2FHNX

Avidin related protein avr4 (c122s, k109i mutant) in complex with bna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
b'CSLTGKWTNNLGSIMTIRAVNSRGEFTGTYLTAVADNPGNITLSPLLGIQHKRASQPTFGFTVHWNFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDISYDWIATRVGYNNFTRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Avidin-related protein 4/5
publication title Factors dictating the pseudocatalytic efficiency of avidins
pubmed doi rcsb
source organism Gallus gallus
molecule tags Sugar binding protein
total genus 25
structure length 118
sequence length 118
chains with identical sequence Y
ec nomenclature
pdb deposition date 2005-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2fhnX00
1VWQB 2IZFB 5K68A 2RTIB 2A5BA 1HXLA 4BJ8A 1RXKA 1VWBB 2OFBA 2RTLA 2JGSA 2RTAA 3T6FA 1STSB 1LUQA 2OF8A 1SWQA 2A5CA 2IZJA 4GJSA 3VGWA 3T6LA 2ZSCA 4Z28A 4DNEA 5K67A 1SWCA 1VWRB 1RXJA 1VWIB 2AVIA 5JD2A 2IZCB 1N9YA 4CPEA 4BX6B 1SRFA 1SLDB 3RY2A 1MM9A 1VWNB 1VWGB 1VWPB 4U46A 1SRIA 1NQMA 1SRJA 1KL5A 1SWRA 1WBIA 1SLFB 4BX7B 1DF8A 2RTRB 3RDQA 1KFFA 2UYWA 1SWHA 4JO6A 2RTKA 1MK5A 1LCWA 1SRGA 4YVBA 1PTSA 2BC3A 3PK2A 3FDCA 3RDSA 1VWMB 1I9HA 2RTGB 3WYPA 4CPHA 3RDOA 1VWKB 2G5LA 1SWLA 1SWOA 1SWTA 2IZDB 1KL3A 4IRWA 4OKAA 4Y59A 5CHKA 4CPIA 2RTMA 4GGTA 1VWLB 1KL4A 3VHMA 1SLGB 2Y32A 2RTCB 1VYOA 1Y52X 2FHNX 3RDXA 4CPFA 1SREA 3VHIA 2IZLB 4Z27A 2Y3EA 2WPUA 3EW1A 4I60A 1N4JA 1VWJB 1SWBA 3MM0A 5IRAA 1NQNA 1NDJA 4Z2OA 1AVDA 1VWDB 2OFAA 4GGZA 1RSTB 2RTDB 4GDAA 4BBOA 2RTOB 1STRB 3WZNA 4Y5DA 1NBXA 1SWEA 2C1QA 3WZOA 5L3YA 2GH7A 4BX5B 2MF6A 4GJVA 5CSEA 1SRHA 1VWCB 3T2WA 2RTJA 4CPHB 4GD9A 3RE5A 1LCVA 1VWEB 3MG5A 1NC9A 2FHLA 4BX6A 1N43A 2IZGB 3T2XA 4JHQA 4Z2PA 1RXHA 1VWFB 2RTEB 4BCSA 4BX7A 2Y3FA 3RE6A 2QCBA 3RY1A 4BX5A 1Y55X 1SWNA 1SWFA 1SWPA 1SWAA 1N7YA 2RTHB 2IZHB 5F2BA 1AVEA 1LDQA 2IZIA 3RDUA 3EW2A 2A8GA 4Z2VA 2RTPB 1SWDA 2IZEB 2RTBB 1N9MA 1HXZA 5IRUA 3SZIA 3WZQA 3WYQA 1VWOB 2IZBA 2RTNB 2IZKA 1VWAB 4EKVA 1SLEB 1STPA 3WZPA 3RDMA 2C1SA 2C4IA 3X00A 1SWSA 1Y53X 2OF9A 1RSUB 1LCZA 1SWKA 4Z6JA 4GGRA 4JNJA 1HQQA 1HY2A 1SWUA 2IZAA 2CAMA 1SWGA 1VWHB 2F01A 1LDOA 1MOYA 2RTFB 5B5FA 1LELA 2UZ2A 5B5GA 3SZHA 1RAVA 5IRWA 1IJ8A 3VHHA 3SZJA 1MEPA 1SWJA 2RTQB
chains in the Genus database with same CATH superfamily
4FBVA 1VWQB 1DFVA 4IAXA 1W5RA 2IZFB 4A60A 1ADLA 1S7DA 2RTIB 1YP6A 4BVMA 1ERXA 2L68A 4NV7A 2RTLA 4A1YA 2JGSA 2X55A 2PI3O 1STSB 3AUMO 1SWQA 1SY3A 4GJSA 2FS7A 3T6LA 2ZSCA 4YCEA 1QY2A 1SMPI 4HPDA 1YWAA 1RXJA 1OPAA 1P6PA 4IB6A 5D45A 2Q39A 4BQUA 3PQUA 2IZCB 2RD7C 5AJCA 1RBPA 1NGLA 3S26A 4MISA 3FENA 3WBGA 1SLDB 2QOSC 4C5PA 3RY2A 4D6AA 3FA6A 5EDCA 3BS2A 3FEKA 1DZKA 1VWGB 1VWPB 4ZFXA 1MX7A 3FA9A 3QQ2A 1KT6A 1NQMA 2FGSA 1YWCA 3LHNA 1JJUA 5H9KA 3WJGA 2MO5A 1YIVA 1LIBA 3AEHA 1KT4A 3O2YA 4JO6A 4GETA 4EXZA 2OFRX 1B56A 4GUZA 1MX8A 3FDCA 4U8UO 2R74A 3B2IA 5BYPA 1ICNA 2LBAA 1I05A 2OVSA 3NQ9A 1VWKB 3WYPA 4WFVA 4R0BA 4MVEA 5HA0A 5HA1A 3ZW1A 1TW4A 2IZDB 1AVGI 5CHKA 4YGHA 1HN2A 1KL4A 3EBKA 2Y32A 1O1UA 1TXLA 3B2LA 2L5PA 2RTCB 1Y52X 4ON1A 1H91A 2IZLB 3F8AA 3FW4A 5HBSA 4I60A 3HK1A 4O3WA 3MM0A 3H3IA 2DJGA 1NQNA 2OY7A 3RWXA 1AVDA 2OY1O 2N93A 2WQAE 3FLLA 4GU8A 1I78A 2A2GA 3D97A 2W2AA 2WUTA 3PQSA 4GDAA 4O4SA 3ELZA 2IFBA 2QO5A 1RLBE 2KTSA 3WZNA 5BVTA 1HQPA 5AQ6A 2G7BA 1TOWA 3JS1A 4HPAA 2MF6A 1QFTA 4PJ2A 4GJVA 3DSZA 3MBTA 1VWCB 4ORXA 3VG5A 2RTJA 1X89A 1OPBA 5LJDA 3RE5A 3WXQA 3ZW0B 4ZHFA 1KZWA 1OBQA 4I3DA 1AQBA 1X8OA 5LKEA 1KGLA 3PDFA 2HKDA 1BSQA 2AT0X 5D8JA 1FE3A 1VWFB 1N0SA 2RTEB 1HMSA 2JW1A 4FQBB 2Y3FA 1BWYA 3RE6A 1GKAB 4CSBA 3UEVA 1MVGA 4I9SA 4GNWA 4N7DA 3VG4A 3OBLA 1Y9LA 2AKQA 2RTHB 4M6SA 4M7MA 3P6FA 2FTBA 1E5PA 2XSTA 4OS0A 1AVEA 1LDQA 1GX8A 2IZIA 2OVEA 2R73A 2OVAA 3ELXA 4YGGA 4AZOA 1JBHA 2NP1A 2G8CO 2RTBB 3JQOA 3D9WA 1NP4A 5IRUA 3WZQA 1DF3A 4LKTA 4ZGFA 1GX9A 2IZKA 4L1NA 1SXUA 1JQPA 3BRNA 4NYRA 3C78X 5HZQA 4LKPA 3B2KA 3BX7A 1U17A 3VE2A 5H9LA 2F09A 4CDFA 4QGWA 2C1SA 2C4IA 1QY0A 3EMMA 3FIDA 4KT5A 1LFOA 1PEEA 3WJEA 3X00A 4OMWA 4AW8A 4DCBA 4K19A 3SLTA 1YWDA 2RQ0A 3BSZE 4U9CA 3KQ0A 1EI5A 1HQQA 1E00A 4INNA 5HCEC 4RUNA 4CPHA 1JJJA 3ZW0A 2CZTA 1MOYA 3DTQA 3P24A 1T8VA 4FBOA 4IB9A 4MEEA 4YFRA 4RUUA 2FT9A 3VHHA 3SZJA 1NP1A 1TVQA 2CM4A 1EUOA 2QOMA 4KH8A 2GTLN 2X8TA 1MEPA 4YKOA 5EDBA 2RTQB 1SY1A 1FJ1E 5HZ5A 1GKAA 1UYNX 1HMTA 2RCTA 5K68A 1QQSA 1AB0A 4QAEA 3V8UA 1O8VA 4BJ8A 1MUPA 1DC9A 1EPBA 2RTAA 3NBXX 5IO5A 2L67A 4Y0SA 2A5CA 3BU1A 3F9DA 3VGWA 1IFCA 2OL7A 5HZ8A 5HCCC 2WEWA 1SWCA 1CRBA 3SAOA 1EQDA 2CBRA 1UREA 3P6DA 4D6BA 1X8UA 4TLJA 2JU3A 2A2UA 3FA7A 3I17A 3UAQA 1SRFA 2ACPX 3APUA 2ACOA 3RSWA 4CPEA 4UU2A 4A8ZA 1T0VA 5FQ8E 5D48A 1ZNHA 1WBIA 4YDBA 1W6FA 2W2FA 1SLFB 1UYOX 5EEEA 3VG2A 4YMYA 1EIOA 1SWHA 4LZVA 2RTKA 1BLRA 2ASNX 2AT6X 2LKKA 3CKGA 1A2DA 1OEKA 5HAEA 2G78A 4OELA 1I9HA 4YKMA 4IABA 1ERBA 1ICMA 1LIDA 3PH5A 2LA7A 4XMFA 1KT7A 4OKAA 1AELA 4CPIA 2GC9A 3JSQA 4CK4A 3VHMA 1SLGB 4DQ3A 1IIUA 2GTLM 4TKJA 1XCAA 4CPFA 3VHIA 4Z27A 3EW1A 2MM3A 1VWJB 1JZUA 3HWEA 1BRPA 3FR4A 3SLJA 1OBPA 1VWDB 3B2HA 3OE3A 2RTDB 1LKEA 1YWBA 3PEDA 4BBOA 1SA8A 1STRB 1B8EA 1X8NA 1Z24A 2DM5A 1A57A 2WSJA 1SWEA 2C1QA 4AYHA 5DG4A 4MVLA 1BEBA 4NNTA 5L8NA 2WEXA 2HLVA 4IB7A 5CSEA 3T2WA 1LCVA 1VWEB 2NNEA 1QY1A 3PPTA 2FHLA 2AL0X 1N43A 3NQ3A 2IZGB 3EC5A 1X8PA 3BX8A 3FR5A 3G7XA 2GTLO 1EIIA 3PH6A 4FGIB 1R0UA 4EQAC 5EEDA 1SXXA 4YVBA 4ALOA 1Y55X 1G5WA 1GGLA 4YDAA 5L8IA 1N7YA 2AT8X 3WJCA 4ZH9A 2GTFX 2Q2MA 3APXA 1B0OA 3CWKA 3EW2A 2HMBA 2OVDA 4OMXA 1UZ2X 4EFGA 3MX7A 4Z2VA 3HWFA 1JMZA 4O4UA 1K3BA 3BU9A 1U0XA 2EU7X 2YMSA 4O4XA 2RTNB 1VPRA 4NP1A 5HTDA 2I5ZO 5H9NA 2RCQA 2X56A 1A18A 2X32A 4LQZA 1STPA 1SY2A 4IAWA 1LPJA 3WZPA 1PMPA 1TOUA 1D2UA 4ZR2A 4NLIA 2XKLA 4OS8A 3BY0A 5B2AO 4MVIA 4XMHA 4YBPA 5CE4A 2CBSA 4ML7B 4GNYA 4O49A 5C0NA 5K06A 5FQ7E 2X4MA 3KFGA 1RSUB 1LCZA 4Z6JA 2LBVA 1LICA 3CR6A 4JNJA 3WVMA 2E4JA 1I06A 2CM9A 1IKJA 4NYQA 4ZHHA 4CDEA 1SWGA 2F01A 1KQXA 1ZNEA 2F73A 2L9CA 3FR2A 1LELA 2DJFA 2HNXA 3N91A 2UZ2A 4ODDA 3ZWEA 3TGBA 1DZMA 4XMGA 5B11O 3T1DA 2Z4IA 1OBUA 2AH7X 2OL8O 3P02A 1HBPA 3NADA 3P6HA 4GDZA 5EZ2A 4ZHCA 5IRWA 1SWJA 4GH7A 1MDCA 5LJEA 3PECA 1JIWI 5IXGA 4AZMA 4AZQA 5BVSA 3F6ZB 5LJGA 3UEWA 5HZ9A 5FQ6E 3D95A 3ZUIA 1RXKA 2K62A 2LFOA 2OFBA 3HWGA 4KC7A 5B3MO 2ANSA 4KIIA 3FYFA 3CQNA 3T6FA 1LUQA 2OF8A 2WQ9A 4DNEA 2OYBO 5K67A 4Z28A 4IBAA 2A0AA 5AEOA 1G85A 1D3SA 1N9YA 4BX6B 4ORSA 4ZCBA 4ZGUA 1KOIA 1VWNB 1ZRYA 1IW2A 3C77X 1EXSA 2O62A 2HZQA 1SRIA 4U46A 2FKGA 1SRJA 1U18A 4I3BA 2PY1A 2RTRB 3CBSA 1KFFA 2UYWA 5AJBA 1PBOA 3GE2A 1MK5A 2AT5X 3PK2A 3ZQ3A 4CPHB 1LNMA 5FENA 2Q2PA 4YFQA 3RDSA 4LZUA 1VWMB 4ARHA 2FWVA 4NV8A 4ZJ0A 2NNDA 5B27A 1GT1A 4Y0QA 3RDOA 3SLOA 1S2PA 3VU1A 1SWLA 5IO7A 1GT4A 4IRWA 1KL3A 4Y59A 2KW1A 4TKBA 2RTMA 1QABE 2BLGA 3O22A 4GGTA 4GRJA 3RZYA 2Z4HA 2OZQA 3RDXA 2BHVA 2FHNX 1SREA 4NW4A 3U03A 2Y3EA 2WPUA 3HOEA 5KHPA 1N4JA 4HFOA 3VG6A 2NNQA 5F1EA 1JV4A 4U8UN 3RBYA 1NDJA 3STNA 4Z2OA 2RA6A 1JMXA 4ID2A 3VG3A 3FIQA 3Q6LA 1YUPA 2BSZA 3NP1A 2A13A 4Y5DA 1NBXA 4O3XB 4OEMA 1BBPA 5KICA 1EPAA 4WFUA 1BSYA 3APWA 4QGXA 3CKFA 2R56A 3SOTA 2X8SA 1HBQA 1SRHA 2X8FA 5D4AA 4EDEA 4GD9A 1CBRA 1KQWA 4BX6A 3E3CA 2RN4A 3PP6A 1G74A 4NNSA 5EPQA 3ZW2A 2QM9A 4JHQA 5H9AA 3STMX 2ALLX 4AZNA 4U3QA 1FEMA 1FTPA 4XMCA 4BX5A 3ZZVA 5F2BA 1SWAA 2AMMX 2YG2A 4Y0PA 3FEPA 4A1HA 2HYSA 2Q4NA 5F7GA 1HMRA 3LV4A 1OEJA 2IZEB 1JJXA 4ZHGA 2BT9A 1N9MA 2QMIA 2P8GA 3B2JA 4I3CA 5FAZA 3WYQA 3FELA 2MJIA 4ZHDA 2IZBA 2X34A 5KIDA 4I6SA 1E2TA 3HTYA 4DQ4A 2QO4A 1X71A 3TZSA 1VWAB 4GE1A 4U8UM 4EKVA 5F58A 3NPOA 3RDMA 2K23A 4PSQA 5F6ZA 1SWSA 1Y0GA 1Y53X 1K24A 1BM5A 3BLGA 2OF9A 4QZUA 4O3ZA 3KFHA 3S5VA 4TQ2A 2OY8A 3D96A 1IKEA 2ZAIA 4BOEA 2JU8A 1EW3A 2LB6A 3EM0A 3EYCA 4GGRA 4O4OA 1O1VA 3LTWA 4OS3A 4TKHA 3TF6A 1SXWA 1ML7A 1HY2A 2CAMA 3HPEA 1VWHB 2RTFB 3HOLA 3KZAA 4XMEA 5B10O 1LF7A 2W2BA 4N7CA 3WJFA 1QWDA 4IMNA 4ZH6A 5B5GA 3WJDA 3KVNA 1ZNKA 1FDQA 2KT4B 1IJ8A 3FMZA 4YFPA 3FA8A 4TJZA 4YBUA 5JR8A 1B4MA 4JGLA 3OD9A 2BS6A 3NX2A 3P6CA 3S5XA 1QFVA 4ALBA 1FELA 5B29A 1XKIA 3NQKA 3WOVA 1VYFA 2A5BA 1HXLA 4I95A 1JYJA 2AF5A 1YP7A 4KC8A 1VWBB 4GK9A 1GT3A 1E06A 1GT5A 2FR3A 2OFMX 3WJBA 4ORYA 3Q34A 3TGAA 2IZJA 4ORUA 3VPJE 4MIRA 2KTDA 1S44A 1W4TA 1VWRB 1VWIB 2AVIA 5JD2A 1OEEA 4QZTA 1MM9A 4HPBA 4EEJA 2OL6O 5FFHA 4BX7B 1KL5A 1SWRA 5IO6A 1DF8A 3RDQA 5L8OA 1L6MA 1ZNLA 5LKFA 4UU3A 1LCWA 1QG5A 1SRGA 1PTSA 2BC3A 2WWPA 3P6EA 4B55A 4ES7A 3K3LA 2G79A 2MWHA 1DZPA 1KT5A 1KZXA 3KFIA 4CDDA 2VFCA 2RTGB 1CBSA 4GZVA 2G5LA 4YCHA 1SXYA 1SWOA 1SWTA 2JN3A 4QYNA 1LIFA 4WHIA 2FKJA 5BVQA 1GX3A 1BRQA 1DZJA 2I5VO 1VWLB 2X46A 5LJKA 1CJ5A 3O19A 3KFFA 5LJCA 2OY5O 1X8QA 1VYOA 4XMDA 4I9RA 4MVKA 4O9SA 2WR6A 1SWBA 1FENA 5IRAA 2VDFA 2OFAA 2POAA 4GGZA 1RSTB 1Y9TA 2RTOB 3EBWA 4O3YA 3U9PC 1JYDA 4YGZA 3WZOA 5L3YA 1CBIA 2HZRA 2GH7A 3S60A 4BX5B 4CDCA 1EALA 1KT3A 1OSPO 1PM1X 1BJ7A 2Q9SA 3AKNA 3GAQA 1GM6A 4IB8A 4CV7A 4GKCA 3UEXA 3MG5A 1NC9A 4QGVA 1I04A 3OJYC 1T68X 3RKGA 3T2XA 1SY0A 3BDRA 4IMOA 4Z2PA 5HWZA 4HPCA 2VFBA 4L3RA 1RXHA 3CQRA 4BCSA 4BX7A 5LJBA 3ZI8A 3VG7A 2QCBA 1LIEA 3ZUOA 1GXAA 2KD2A 3RY1A 4ORWA 4QRLA 4AZRA 4Y0RA 1ZNDA 1SWNA 1SWFA 1KXOA 1SWPA 1BSOA 2IZHB 5D47A 2M4LA 1ZNGA 1A3YA 2A3FX 2X45A 3NX1A 3RDUA 1CBQA 2A8GA 2RTPB 1SWDA 3AKMA 4ORRA 4QYPA 5F6BA 4YH0A 2MHDA 1HXZA 2FRSA 3SZIA 2FR2A 2AT3X 1VWOB 4AZPA 1I4UA 4FBRA 5CYBA 3APVA 5DPQA 1ALBA 3NR3A 2GJ5A 3VE1A 1E02A 1SLEB 3L4RA 4TNNA 3CBCA 5H8TA 4BGFA 1WUBA 4KCAA 3TGCA 4HWMA 1G7NA 3STKA 5HTEA 2BS5A 4NLJA 1ACDA 3IFBA 1DV9A 2QO6A 2ZAGA 1SWKA 1IFBA 2JMBA 5LJHA 3FW5A 3P6GA 3UEUA 2FS6A 3IA8A 3U0DA 3ZW1B 4COTA 1SWUA 2IZAA 2JU7A 3CMPA 3QKGA 3D4RA 1LDOA 5B5FA 4QNIA 3C76X 2FLJA 1PBYA 3MVFA 3I0AA 3SZHA 1RAVA 1VYGA 3HWDA 4WBKA 4QQ1A 5HCDC 2CZUA 5HZ6A 2JOZA
chains in the Genus database with same CATH topology
1VWQB 2IZFB 5K68A 2RTIB 2A5BA 1HXLA 4BJ8A 1RXKA 1VWBB 2OFBA 2RTLA 2JGSA 2RTAA 3T6FA 1STSB 1LUQA 2OF8A 1SWQA 2A5CA 2IZJA 4GJSA 3VGWA 3T6LA 2ZSCA 4Z28A 4DNEA 5K67A 1SWCA 1VWRB 1RXJA 1VWIB 2AVIA 5JD2A 2IZCB 1N9YA 4CPEA 4BX6B 1SRFA 1SLDB 3RY2A 1MM9A 1VWNB 1VWGB 1VWPB 4U46A 1SRIA 1NQMA 1SRJA 1KL5A 1SWRA 1WBIA 1SLFB 4BX7B 1DF8A 2RTRB 3RDQA 1KFFA 2UYWA 1SWHA 4JO6A 2RTKA 1MK5A 1LCWA 1SRGA 4YVBA 1PTSA 2BC3A 3PK2A 3FDCA 3RDSA 1VWMB 1I9HA 2RTGB 3WYPA 4CPHA 3RDOA 1VWKB 2G5LA 1SWLA 1SWOA 1SWTA 2IZDB 1KL3A 4IRWA 4OKAA 4Y59A 5CHKA 4CPIA 2RTMA 4GGTA 1VWLB 1KL4A 3VHMA 1SLGB 2Y32A 2RTCB 1VYOA 1Y52X 2FHNX 3RDXA 4CPFA 1SREA 3VHIA 2IZLB 4Z27A 2Y3EA 2WPUA 3EW1A 4I60A 1N4JA 1VWJB 1SWBA 3MM0A 5IRAA 1NQNA 1NDJA 4Z2OA 1AVDA 1VWDB 2OFAA 4GGZA 1RSTB 2RTDB 4GDAA 4BBOA 2RTOB 1STRB 3WZNA 4Y5DA 1NBXA 1SWEA 2C1QA 3WZOA 5L3YA 2GH7A 4BX5B 2MF6A 4GJVA 5CSEA 1SRHA 1VWCB 3T2WA 2RTJA 4CPHB 4GD9A 3RE5A 1LCVA 1VWEB 3MG5A 1NC9A 2FHLA 4BX6A 1N43A 2IZGB 3T2XA 4JHQA 4Z2PA 1RXHA 1VWFB 2RTEB 4BCSA 4BX7A 2Y3FA 3RE6A 2QCBA 3RY1A 4BX5A 1Y55X 1SWNA 1SWFA 1SWPA 1SWAA 1N7YA 2RTHB 2IZHB 5F2BA 1AVEA 1LDQA 2IZIA 3RDUA 3EW2A 2A8GA 4Z2VA 2RTPB 1SWDA 2IZEB 2RTBB 1N9MA 1HXZA 5IRUA 3SZIA 3WZQA 3WYQA 1VWOB 2IZBA 2RTNB 2IZKA 1VWAB 4EKVA 1SLEB 1STPA 3WZPA 3RDMA 2C1SA 2C4IA 3X00A 1SWSA 1Y53X 2OF9A 1RSUB 1LCZA 1SWKA 4Z6JA 4GGRA 4JNJA 1HQQA 1HY2A 1SWUA 2IZAA 2CAMA 1SWGA 1VWHB 2F01A 1LDOA 1MOYA 2RTFB 5B5FA 1LELA 2UZ2A 5B5GA 3SZHA 1RAVA 5IRWA 1IJ8A 3VHHA 3SZJA 1MEPA 1SWJA 2RTQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VWQ B;  2IZF B;  5K68 A;  2RTI B;  2A5B A;  1HXL A;  4BJ8 A;  1RXK A;  1VWB B;  2OFB A;  2RTL A;  2JGS A;  2RTA A;  3T6F A;  1STS B;  1LUQ A;  2OF8 A;  1SWQ A;  2A5C A;  2IZJ A;  4GJS A;  3VGW A;  3T6L A;  2ZSC A;  4Z28 A;  4DNE A;  5K67 A;  1SWC A;  1VWR B;  1RXJ A;  1VWI B;  2AVI A;  5JD2 A;  2IZC B;  1N9Y A;  4CPE A;  4BX6 B;  1SRF A;  1SLD B;  3RY2 A;  1MM9 A;  1VWN B;  1VWG B;  1VWP B;  4U46 A;  1SRI A;  1NQM A;  1SRJ A;  1KL5 A;  1SWR A;  1WBI A;  1SLF B;  4BX7 B;  1DF8 A;  2RTR B;  3RDQ A;  1KFF A;  2UYW A;  1SWH A;  4JO6 A;  2RTK A;  1MK5 A;  1LCW A;  1SRG A;  4YVB A;  1PTS A;  2BC3 A;  3PK2 A;  3FDC A;  3RDS A;  1VWM B;  1I9H A;  2RTG B;  3WYP A;  4CPH A;  3RDO A;  1VWK B;  2G5L A;  1SWL A;  1SWO A;  1SWT A;  2IZD B;  1KL3 A;  4IRW A;  4OKA A;  4Y59 A;  5CHK A;  4CPI A;  2RTM A;  4GGT A;  1VWL B;  1KL4 A;  3VHM A;  1SLG B;  2Y32 A;  2RTC B;  1VYO A;  1Y52 X;  2FHN X;  3RDX A;  4CPF A;  1SRE A;  3VHI A;  2IZL B;  4Z27 A;  2Y3E A;  2WPU A;  3EW1 A;  4I60 A;  1N4J A;  1VWJ B;  1SWB A;  3MM0 A;  5IRA A;  1NQN A;  1NDJ A;  4Z2O A;  1AVD A;  1VWD B;  2OFA A;  4GGZ A;  1RST B;  2RTD B;  4GDA A;  4BBO A;  2RTO B;  1STR B;  3WZN A;  4Y5D A;  1NBX A;  1SWE A;  2C1Q A;  3WZO A;  5L3Y A;  2GH7 A;  4BX5 B;  2MF6 A;  4GJV A;  5CSE A;  1SRH A;  1VWC B;  3T2W A;  2RTJ A;  4CPH B;  4GD9 A;  3RE5 A;  1LCV A;  1VWE B;  3MG5 A;  1NC9 A;  2FHL A;  4BX6 A;  1N43 A;  2IZG B;  3T2X A;  4JHQ A;  4Z2P A;  1RXH A;  1VWF B;  2RTE B;  4BCS A;  4BX7 A;  2Y3F A;  3RE6 A;  2QCB A;  3RY1 A;  4BX5 A;  1Y55 X;  1SWN A;  1SWF A;  1SWP A;  1SWA A;  1N7Y A;  2RTH B;  2IZH B;  5F2B A;  1AVE A;  1LDQ A;  2IZI A;  3RDU A;  3EW2 A;  2A8G A;  4Z2V A;  2RTP B;  1SWD A;  2IZE B;  2RTB B;  1N9M A;  1HXZ A;  5IRU A;  3SZI A;  3WZQ A;  3WYQ A;  1VWO B;  2IZB A;  2RTN B;  2IZK A;  1VWA B;  4EKV A;  1SLE B;  1STP A;  3WZP A;  3RDM A;  2C1S A;  2C4I A;  3X00 A;  1SWS A;  1Y53 X;  2OF9 A;  1RSU B;  1LCZ A;  1SWK A;  4Z6J A;  4GGR A;  4JNJ A;  1HQQ A;  1HY2 A;  1SWU A;  2IZA A;  2CAM A;  1SWG A;  1VWH B;  2F01 A;  1LDO A;  1MOY A;  2RTF B;  5B5F A;  1LEL A;  2UZ2 A;  5B5G A;  3SZH A;  1RAV A;  5IRW A;  1IJ8 A;  3VHH A;  3SZJ A;  1MEP A;  1SWJ A;  2RTQ B; 
#chains in the Genus database with same CATH topology
 4FBV A;  1VWQ B;  1DFV A;  4IAX A;  1W5R A;  2IZF B;  4A60 A;  1ADL A;  1S7D A;  2RTI B;  1YP6 A;  4BVM A;  1ERX A;  2L68 A;  4NV7 A;  2RTL A;  4A1Y A;  2JGS A;  2X55 A;  2PI3 O;  1STS B;  3AUM O;  1SWQ A;  1SY3 A;  4GJS A;  2FS7 A;  3T6L A;  2ZSC A;  4YCE A;  1QY2 A;  1SMP I;  4HPD A;  1YWA A;  1RXJ A;  1OPA A;  1P6P A;  4IB6 A;  5D45 A;  2Q39 A;  4BQU A;  3PQU A;  2IZC B;  2RD7 C;  5AJC A;  1RBP A;  1NGL A;  3S26 A;  4MIS A;  3FEN A;  3WBG A;  1SLD B;  2QOS C;  4C5P A;  3RY2 A;  4D6A A;  3FA6 A;  5EDC A;  3BS2 A;  3FEK A;  1DZK A;  1VWG B;  1VWP B;  4ZFX A;  1MX7 A;  3FA9 A;  3QQ2 A;  1KT6 A;  1NQM A;  2FGS A;  1YWC A;  3LHN A;  1JJU A;  5H9K A;  3WJG A;  2MO5 A;  1YIV A;  1LIB A;  3AEH A;  1KT4 A;  3O2Y A;  4JO6 A;  4GET A;  4EXZ A;  2OFR X;  1B56 A;  4GUZ A;  1MX8 A;  3FDC A;  4U8U O;  2R74 A;  3B2I A;  5BYP A;  1ICN A;  2LBA A;  1I05 A;  2OVS A;  3NQ9 A;  1VWK B;  3WYP A;  4WFV A;  4R0B A;  4MVE A;  5HA0 A;  5HA1 A;  3ZW1 A;  1TW4 A;  2IZD B;  1AVG I;  5CHK A;  4YGH A;  1HN2 A;  1KL4 A;  3EBK A;  2Y32 A;  1O1U A;  1TXL A;  3B2L A;  2L5P A;  2RTC B;  1Y52 X;  4ON1 A;  1H91 A;  2IZL B;  3F8A A;  3FW4 A;  5HBS A;  4I60 A;  3HK1 A;  4O3W A;  3MM0 A;  3H3I A;  2DJG A;  1NQN A;  2OY7 A;  3RWX A;  1AVD A;  2OY1 O;  2N93 A;  2WQA E;  3FLL A;  4GU8 A;  1I78 A;  2A2G A;  3D97 A;  2W2A A;  2WUT A;  3PQS A;  4GDA A;  4O4S A;  3ELZ A;  2IFB A;  2QO5 A;  1RLB E;  2KTS A;  3WZN A;  5BVT A;  1HQP A;  5AQ6 A;  2G7B A;  1TOW A;  3JS1 A;  4HPA A;  2MF6 A;  1QFT A;  4PJ2 A;  4GJV A;  3DSZ A;  3MBT A;  1VWC B;  4ORX A;  3VG5 A;  2RTJ A;  1X89 A;  1OPB A;  5LJD A;  3RE5 A;  3WXQ A;  3ZW0 B;  4ZHF A;  1KZW A;  1OBQ A;  4I3D A;  1AQB A;  1X8O A;  5LKE A;  1KGL A;  3PDF A;  2HKD A;  1BSQ A;  2AT0 X;  5D8J A;  1FE3 A;  1VWF B;  1N0S A;  2RTE B;  1HMS A;  2JW1 A;  4FQB B;  2Y3F A;  1BWY A;  3RE6 A;  1GKA B;  4CSB A;  3UEV A;  1MVG A;  4I9S A;  4GNW A;  4N7D A;  3VG4 A;  3OBL A;  1Y9L A;  2AKQ A;  2RTH B;  4M6S A;  4M7M A;  3P6F A;  2FTB A;  1E5P A;  2XST A;  4OS0 A;  1AVE A;  1LDQ A;  1GX8 A;  2IZI A;  2OVE A;  2R73 A;  2OVA A;  3ELX A;  4YGG A;  4AZO A;  1JBH A;  2NP1 A;  2G8C O;  2RTB B;  3JQO A;  3D9W A;  1NP4 A;  5IRU A;  3WZQ A;  1DF3 A;  4LKT A;  4ZGF A;  1GX9 A;  2IZK A;  4L1N A;  1SXU A;  1JQP A;  3BRN A;  4NYR A;  3C78 X;  5HZQ A;  4LKP A;  3B2K A;  3BX7 A;  1U17 A;  3VE2 A;  5H9L A;  2F09 A;  4CDF A;  4QGW A;  2C1S A;  2C4I A;  1QY0 A;  3EMM A;  3FID A;  4KT5 A;  1LFO A;  1PEE A;  3WJE A;  3X00 A;  4OMW A;  4AW8 A;  4DCB A;  4K19 A;  3SLT A;  1YWD A;  2RQ0 A;  3BSZ E;  4U9C A;  3KQ0 A;  1EI5 A;  1HQQ A;  1E00 A;  4INN A;  5HCE C;  4RUN A;  4CPH A;  1JJJ A;  3ZW0 A;  2CZT A;  1MOY A;  3DTQ A;  3P24 A;  1T8V A;  4FBO A;  4IB9 A;  4MEE A;  4YFR A;  4RUU A;  2FT9 A;  3VHH A;  3SZJ A;  1NP1 A;  1TVQ A;  2CM4 A;  1EUO A;  2QOM A;  4KH8 A;  2GTL N;  2X8T A;  1MEP A;  4YKO A;  5EDB A;  2RTQ B;  1SY1 A;  1FJ1 E;  5HZ5 A;  1GKA A;  1UYN X;  1HMT A;  2RCT A;  5K68 A;  1QQS A;  1AB0 A;  4QAE A;  3V8U A;  1O8V A;  4BJ8 A;  1MUP A;  1DC9 A;  1EPB A;  2RTA A;  3NBX X;  5IO5 A;  2L67 A;  4Y0S A;  2A5C A;  3BU1 A;  3F9D A;  3VGW A;  1IFC A;  2OL7 A;  5HZ8 A;  5HCC C;  2WEW A;  1SWC A;  1CRB A;  3SAO A;  1EQD A;  2CBR A;  1URE A;  3P6D A;  4D6B A;  1X8U A;  4TLJ A;  2JU3 A;  2A2U A;  3FA7 A;  3I17 A;  3UAQ A;  1SRF A;  2ACP X;  3APU A;  2ACO A;  3RSW A;  4CPE A;  4UU2 A;  4A8Z A;  1T0V A;  5FQ8 E;  5D48 A;  1ZNH A;  1WBI A;  4YDB A;  1W6F A;  2W2F A;  1SLF B;  1UYO X;  5EEE A;  3VG2 A;  4YMY A;  1EIO A;  1SWH A;  4LZV A;  2RTK A;  1BLR A;  2ASN X;  2AT6 X;  2LKK A;  3CKG A;  1A2D A;  1OEK A;  5HAE A;  2G78 A;  4OEL A;  1I9H A;  4YKM A;  4IAB A;  1ERB A;  1ICM A;  1LID A;  3PH5 A;  2LA7 A;  4XMF A;  1KT7 A;  4OKA A;  1AEL A;  4CPI A;  2GC9 A;  3JSQ A;  4CK4 A;  3VHM A;  1SLG B;  4DQ3 A;  1IIU A;  2GTL M;  4TKJ A;  1XCA A;  4CPF A;  3VHI A;  4Z27 A;  3EW1 A;  2MM3 A;  1VWJ B;  1JZU A;  3HWE A;  1BRP A;  3FR4 A;  3SLJ A;  1OBP A;  1VWD B;  3B2H A;  3OE3 A;  2RTD B;  1LKE A;  1YWB A;  3PED A;  4BBO A;  1SA8 A;  1STR B;  1B8E A;  1X8N A;  1Z24 A;  2DM5 A;  1A57 A;  2WSJ A;  1SWE A;  2C1Q A;  4AYH A;  5DG4 A;  4MVL A;  1BEB A;  4NNT A;  5L8N A;  2WEX A;  2HLV A;  4IB7 A;  5CSE A;  3T2W A;  1LCV A;  1VWE B;  2NNE A;  1QY1 A;  3PPT A;  2FHL A;  2AL0 X;  1N43 A;  3NQ3 A;  2IZG B;  3EC5 A;  1X8P A;  3BX8 A;  3FR5 A;  3G7X A;  2GTL O;  1EII A;  3PH6 A;  4FGI B;  1R0U A;  4EQA C;  5EED A;  1SXX A;  4YVB A;  4ALO A;  1Y55 X;  1G5W A;  1GGL A;  4YDA A;  5L8I A;  1N7Y A;  2AT8 X;  3WJC A;  4ZH9 A;  2GTF X;  2Q2M A;  3APX A;  1B0O A;  3CWK A;  3EW2 A;  2HMB A;  2OVD A;  4OMX A;  1UZ2 X;  4EFG A;  3MX7 A;  4Z2V A;  3HWF A;  1JMZ A;  4O4U A;  1K3B A;  3BU9 A;  1U0X A;  2EU7 X;  2YMS A;  4O4X A;  2RTN B;  1VPR A;  4NP1 A;  5HTD A;  2I5Z O;  5H9N A;  2RCQ A;  2X56 A;  1A18 A;  2X32 A;  4LQZ A;  1STP A;  1SY2 A;  4IAW A;  1LPJ A;  3WZP A;  1PMP A;  1TOU A;  1D2U A;  4ZR2 A;  4NLI A;  2XKL A;  4OS8 A;  3BY0 A;  5B2A O;  4MVI A;  4XMH A;  4YBP A;  5CE4 A;  2CBS A;  4ML7 B;  4GNY A;  4O49 A;  5C0N A;  5K06 A;  5FQ7 E;  2X4M A;  3KFG A;  1RSU B;  1LCZ A;  4Z6J A;  2LBV A;  1LIC A;  3CR6 A;  4JNJ A;  3WVM A;  2E4J A;  1I06 A;  2CM9 A;  1IKJ A;  4NYQ A;  4ZHH A;  4CDE A;  1SWG A;  2F01 A;  1KQX A;  1ZNE A;  2F73 A;  2L9C A;  3FR2 A;  1LEL A;  2DJF A;  2HNX A;  3N91 A;  2UZ2 A;  4ODD A;  3ZWE A;  3TGB A;  1DZM A;  4XMG A;  5B11 O;  3T1D A;  2Z4I A;  1OBU A;  2AH7 X;  2OL8 O;  3P02 A;  1HBP A;  3NAD A;  3P6H A;  4GDZ A;  5EZ2 A;  4ZHC A;  5IRW A;  1SWJ A;  4GH7 A;  1MDC A;  5LJE A;  3PEC A;  1JIW I;  5IXG A;  4AZM A;  4AZQ A;  5BVS A;  3F6Z B;  5LJG A;  3UEW A;  5HZ9 A;  5FQ6 E;  3D95 A;  3ZUI A;  1RXK A;  2K62 A;  2LFO A;  2OFB A;  3HWG A;  4KC7 A;  5B3M O;  2ANS A;  4KII A;  3FYF A;  3CQN A;  3T6F A;  1LUQ A;  2OF8 A;  2WQ9 A;  4DNE A;  2OYB O;  5K67 A;  4Z28 A;  4IBA A;  2A0A A;  5AEO A;  1G85 A;  1D3S A;  1N9Y A;  4BX6 B;  4ORS A;  4ZCB A;  4ZGU A;  1KOI A;  1VWN B;  1ZRY A;  1IW2 A;  3C77 X;  1EXS A;  2O62 A;  2HZQ A;  1SRI A;  4U46 A;  2FKG A;  1SRJ A;  1U18 A;  4I3B A;  2PY1 A;  2RTR B;  3CBS A;  1KFF A;  2UYW A;  5AJB A;  1PBO A;  3GE2 A;  1MK5 A;  2AT5 X;  3PK2 A;  3ZQ3 A;  4CPH B;  1LNM A;  5FEN A;  2Q2P A;  4YFQ A;  3RDS A;  4LZU A;  1VWM B;  4ARH A;  2FWV A;  4NV8 A;  4ZJ0 A;  2NND A;  5B27 A;  1GT1 A;  4Y0Q A;  3RDO A;  3SLO A;  1S2P A;  3VU1 A;  1SWL A;  5IO7 A;  1GT4 A;  4IRW A;  1KL3 A;  4Y59 A;  2KW1 A;  4TKB A;  2RTM A;  1QAB E;  2BLG A;  3O22 A;  4GGT A;  4GRJ A;  3RZY A;  2Z4H A;  2OZQ A;  3RDX A;  2BHV A;  2FHN X;  1SRE A;  4NW4 A;  3U03 A;  2Y3E A;  2WPU A;  3HOE A;  5KHP A;  1N4J A;  4HFO A;  3VG6 A;  2NNQ A;  5F1E A;  1JV4 A;  4U8U N;  3RBY A;  1NDJ A;  3STN A;  4Z2O A;  2RA6 A;  1JMX A;  4ID2 A;  3VG3 A;  3FIQ A;  3Q6L A;  1YUP A;  2BSZ A;  3NP1 A;  2A13 A;  4Y5D A;  1NBX A;  4O3X B;  4OEM A;  1BBP A;  5KIC A;  1EPA A;  4WFU A;  1BSY A;  3APW A;  4QGX A;  3CKF A;  2R56 A;  3SOT A;  2X8S A;  1HBQ A;  1SRH A;  2X8F A;  5D4A A;  4EDE A;  4GD9 A;  1CBR A;  1KQW A;  4BX6 A;  3E3C A;  2RN4 A;  3PP6 A;  1G74 A;  4NNS A;  5EPQ A;  3ZW2 A;  2QM9 A;  4JHQ A;  5H9A A;  3STM X;  2ALL X;  4AZN A;  4U3Q A;  1FEM A;  1FTP A;  4XMC A;  4BX5 A;  3ZZV A;  5F2B A;  1SWA A;  2AMM X;  2YG2 A;  4Y0P A;  3FEP A;  4A1H A;  2HYS A;  2Q4N A;  5F7G A;  1HMR A;  3LV4 A;  1OEJ A;  2IZE B;  1JJX A;  4ZHG A;  2BT9 A;  1N9M A;  2QMI A;  2P8G A;  3B2J A;  4I3C A;  5FAZ A;  3WYQ A;  3FEL A;  2MJI A;  4ZHD A;  2IZB A;  2X34 A;  5KID A;  4I6S A;  1E2T A;  3HTY A;  4DQ4 A;  2QO4 A;  1X71 A;  3TZS A;  1VWA B;  4GE1 A;  4U8U M;  4EKV A;  5F58 A;  3NPO A;  3RDM A;  2K23 A;  4PSQ A;  5F6Z A;  1SWS A;  1Y0G A;  1Y53 X;  1K24 A;  1BM5 A;  3BLG A;  2OF9 A;  4QZU A;  4O3Z A;  3KFH A;  3S5V A;  4TQ2 A;  2OY8 A;  3D96 A;  1IKE A;  2ZAI A;  4BOE A;  2JU8 A;  1EW3 A;  2LB6 A;  3EM0 A;  3EYC A;  4GGR A;  4O4O A;  1O1V A;  3LTW A;  4OS3 A;  4TKH A;  3TF6 A;  1SXW A;  1ML7 A;  1HY2 A;  2CAM A;  3HPE A;  1VWH B;  2RTF B;  3HOL A;  3KZA A;  4XME A;  5B10 O;  1LF7 A;  2W2B A;  4N7C A;  3WJF A;  1QWD A;  4IMN A;  4ZH6 A;  5B5G A;  3WJD A;  3KVN A;  1ZNK A;  1FDQ A;  2KT4 B;  1IJ8 A;  3FMZ A;  4YFP A;  3FA8 A;  4TJZ A;  4YBU A;  5JR8 A;  1B4M A;  4JGL A;  3OD9 A;  2BS6 A;  3NX2 A;  3P6C A;  3S5X A;  1QFV A;  4ALB A;  1FEL A;  5B29 A;  1XKI A;  3NQK A;  3WOV A;  1VYF A;  2A5B A;  1HXL A;  4I95 A;  1JYJ A;  2AF5 A;  1YP7 A;  4KC8 A;  1VWB B;  4GK9 A;  1GT3 A;  1E06 A;  1GT5 A;  2FR3 A;  2OFM X;  3WJB A;  4ORY A;  3Q34 A;  3TGA A;  2IZJ A;  4ORU A;  3VPJ E;  4MIR A;  2KTD A;  1S44 A;  1W4T A;  1VWR B;  1VWI B;  2AVI A;  5JD2 A;  1OEE A;  4QZT A;  1MM9 A;  4HPB A;  4EEJ A;  2OL6 O;  5FFH A;  4BX7 B;  1KL5 A;  1SWR A;  5IO6 A;  1DF8 A;  3RDQ A;  5L8O A;  1L6M A;  1ZNL A;  5LKF A;  4UU3 A;  1LCW A;  1QG5 A;  1SRG A;  1PTS A;  2BC3 A;  2WWP A;  3P6E A;  4B55 A;  4ES7 A;  3K3L A;  2G79 A;  2MWH A;  1DZP A;  1KT5 A;  1KZX A;  3KFI A;  4CDD A;  2VFC A;  2RTG B;  1CBS A;  4GZV A;  2G5L A;  4YCH A;  1SXY A;  1SWO A;  1SWT A;  2JN3 A;  4QYN A;  1LIF A;  4WHI A;  2FKJ A;  5BVQ A;  1GX3 A;  1BRQ A;  1DZJ A;  2I5V O;  1VWL B;  2X46 A;  5LJK A;  1CJ5 A;  3O19 A;  3KFF A;  5LJC A;  2OY5 O;  1X8Q A;  1VYO A;  4XMD A;  4I9R A;  4MVK A;  4O9S A;  2WR6 A;  1SWB A;  1FEN A;  5IRA A;  2VDF A;  2OFA A;  2POA A;  4GGZ A;  1RST B;  1Y9T A;  2RTO B;  3EBW A;  4O3Y A;  3U9P C;  1JYD A;  4YGZ A;  3WZO A;  5L3Y A;  1CBI A;  2HZR A;  2GH7 A;  3S60 A;  4BX5 B;  4CDC A;  1EAL A;  1KT3 A;  1OSP O;  1PM1 X;  1BJ7 A;  2Q9S A;  3AKN A;  3GAQ A;  1GM6 A;  4IB8 A;  4CV7 A;  4GKC A;  3UEX A;  3MG5 A;  1NC9 A;  4QGV A;  1I04 A;  3OJY C;  1T68 X;  3RKG A;  3T2X A;  1SY0 A;  3BDR A;  4IMO A;  4Z2P A;  5HWZ A;  4HPC A;  2VFB A;  4L3R A;  1RXH A;  3CQR A;  4BCS A;  4BX7 A;  5LJB A;  3ZI8 A;  3VG7 A;  2QCB A;  1LIE A;  3ZUO A;  1GXA A;  2KD2 A;  3RY1 A;  4ORW A;  4QRL A;  4AZR A;  4Y0R A;  1ZND A;  1SWN A;  1SWF A;  1KXO A;  1SWP A;  1BSO A;  2IZH B;  5D47 A;  2M4L A;  1ZNG A;  1A3Y A;  2A3F X;  2X45 A;  3NX1 A;  3RDU A;  1CBQ A;  2A8G A;  2RTP B;  1SWD A;  3AKM A;  4ORR A;  4QYP A;  5F6B A;  4YH0 A;  2MHD A;  1HXZ A;  2FRS A;  3SZI A;  2FR2 A;  2AT3 X;  1VWO B;  4AZP A;  1I4U A;  4FBR A;  5CYB A;  3APV A;  5DPQ A;  1ALB A;  3NR3 A;  2GJ5 A;  3VE1 A;  1E02 A;  1SLE B;  3L4R A;  4TNN A;  3CBC A;  5H8T A;  4BGF A;  1WUB A;  4KCA A;  3TGC A;  4HWM A;  1G7N A;  3STK A;  5HTE A;  2BS5 A;  4NLJ A;  1ACD A;  3IFB A;  1DV9 A;  2QO6 A;  2ZAG A;  1SWK A;  1IFB A;  2JMB A;  5LJH A;  3FW5 A;  3P6G A;  3UEU A;  2FS6 A;  3IA8 A;  3U0D A;  3ZW1 B;  4COT A;  1SWU A;  2IZA A;  2JU7 A;  3CMP A;  3QKG A;  3D4R A;  1LDO A;  5B5F A;  4QNI A;  3C76 X;  2FLJ A;  1PBY A;  3MVF A;  3I0A A;  3SZH A;  1RAV A;  1VYG A;  3HWD A;  4WBK A;  4QQ1 A;  5HCD C;  2CZU A;  5HZ6 A;  2JOZ A; 
#chains in the Genus database with same CATH homology
 1VWQ B;  2IZF B;  5K68 A;  2RTI B;  2A5B A;  1HXL A;  4BJ8 A;  1RXK A;  1VWB B;  2OFB A;  2RTL A;  2JGS A;  2RTA A;  3T6F A;  1STS B;  1LUQ A;  2OF8 A;  1SWQ A;  2A5C A;  2IZJ A;  4GJS A;  3VGW A;  3T6L A;  2ZSC A;  4Z28 A;  4DNE A;  5K67 A;  1SWC A;  1VWR B;  1RXJ A;  1VWI B;  2AVI A;  5JD2 A;  2IZC B;  1N9Y A;  4CPE A;  4BX6 B;  1SRF A;  1SLD B;  3RY2 A;  1MM9 A;  1VWN B;  1VWG B;  1VWP B;  4U46 A;  1SRI A;  1NQM A;  1SRJ A;  1KL5 A;  1SWR A;  1WBI A;  1SLF B;  4BX7 B;  1DF8 A;  2RTR B;  3RDQ A;  1KFF A;  2UYW A;  1SWH A;  4JO6 A;  2RTK A;  1MK5 A;  1LCW A;  1SRG A;  4YVB A;  1PTS A;  2BC3 A;  3PK2 A;  3FDC A;  3RDS A;  1VWM B;  1I9H A;  2RTG B;  3WYP A;  4CPH A;  3RDO A;  1VWK B;  2G5L A;  1SWL A;  1SWO A;  1SWT A;  2IZD B;  1KL3 A;  4IRW A;  4OKA A;  4Y59 A;  5CHK A;  4CPI A;  2RTM A;  4GGT A;  1VWL B;  1KL4 A;  3VHM A;  1SLG B;  2Y32 A;  2RTC B;  1VYO A;  1Y52 X;  2FHN X;  3RDX A;  4CPF A;  1SRE A;  3VHI A;  2IZL B;  4Z27 A;  2Y3E A;  2WPU A;  3EW1 A;  4I60 A;  1N4J A;  1VWJ B;  1SWB A;  3MM0 A;  5IRA A;  1NQN A;  1NDJ A;  4Z2O A;  1AVD A;  1VWD B;  2OFA A;  4GGZ A;  1RST B;  2RTD B;  4GDA A;  4BBO A;  2RTO B;  1STR B;  3WZN A;  4Y5D A;  1NBX A;  1SWE A;  2C1Q A;  3WZO A;  5L3Y A;  2GH7 A;  4BX5 B;  2MF6 A;  4GJV A;  5CSE A;  1SRH A;  1VWC B;  3T2W A;  2RTJ A;  4CPH B;  4GD9 A;  3RE5 A;  1LCV A;  1VWE B;  3MG5 A;  1NC9 A;  2FHL A;  4BX6 A;  1N43 A;  2IZG B;  3T2X A;  4JHQ A;  4Z2P A;  1RXH A;  1VWF B;  2RTE B;  4BCS A;  4BX7 A;  2Y3F A;  3RE6 A;  2QCB A;  3RY1 A;  4BX5 A;  1Y55 X;  1SWN A;  1SWF A;  1SWP A;  1SWA A;  1N7Y A;  2RTH B;  2IZH B;  5F2B A;  1AVE A;  1LDQ A;  2IZI A;  3RDU A;  3EW2 A;  2A8G A;  4Z2V A;  2RTP B;  1SWD A;  2IZE B;  2RTB B;  1N9M A;  1HXZ A;  5IRU A;  3SZI A;  3WZQ A;  3WYQ A;  1VWO B;  2IZB A;  2RTN B;  2IZK A;  1VWA B;  4EKV A;  1SLE B;  1STP A;  3WZP A;  3RDM A;  2C1S A;  2C4I A;  3X00 A;  1SWS A;  1Y53 X;  2OF9 A;  1RSU B;  1LCZ A;  1SWK A;  4Z6J A;  4GGR A;  4JNJ A;  1HQQ A;  1HY2 A;  1SWU A;  2IZA A;  2CAM A;  1SWG A;  1VWH B;  2F01 A;  1LDO A;  1MOY A;  2RTF B;  5B5F A;  1LEL A;  2UZ2 A;  5B5G A;  3SZH A;  1RAV A;  5IRW A;  1IJ8 A;  3VHH A;  3SZJ A;  1MEP A;  1SWJ A;  2RTQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...