ES2A 4IOCQ 1X0PA 1TK8A 1FK9B 2HRYA 1Z2LA 1LXNA 4Q0BB 2AJ1A 5E3RA 4E8UA 4OHWA 1IUJA 3D5MA 1FKOB 1Y5IB 3N6MA 3ENVA 3KLEA 1MU2B 3RB6A 5ADZA 3T3FA 2XLIA 1FJCA 3MM6B 1DLOA 3G8QA 3IG1A 3DLEB 3QO9A 4NLXA 4P6QA 1UMJA 3CMES 2MKJA 3CTRA 5D4NA 2DR8A 2FVQA 1TKTB 3MM8B 4A8YA 2NYIA 3DRRA 3KFWX 1OWXA 3N9UC 3DOLB 1FTCA 1I1GA 4OJ1A 5FDLB 5DDPC 1APSA 1RK8A 4BDPA 2V8HA 3IN5A 2JVOA 3EZUA 5SUHA 3SCLE 1C1BB 1HI1A 3M05A 1U1KA 4JV5F 4NA2A 1E6YA 1TKDA 1FO1A 5CCMA 4CNZA 2CPFA 3O1LA 1NNDA 1HW9A 5IT9Y 2LA6A 3C6UA 5DS7A 4N8NA 1YJ9S 3RTVA 4Y2KA 1ROFA 1FKPA 1NO8A 1XNRF 1GXLA 3QJLA 2GCFA 1WEZA 2V4JA 4DS4A 2DPJA 1W2IA 2LU2A 4FF1A 2MJNA 1YQHA 3MAQA 4G1IA 2NZ4A 2RS8A 3HHLB 3TANA 1ZM2A 5HO4A 3MF5A 2PT0A 4NLPA 2HIQA 4UOCA 4KHRA 4OZ1A 4WFXA 5KFQA 2OTLS 2YKNB 3M9MB 2J0QD 6FDRA 2VG7A 5F0UA 2RT3A 1NAQA 2EFQA 3PIOQ 4CO1A 2UUCF 3GV8B 2HRUA 3PIPQ 1Y5LB 1UWBA 3N5BA 3SMZA 2ZZMA 4RUAA 4K4WA 4ED1A 4A8FA 4J9NA 2Q66A 2HNZA 4IYQA 4OZ0A 1KEKA 2DRBA 2UVUA 1S79A 4Y2CA 3O3LA 1MWZA 4MAKA 3K5NA 4NA3A 4FF2A 4X65F 4IRKA 2RJZA 1FXLA 4DLEA 1M5KC 4UY8T 3DMJB 2WOMB 4Y2AA 3LO3A 4DFMA 2KFYA 1FEEA 2ZH7A 1UEVA 2V94A 3U02A 3GIMA 3HDSA 3DRPB 2XMMA 2VFSA 1S9EA 3NNHA 2ZOGA 5A6WA 1M5PC 5D4PA 1NJWA 1JLCB 4ECWA 2ZHBA 1OSCA 2ZE2A 4C8YA 3H4BA 4AXJA 5AXNA 2J7KA 2BZ2A 4DR3F 3IO1A 4MIWA 2CQDA 2E9TA 5GAHU 1ZPWX 2ZBIA 5T7LB 2XO7A 4M94A 2AU0A 3CDBA 1U25A 1X4HA 3M2UB 5C42B 4I67A 2IRYA 1VQ5S 1UVKA 2IA0A 4DQIA 1RWUA 4M1KA 4RW8A 4DL6A 5CZXA 3THPA 5A8RA 3BEGB 4C98A 5DQGA 2GGPA 2E44A 1TL4A 3IAM9 4DSEA 5DM6Q 3PRDA 3T5JA 4ZPTR 1TK0A 2DNHA 5KFZA 5J1EA 4RBTA 4DSKA 3BQ1A 1NEEA 1IM4A 3ENWA 1SV5B 3M30B 4ZVHA 2V5HG 3JYTB 2HMIB 3LP1B 3MEGB 4ZKAA 1YRXA 5IXUA 3MUMP 3Q22A 1JNZB 2POKA 1J5OB 2XMKA 4M5DB 2J0XA 2N3LA 2D3OR 1YRTA 3OUYB 2GO9A 3BGLA 1N6QA 1VQLS 1RTJB 5BYSA 4ED8A 4C8NA 1HWJA 1VOMA 1SL2A 1RKJA 2ZJPQ 2MDAA 3LAMA 5CYQA 3CPWR 2BOPA 3K5OA 2EW9A 2F9JA 3MMBB 1IBKF 2XWYA 2AP6A 4F8RA 2IHR1 4IQXA 1RT3B 1SBRA 4K4UA 5I3UB 4H4OB 1FJ7A 4OHVA 2JJ4D 4TU8A 1RT6B 1FF2A 1TVRB 1LFWA 1RI7A 3QGHA 4I7FA 4OV1A 3MM5B 2OO4A 1FDDA 3W2VA 2QA1A 1BY9A 2FGOA 2ZNYA 3TAQA 1D9DA 3S01A 2NPIA 2R7XA 1LW0A 1DBDA 2RE1A 5F41A 2N7YA 2YX1A 2FJXA 2KFZA 2IA6A 2CQIA 4D3GA 1VQ4S 1V3ZA 2OIHA 3NAIA 1B7FA 2AYMA 2RKIB 2QA4S 5E5NA 1DQ9A 2YQ3A 4YR3A 1SKRA 3HP6A 1OO0B 1TV6A 2A2CA 3VAIA 2VFUA 1MROB 4IFVB 2WHOA 3OL6A 3AB2B 2CIMA 1GTHA 3I4PA 2OPPA 4PXDA 3ONQA 4KRWA 3E2EA 3MR6A 2MKIA 2QE5A 5L1IA 2VFVA 4ZVEA 1X4FA 4URQU 1KLNA 3Q8RB 4TYAA 5A0YA 3WC0A 2BM1A 1GXUA 2OPSA 4KTQA 2VQFF 5K14A 3CIMA 2D7SA 4JV0A 1N36F 2F8MA 5HL7Q 2AYBA 1X5SA 4HTJA 2GHWA 3BF4A 4UUXA 4QOTA 1KVJA 3I5CA 3TRGA 2XY7A 3MR5A 4CO4A 4TU9A 5KG4A 2LEAA 2MZRA 3AY0A 4USJC 1T05A 3LALA 3R5AA 4Y34A 5E7OB 3WC2A 4B3SF 3MTJA 1WI6A 1IBLF 2OPRA 4O44B 4F4WA 3OFHA 1NK8A 4A8OA 3V6DB 1TKXB 5IT4A 1KQSR 2HHSA 4DFJA 4FF3A 4J9MA 1X4CA 2IFXA 3NP5A 1QSYA 3R5BA 4Q8EA 2R7TA 3SCKE 3PO4A 1T94A 1KTVA 4JI8F 5DG9A 4Q8FA 1VI7A 3N0VA 2V9WA 1Y5NB 3BR8A 4DDFA 1DTTB 4DWIA 2WK4A 5M2UA 2D74B 2MQPA 1XEZA 2APOA 2ZH8A 2ATLA 4IR1A 5M2PA 3R5CA 1X4GA 1VC0A 2W4PA 4BCAA 2J8AA 1QE1A 3K8VA 3QIPA 5GADI 2R2RA 1DFDA 1DRZA 1QSSA 2ZHAA 1VQNS 3UD4P 4RW7A 2LECA 2F3JA 2PEHA 1KTQA 3PW4A 3PXGa 3M8RA 5AXKA 1KLMA 1RT4A 4QWBA 4Q2MA 3P6YC 2W8LA 3HVRA 1ZZNA 1SJFA 4QWEA 3FNNA 3EGWB 2DGUA 3EXCX 2EKYA 3HFKA 4DQQA 2Q43A 4QR1A 2XSFA 3MPVA 3UWTA 3DLHA 1WF1A 3CJ3A 2P6TA 1VFJA 3ISNC 3CC7S 4B3TF 5D8HB 4Y65A 5HI7A 3OJSA 2R9LA 2CPXA 1C4AA 2GQCA 2JH3A 4IDKA 4CTAB 3IWLA 3DNCA 3TW0A 2NSBA 2CQBA 1T3NA 3FQKA 2DTJA 1NKCA 2O1PA 3T5LA 3KTQA 4K59A 4K4SA 4PPDA 3KK3B 4DFPA 4I2PB 3FRZA 3UW1A 1S10A 1AFJA 4O0IA 3HHLD 2YY3A 1DQAA 5LXYA 1I94F 3UPFA 5HMZA 4DL3A 4F3MA 4PQUB 5JVGQ 1WHXA 2GMJA 4ILLA 3CDEA 4BC9A 4DR4F 1NK0A 2ZH2A 2W9CA 2EFVA 4ZCMA 2WB4A 2B5JA 3L95X 2LQBA 1SXLA 4ZPCA 4J9KA 1IKWB 3HHEA 3KJVA 3TUZC 3CULA 1LK5A 1JB0C 2ZD1B 3LH2S 3GWCA 1NK7A 3LP2B 2Y1IA