2FHXB

Pseudomonas aeruginosa spm-1 metallo-beta-lactamase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
245
structure length
244
Chain Sequence
DHVDLPYNLTATKIDSDVFVVTDRDFYSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGMIKPKELGYLGDANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Pseudomonas aeruginosa SPM-1 Provides Insights into Variable Zinc Affinity of Metallo-beta-lactamases.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase, metal binding protein
molecule keywords SPM-1
total genus 73
structure length 244
sequence length 245
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2fhxB00
4C1CA 1KO3A 5AYAA 3BK1A 1Y44A 2R2DA 3IE2A 3VQZA 5B3RA 2ZO4A 3ESHA 3F9OA 5ACTA 2BG8B 1L9YA 4GCWA 5EWAA 3JXPA 2ZNBA 5FQCA 1DXKA 5AXOA 2Q0JA 1ZKPA 2Y87A 2Q0IA 4DIKA 5K0WA 5DPXA 4XWTA 4AWYB 5FQBA 4WD6A 5A87A 4UWSB 2FHXA 2YCBA 2AIOA 5EHTA 4KEQA 4TYFA 3ZR9A 3ZQ4A 1A7TA 5ACWA 4TZBA 4H0DA 2BGAA 2YZ3A 4NQ5A 1QH3A 5ACPA 5HISA 3DHCA 4P62A 4D1UA 3DHAA 2YNVA 5ACXA 3IOFA 1QH5A 5EVKA 3T3OA 3Q6VA 2YNUA 3DHBA 4ZEJA 5K4NA 2OHHA 5ACVA 5ACSA 1DD6A 4UWRB 5LCHA 1JT1A 3I13A 5EV8A 2P18A 4C1FA 1VMEA 3H3EA 5LCFA 1YCFA 5K4KA 3SD9A 3WXCA 3A4YA 2GCUA 5LM6A 2BFZB 5EV6A 2YNVB 2GFJA 4KEPA 4AX0B 2BTNA 3IE0A 3DH8A 2NYPA 2NZFA 1WUOA 5LSCA 4Z6XA 4D1WA 2I7VA 2BC2A 2ZZIA 4C1EA 3SRXA 1WW1A 2OHIA 3I14A 2WRSA 5AEBA 5HIOA 4O98A 1VGNA 3R2UA 4UA4A 4TZEA 3I11A 3FCZA 3IEMA 5HH4A 4YSKA 2WYMA 2UYXA 3I0VA 4LE6A 4D02A 3IDZA 2I7XA 2M5DA 4Z7RA 2BFKA 2H6AA 4RBSA 3ADRA 3T9MA 1P9EA 4D1TA 5AXRA 4EYBA 2CBNA 5K4MA 4RAWA 2BR6A 4PVOA 1WRAA 4NQ6A 5EW0A 3IEKA 3BK2A 1X8IA 3AF5A 4AD9A 1MQOA 1KO2A 2Y8AA 4XUKA 3PY5A 3SW3A 1VJNA 4EYFA 4U4LA 5EVDA 1YCHA 2BIBA 3KNSA 2P97A 4FEKA 2A7MA 2FHXB 4UWOB 2HB9A 2WYMC 5AHOA 2OHJA 4RM5A 2WHGA 5HIPA 4TYTA 4EYLA 2DOOA 1X8HA 5B1UA 5A0TA 4YSLA 4F6HA 1E5DA 4F6ZA 2VW8A 1KR3A 2QINA 3MD7A 4UAMA 4NQ2A 3SPUA 2BG7A 4YSBA 2I7TA 1K07A 2M5CA 3RPCA 3VPEA 3X2XA 2FM6A 3FAIA 1M2XA 3BC2A 4Z5YA 1BVTA 1A8TA 1SMLA 3PG4A 3X2YA 4C1HA 3I15A 2BG8A 2Y8BA 4BZ3A 4JO0A 4UBQA 3X30A 5EH9A 4EFZA 1XM8A 4FR7A 4RL0A 4HKYA 1JJTA 4ZO3A 4ZNBA 1WUPA 2ZWRA 2FU9A 3KL7A 3G1PA 3L6NA 5KILA 4C1DA 3TP9A 2FU6A 5EVBA 2E7YA 2QJSA 4TZFA 1XTOA 3QH8A 5A0VA 4AX1B 2NZEA 1HLKA 2QDSA 4EY2A 4AWZA 4HL1A 4RL2A 5HIQA 2YNTB 5ACQA 4C1GA 2FU7A 5ACUA 3BV6A 5AHRA 2XF4A 3RKKA 2BG2A 2AZ4A 3T3NA 4EXSA 4V0HA 3IELA 1BMCA 3LVZA 4RAMA 2BMIA 1BC2A 5HH5A 4CHLA 4GYQA 1JJEA 2P1EA 2XR1A 3KNRA 2BFLA 4EXYA 3S0ZA 4TZ9A 1ZTCA 2QEDA 2DKFA 1YCGA 2BG6A 4ZO2A 2P4ZA 4FSBA 2NXAA 3ZNBA 3AJ3A 4NQ4A 5LMCA 4UWPB 5LE1A 2FK6A 5IQKA 5FQAA 5B15A 1ZNBA 3SBLA 5A5ZA 4BP0A 2Q42A 2GFKA 2WYLA 2YNWA 5LS3A 2QDTA 4HL2A 2GKLA 3IOGA 2YNTA 3IE1A 5KIKA 4Z67A 4J5FA 4D1VA 4Z60A 4XWWA 3P2UA 4Z5ZA 3SFPA 3ZWFA 4J5HA 5LCAA 5ACRA 2Q9UA 5LLDA 3X2ZA 2FU8A 1DDKA 3AF6A 3PY6A 3RKJA 4GYUA 1X8GA 4C09A 5HH6A 4B87A 4DILA 2BFZA 4PVTA 2GMNA
chains in the Genus database with same CATH superfamily
4C1CA 1KO3A 5AYAA 3BK1A 1Y44A 2R2DA 3IE2A 3VQZA 5B3RA 2ZO4A 3ESHA 3F9OA 5ACTA 2BG8B 1L9YA 4GCWA 5EWAA 3JXPA 2ZNBA 5FQCA 1DXKA 5AXOA 2Q0JA 1ZKPA 2Y87A 2Q0IA 4DIKA 5K0WA 2YHEA 5DPXA 4XWTA 4AWYB 5FQBA 4WD6A 5A87A 4UWSB 2FHXA 2YCBA 2AIOA 5EHTA 4KEQA 4TYFA 5AIJA 3ZR9A 3ZQ4A 1A7TA 5ACWA 4TZBA 4H0DA 2BGAA 2YZ3A 4NQ5A 1QH3A 5ACPA 5HISA 3DHCA 4P62A 4D1UA 3DHAA 2YNVA 5ACXA 3IOFA 1QH5A 5EVKA 3T3OA 3Q6VA 2YNUA 3DHBA 4ZEJA 5K4NA 4AV7A 2OHHA 5ACVA 5ACSA 1DD6A 4UWRB 5LCHA 1JT1A 3I13A 5EV8A 2P18A 4C1FA 1VMEA 3H3EA 5LCFA 1YCFA 5K4KA 3SD9A 2CG3A 3WXCA 3A4YA 2GCUA 5LM6A 2BFZB 2CFUA 5EV6A 2YNVB 2GFJA 4KEPA 4AX0B 2BTNA 3IE0A 3DH8A 2NYPA 2NZFA 1WUOA 5LSCA 4Z6XA 4D1WA 2I7VA 2BC2A 2ZZIA 4C1EA 3SRXA 1WW1A 2OHIA 3I14A 2WRSA 5AEBA 5HIOA 4O98A 1VGNA 3R2UA 4UA4A 4TZEA 3I11A 3FCZA 3IEMA 5HH4A 4YSKA 2WYMA 2UYXA 3I0VA 4LE6A 4D02A 3IDZA 2I7XA 2M5DA 4Z7RA 2BFKA 2H6AA 4RBSA 3ADRA 3T9MA 1P9EA 4D1TA 5AXRA 4EYBA 2CBNA 5K4MA 4NURA 4RAWA 2BR6A 4PVOA 1WRAA 4NQ6A 5EW0A 3IEKA 3BK2A 1X8IA 3AF5A 4AD9A 1MQOA 1KO2A 2Y8AA 4XUKA 3PY5A 3SW3A 1VJNA 4EYFA 4U4LA 5EVDA 1YCHA 2BIBA 3KNSA 2P97A 4FEKA 2A7MA 2FHXB 4UWOB 2HB9A 5AJLA 2WYMC 5AHOA 2OHJA 4RM5A 2WHGA 5HIPA 4TYTA 4EYLA 2DOOA 1X8HA 5B1UA 5A0TA 4YSLA 4F6HA 1E5DA 4F6ZA 2VW8A 1KR3A 2QINA 3MD7A 4UAMA 4NQ2A 2CFZA 3SPUA 2CG2A 2BG7A 4YSBA 2I7TA 1K07A 5A23A 2M5CA 3RPCA 3VPEA 3X2XA 2FM6A 3FAIA 1M2XA 3BC2A 4Z5YA 1BVTA 1A8TA 1SMLA 3PG4A 3X2YA 4C1HA 3I15A 2BG8A 2Y8BA 4BZ3A 4JO0A 4UBQA 3X30A 5EH9A 4EFZA 1XM8A 4FR7A 4RL0A 4HKYA 1JJTA 4ZO3A 4ZNBA 1WUPA 2ZWRA 2FU9A 3KL7A 3G1PA 3L6NA 5KILA 4C1DA 3TP9A 2FU6A 5EVBA 2E7YA 2QJSA 4TZFA 1XTOA 3QH8A 5A0VA 4AX1B 2NZEA 1HLKA 2QDSA 4EY2A 4AWZA 4HL1A 4RL2A 5HIQA 2YNTB 5ACQA 4C1GA 2FU7A 4AXHA 5ACUA 3BV6A 5AHRA 2XF4A 3RKKA 2BG2A 2AZ4A 3T3NA 4EXSA 4V0HA 3IELA 1BMCA 3LVZA 4RAMA 2BMIA 1BC2A 5HH5A 4CHLA 4GYQA 1JJEA 2P1EA 2XR1A 3KNRA 2BFLA 4PDXA 4EXYA 3S0ZA 4TZ9A 1ZTCA 2QEDA 2DKFA 1YCGA 2BG6A 4ZO2A 2P4ZA 4FSBA 2NXAA 3ZNBA 3AJ3A 4NQ4A 5LMCA 4UWPB 5LE1A 2FK6A 5IQKA 5FQAA 5B15A 1ZNBA 3SBLA 5A5ZA 4BP0A 2Q42A 2GFKA 2WYLA 2YNWA 5LS3A 2QDTA 4HL2A 2GKLA 3IOGA 2YNTA 3IE1A 5KIKA 4Z67A 4J5FA 4D1VA 4Z60A 4XWWA 3P2UA 4Z5ZA 3SFPA 3ZWFA 4J5HA 5LCAA 5ACRA 2Q9UA 5LLDA 3X2ZA 2FU8A 1DDKA 3AF6A 3PY6A 3RKJA 4GYUA 1X8GA 4C09A 5HH6A 4B87A 4DILA 2BFZA 4PVTA 2GMNA
chains in the Genus database with same CATH topology
4C1CA 1KO3A 5AYAA 3BK1A 1Y44A 2R2DA 3IE2A 3VQZA 5B3RA 2ZO4A 3ESHA 3F9OA 5ACTA 2BG8B 1L9YA 4GCWA 5EWAA 3JXPA 2ZNBA 5FQCA 1DXKA 5AXOA 2Q0JA 1ZKPA 2Y87A 2Q0IA 4DIKA 5K0WA 5DPXA 4XWTA 4AWYB 5FQBA 4WD6A 5A87A 4UWSB 2FHXA 2YCBA 2AIOA 5EHTA 4KEQA 4TYFA 3ZR9A 3ZQ4A 1A7TA 5ACWA 4TZBA 4H0DA 2BGAA 2YZ3A 4NQ5A 1QH3A 5ACPA 5HISA 3DHCA 4P62A 4D1UA 3DHAA 2YNVA 5ACXA 3IOFA 1QH5A 5EVKA 3T3OA 3Q6VA 2YNUA 3DHBA 4ZEJA 5K4NA 2OHHA 5ACVA 5ACSA 1DD6A 4UWRB 5LCHA 1JT1A 3I13A 5EV8A 2P18A 4C1FA 1VMEA 3H3EA 5LCFA 1YCFA 5K4KA 3SD9A 3WXCA 3A4YA 2GCUA 5LM6A 2BFZB 5EV6A 2YNVB 2GFJA 4KEPA 4AX0B 2BTNA 3IE0A 3DH8A 2NYPA 2NZFA 1WUOA 5LSCA 4Z6XA 4D1WA 2I7VA 2BC2A 2ZZIA 4C1EA 3SRXA 1WW1A 2OHIA 3I14A 2WRSA 5AEBA 5HIOA 4O98A 1VGNA 3R2UA 4UA4A 4TZEA 3I11A 3FCZA 3IEMA 5HH4A 4YSKA 2WYMA 2UYXA 3I0VA 4LE6A 4D02A 3IDZA 2I7XA 2M5DA 4Z7RA 2BFKA 2H6AA 4RBSA 3ADRA 3T9MA 1P9EA 4D1TA 5AXRA 4EYBA 2CBNA 5K4MA 4RAWA 2BR6A 4PVOA 1WRAA 4NQ6A 5EW0A 3IEKA 3BK2A 1X8IA 3AF5A 4AD9A 1MQOA 1KO2A 2Y8AA 4XUKA 3PY5A 3SW3A 1VJNA 4EYFA 4U4LA 5EVDA 1YCHA 2BIBA 3KNSA 2P97A 4FEKA 2A7MA 2FHXB 4UWOB 2HB9A 2WYMC 5AHOA 2OHJA 4RM5A 2WHGA 5HIPA 4TYTA 4EYLA 2DOOA 1X8HA 5B1UA 5A0TA 4YSLA 4F6HA 1E5DA 4F6ZA 2VW8A 1KR3A 2QINA 3MD7A 4UAMA 4NQ2A 3SPUA 2BG7A 4YSBA 2I7TA 1K07A 2M5CA 3RPCA 3VPEA 3X2XA 2FM6A 3FAIA 1M2XA 3BC2A 4Z5YA 1BVTA 1A8TA 1SMLA 3PG4A 3X2YA 4C1HA 3I15A 2BG8A 2Y8BA 4BZ3A 4JO0A 4UBQA 3X30A 5EH9A 4EFZA 1XM8A 4FR7A 4RL0A 4HKYA 1JJTA 4ZO3A 4ZNBA 1WUPA 2ZWRA 2FU9A 3KL7A 3G1PA 3L6NA 5KILA 4C1DA 3TP9A 2FU6A 5EVBA 2E7YA 2QJSA 4TZFA 1XTOA 3QH8A 5A0VA 4AX1B 2NZEA 1HLKA 2QDSA 4EY2A 4AWZA 4HL1A 4RL2A 5HIQA 2YNTB 5ACQA 4C1GA 2FU7A 5ACUA 3BV6A 5AHRA 2XF4A 3RKKA 2BG2A 2AZ4A 3T3NA 4EXSA 4V0HA 3IELA 1BMCA 3LVZA 4RAMA 2BMIA 1BC2A 5HH5A 4CHLA 4GYQA 1JJEA 2P1EA 2XR1A 3KNRA 2BFLA 4EXYA 3S0ZA 4TZ9A 1ZTCA 2QEDA 2DKFA 1YCGA 2BG6A 4ZO2A 2P4ZA 4FSBA 2NXAA 3ZNBA 3AJ3A 4NQ4A 5LMCA 4UWPB 5LE1A 2FK6A 5IQKA 5FQAA 5B15A 1ZNBA 3SBLA 5A5ZA 4BP0A 2Q42A 2GFKA 2WYLA 2YNWA 5LS3A 2QDTA 4HL2A 2GKLA 3IOGA 2YNTA 3IE1A 5KIKA 4Z67A 4J5FA 4D1VA 4Z60A 4XWWA 3P2UA 4Z5ZA 3SFPA 3ZWFA 4J5HA 5LCAA 5ACRA 2Q9UA 5LLDA 3X2ZA 2FU8A 1DDKA 3AF6A 3PY6A 3RKJA 4GYUA 1X8GA 4C09A 5HH6A 4B87A 4DILA 2BFZA 4PVTA 2GMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C1C A;  1KO3 A;  5AYA A;  3BK1 A;  1Y44 A;  2R2D A;  3IE2 A;  3VQZ A;  5B3R A;  2ZO4 A;  3ESH A;  3F9O A;  5ACT A;  2BG8 B;  1L9Y A;  4GCW A;  5EWA A;  3JXP A;  2ZNB A;  5FQC A;  1DXK A;  5AXO A;  2Q0J A;  1ZKP A;  2Y87 A;  2Q0I A;  4DIK A;  5K0W A;  5DPX A;  4XWT A;  4AWY B;  5FQB A;  4WD6 A;  5A87 A;  4UWS B;  2FHX A;  2YCB A;  2AIO A;  5EHT A;  4KEQ A;  4TYF A;  3ZR9 A;  3ZQ4 A;  1A7T A;  5ACW A;  4TZB A;  4H0D A;  2BGA A;  2YZ3 A;  4NQ5 A;  1QH3 A;  5ACP A;  5HIS A;  3DHC A;  4P62 A;  4D1U A;  3DHA A;  2YNV A;  5ACX A;  3IOF A;  1QH5 A;  5EVK A;  3T3O A;  3Q6V A;  2YNU A;  3DHB A;  4ZEJ A;  5K4N A;  2OHH A;  5ACV A;  5ACS A;  1DD6 A;  4UWR B;  5LCH A;  1JT1 A;  3I13 A;  5EV8 A;  2P18 A;  4C1F A;  1VME A;  3H3E A;  5LCF A;  1YCF A;  5K4K A;  3SD9 A;  3WXC A;  3A4Y A;  2GCU A;  5LM6 A;  2BFZ B;  5EV6 A;  2YNV B;  2GFJ A;  4KEP A;  4AX0 B;  2BTN A;  3IE0 A;  3DH8 A;  2NYP A;  2NZF A;  1WUO A;  5LSC A;  4Z6X A;  4D1W A;  2I7V A;  2BC2 A;  2ZZI A;  4C1E A;  3SRX A;  1WW1 A;  2OHI A;  3I14 A;  2WRS A;  5AEB A;  5HIO A;  4O98 A;  1VGN A;  3R2U A;  4UA4 A;  4TZE A;  3I11 A;  3FCZ A;  3IEM A;  5HH4 A;  4YSK A;  2WYM A;  2UYX A;  3I0V A;  4LE6 A;  4D02 A;  3IDZ A;  2I7X A;  2M5D A;  4Z7R A;  2BFK A;  2H6A A;  4RBS A;  3ADR A;  3T9M A;  1P9E A;  4D1T A;  5AXR A;  4EYB A;  2CBN A;  5K4M A;  4RAW A;  2BR6 A;  4PVO A;  1WRA A;  4NQ6 A;  5EW0 A;  3IEK A;  3BK2 A;  1X8I A;  3AF5 A;  4AD9 A;  1MQO A;  1KO2 A;  2Y8A A;  4XUK A;  3PY5 A;  3SW3 A;  1VJN A;  4EYF A;  4U4L A;  5EVD A;  1YCH A;  2BIB A;  3KNS A;  2P97 A;  4FEK A;  2A7M A;  2FHX B;  4UWO B;  2HB9 A;  2WYM C;  5AHO A;  2OHJ A;  4RM5 A;  2WHG A;  5HIP A;  4TYT A;  4EYL A;  2DOO A;  1X8H A;  5B1U A;  5A0T A;  4YSL A;  4F6H A;  1E5D A;  4F6Z A;  2VW8 A;  1KR3 A;  2QIN A;  3MD7 A;  4UAM A;  4NQ2 A;  3SPU A;  2BG7 A;  4YSB A;  2I7T A;  1K07 A;  2M5C A;  3RPC A;  3VPE A;  3X2X A;  2FM6 A;  3FAI A;  1M2X A;  3BC2 A;  4Z5Y A;  1BVT A;  1A8T A;  1SML A;  3PG4 A;  3X2Y A;  4C1H A;  3I15 A;  2BG8 A;  2Y8B A;  4BZ3 A;  4JO0 A;  4UBQ A;  3X30 A;  5EH9 A;  4EFZ A;  1XM8 A;  4FR7 A;  4RL0 A;  4HKY A;  1JJT A;  4ZO3 A;  4ZNB A;  1WUP A;  2ZWR A;  2FU9 A;  3KL7 A;  3G1P A;  3L6N A;  5KIL A;  4C1D A;  3TP9 A;  2FU6 A;  5EVB A;  2E7Y A;  2QJS A;  4TZF A;  1XTO A;  3QH8 A;  5A0V A;  4AX1 B;  2NZE A;  1HLK A;  2QDS A;  4EY2 A;  4AWZ A;  4HL1 A;  4RL2 A;  5HIQ A;  2YNT B;  5ACQ A;  4C1G A;  2FU7 A;  5ACU A;  3BV6 A;  5AHR A;  2XF4 A;  3RKK A;  2BG2 A;  2AZ4 A;  3T3N A;  4EXS A;  4V0H A;  3IEL A;  1BMC A;  3LVZ A;  4RAM A;  2BMI A;  1BC2 A;  5HH5 A;  4CHL A;  4GYQ A;  1JJE A;  2P1E A;  2XR1 A;  3KNR A;  2BFL A;  4EXY A;  3S0Z A;  4TZ9 A;  1ZTC A;  2QED A;  2DKF A;  1YCG A;  2BG6 A;  4ZO2 A;  2P4Z A;  4FSB A;  2NXA A;  3ZNB A;  3AJ3 A;  4NQ4 A;  5LMC A;  4UWP B;  5LE1 A;  2FK6 A;  5IQK A;  5FQA A;  5B15 A;  1ZNB A;  3SBL A;  5A5Z A;  4BP0 A;  2Q42 A;  2GFK A;  2WYL A;  2YNW A;  5LS3 A;  2QDT A;  4HL2 A;  2GKL A;  3IOG A;  2YNT A;  3IE1 A;  5KIK A;  4Z67 A;  4J5F A;  4D1V A;  4Z60 A;  4XWW A;  3P2U A;  4Z5Z A;  3SFP A;  3ZWF A;  4J5H A;  5LCA A;  5ACR A;  2Q9U A;  5LLD A;  3X2Z A;  2FU8 A;  1DDK A;  3AF6 A;  3PY6 A;  3RKJ A;  4GYU A;  1X8G A;  4C09 A;  5HH6 A;  4B87 A;  4DIL A;  2BFZ A;  4PVT A;  2GMN A; 
#chains in the Genus database with same CATH topology
 4C1C A;  1KO3 A;  5AYA A;  3BK1 A;  1Y44 A;  2R2D A;  3IE2 A;  3VQZ A;  5B3R A;  2ZO4 A;  3ESH A;  3F9O A;  5ACT A;  2BG8 B;  1L9Y A;  4GCW A;  5EWA A;  3JXP A;  2ZNB A;  5FQC A;  1DXK A;  5AXO A;  2Q0J A;  1ZKP A;  2Y87 A;  2Q0I A;  4DIK A;  5K0W A;  2YHE A;  5DPX A;  4XWT A;  4AWY B;  5FQB A;  4WD6 A;  5A87 A;  4UWS B;  2FHX A;  2YCB A;  2AIO A;  5EHT A;  4KEQ A;  4TYF A;  5AIJ A;  3ZR9 A;  3ZQ4 A;  1A7T A;  5ACW A;  4TZB A;  4H0D A;  2BGA A;  2YZ3 A;  4NQ5 A;  1QH3 A;  5ACP A;  5HIS A;  3DHC A;  4P62 A;  4D1U A;  3DHA A;  2YNV A;  5ACX A;  3IOF A;  1QH5 A;  5EVK A;  3T3O A;  3Q6V A;  2YNU A;  3DHB A;  4ZEJ A;  5K4N A;  4AV7 A;  2OHH A;  5ACV A;  5ACS A;  1DD6 A;  4UWR B;  5LCH A;  1JT1 A;  3I13 A;  5EV8 A;  2P18 A;  4C1F A;  1VME A;  3H3E A;  5LCF A;  1YCF A;  5K4K A;  3SD9 A;  2CG3 A;  3WXC A;  3A4Y A;  2GCU A;  5LM6 A;  2BFZ B;  2CFU A;  5EV6 A;  2YNV B;  2GFJ A;  4KEP A;  4AX0 B;  2BTN A;  3IE0 A;  3DH8 A;  2NYP A;  2NZF A;  1WUO A;  5LSC A;  4Z6X A;  4D1W A;  2I7V A;  2BC2 A;  2ZZI A;  4C1E A;  3SRX A;  1WW1 A;  2OHI A;  3I14 A;  2WRS A;  5AEB A;  5HIO A;  4O98 A;  1VGN A;  3R2U A;  4UA4 A;  4TZE A;  3I11 A;  3FCZ A;  3IEM A;  5HH4 A;  4YSK A;  2WYM A;  2UYX A;  3I0V A;  4LE6 A;  4D02 A;  3IDZ A;  2I7X A;  2M5D A;  4Z7R A;  2BFK A;  2H6A A;  4RBS A;  3ADR A;  3T9M A;  1P9E A;  4D1T A;  5AXR A;  4EYB A;  2CBN A;  5K4M A;  4NUR A;  4RAW A;  2BR6 A;  4PVO A;  1WRA A;  4NQ6 A;  5EW0 A;  3IEK A;  3BK2 A;  1X8I A;  3AF5 A;  4AD9 A;  1MQO A;  1KO2 A;  2Y8A A;  4XUK A;  3PY5 A;  3SW3 A;  1VJN A;  4EYF A;  4U4L A;  5EVD A;  1YCH A;  2BIB A;  3KNS A;  2P97 A;  4FEK A;  2A7M A;  2FHX B;  4UWO B;  2HB9 A;  5AJL A;  2WYM C;  5AHO A;  2OHJ A;  4RM5 A;  2WHG A;  5HIP A;  4TYT A;  4EYL A;  2DOO A;  1X8H A;  5B1U A;  5A0T A;  4YSL A;  4F6H A;  1E5D A;  4F6Z A;  2VW8 A;  1KR3 A;  2QIN A;  3MD7 A;  4UAM A;  4NQ2 A;  2CFZ A;  3SPU A;  2CG2 A;  2BG7 A;  4YSB A;  2I7T A;  1K07 A;  5A23 A;  2M5C A;  3RPC A;  3VPE A;  3X2X A;  2FM6 A;  3FAI A;  1M2X A;  3BC2 A;  4Z5Y A;  1BVT A;  1A8T A;  1SML A;  3PG4 A;  3X2Y A;  4C1H A;  3I15 A;  2BG8 A;  2Y8B A;  4BZ3 A;  4JO0 A;  4UBQ A;  3X30 A;  5EH9 A;  4EFZ A;  1XM8 A;  4FR7 A;  4RL0 A;  4HKY A;  1JJT A;  4ZO3 A;  4ZNB A;  1WUP A;  2ZWR A;  2FU9 A;  3KL7 A;  3G1P A;  3L6N A;  5KIL A;  4C1D A;  3TP9 A;  2FU6 A;  5EVB A;  2E7Y A;  2QJS A;  4TZF A;  1XTO A;  3QH8 A;  5A0V A;  4AX1 B;  2NZE A;  1HLK A;  2QDS A;  4EY2 A;  4AWZ A;  4HL1 A;  4RL2 A;  5HIQ A;  2YNT B;  5ACQ A;  4C1G A;  2FU7 A;  4AXH A;  5ACU A;  3BV6 A;  5AHR A;  2XF4 A;  3RKK A;  2BG2 A;  2AZ4 A;  3T3N A;  4EXS A;  4V0H A;  3IEL A;  1BMC A;  3LVZ A;  4RAM A;  2BMI A;  1BC2 A;  5HH5 A;  4CHL A;  4GYQ A;  1JJE A;  2P1E A;  2XR1 A;  3KNR A;  2BFL A;  4PDX A;  4EXY A;  3S0Z A;  4TZ9 A;  1ZTC A;  2QED A;  2DKF A;  1YCG A;  2BG6 A;  4ZO2 A;  2P4Z A;  4FSB A;  2NXA A;  3ZNB A;  3AJ3 A;  4NQ4 A;  5LMC A;  4UWP B;  5LE1 A;  2FK6 A;  5IQK A;  5FQA A;  5B15 A;  1ZNB A;  3SBL A;  5A5Z A;  4BP0 A;  2Q42 A;  2GFK A;  2WYL A;  2YNW A;  5LS3 A;  2QDT A;  4HL2 A;  2GKL A;  3IOG A;  2YNT A;  3IE1 A;  5KIK A;  4Z67 A;  4J5F A;  4D1V A;  4Z60 A;  4XWW A;  3P2U A;  4Z5Z A;  3SFP A;  3ZWF A;  4J5H A;  5LCA A;  5ACR A;  2Q9U A;  5LLD A;  3X2Z A;  2FU8 A;  1DDK A;  3AF6 A;  3PY6 A;  3RKJ A;  4GYU A;  1X8G A;  4C09 A;  5HH6 A;  4B87 A;  4DIL A;  2BFZ A;  4PVT A;  2GMN A; 
#chains in the Genus database with same CATH homology
 4C1C A;  1KO3 A;  5AYA A;  3BK1 A;  1Y44 A;  2R2D A;  3IE2 A;  3VQZ A;  5B3R A;  2ZO4 A;  3ESH A;  3F9O A;  5ACT A;  2BG8 B;  1L9Y A;  4GCW A;  5EWA A;  3JXP A;  2ZNB A;  5FQC A;  1DXK A;  5AXO A;  2Q0J A;  1ZKP A;  2Y87 A;  2Q0I A;  4DIK A;  5K0W A;  5DPX A;  4XWT A;  4AWY B;  5FQB A;  4WD6 A;  5A87 A;  4UWS B;  2FHX A;  2YCB A;  2AIO A;  5EHT A;  4KEQ A;  4TYF A;  3ZR9 A;  3ZQ4 A;  1A7T A;  5ACW A;  4TZB A;  4H0D A;  2BGA A;  2YZ3 A;  4NQ5 A;  1QH3 A;  5ACP A;  5HIS A;  3DHC A;  4P62 A;  4D1U A;  3DHA A;  2YNV A;  5ACX A;  3IOF A;  1QH5 A;  5EVK A;  3T3O A;  3Q6V A;  2YNU A;  3DHB A;  4ZEJ A;  5K4N A;  2OHH A;  5ACV A;  5ACS A;  1DD6 A;  4UWR B;  5LCH A;  1JT1 A;  3I13 A;  5EV8 A;  2P18 A;  4C1F A;  1VME A;  3H3E A;  5LCF A;  1YCF A;  5K4K A;  3SD9 A;  3WXC A;  3A4Y A;  2GCU A;  5LM6 A;  2BFZ B;  5EV6 A;  2YNV B;  2GFJ A;  4KEP A;  4AX0 B;  2BTN A;  3IE0 A;  3DH8 A;  2NYP A;  2NZF A;  1WUO A;  5LSC A;  4Z6X A;  4D1W A;  2I7V A;  2BC2 A;  2ZZI A;  4C1E A;  3SRX A;  1WW1 A;  2OHI A;  3I14 A;  2WRS A;  5AEB A;  5HIO A;  4O98 A;  1VGN A;  3R2U A;  4UA4 A;  4TZE A;  3I11 A;  3FCZ A;  3IEM A;  5HH4 A;  4YSK A;  2WYM A;  2UYX A;  3I0V A;  4LE6 A;  4D02 A;  3IDZ A;  2I7X A;  2M5D A;  4Z7R A;  2BFK A;  2H6A A;  4RBS A;  3ADR A;  3T9M A;  1P9E A;  4D1T A;  5AXR A;  4EYB A;  2CBN A;  5K4M A;  4RAW A;  2BR6 A;  4PVO A;  1WRA A;  4NQ6 A;  5EW0 A;  3IEK A;  3BK2 A;  1X8I A;  3AF5 A;  4AD9 A;  1MQO A;  1KO2 A;  2Y8A A;  4XUK A;  3PY5 A;  3SW3 A;  1VJN A;  4EYF A;  4U4L A;  5EVD A;  1YCH A;  2BIB A;  3KNS A;  2P97 A;  4FEK A;  2A7M A;  2FHX B;  4UWO B;  2HB9 A;  2WYM C;  5AHO A;  2OHJ A;  4RM5 A;  2WHG A;  5HIP A;  4TYT A;  4EYL A;  2DOO A;  1X8H A;  5B1U A;  5A0T A;  4YSL A;  4F6H A;  1E5D A;  4F6Z A;  2VW8 A;  1KR3 A;  2QIN A;  3MD7 A;  4UAM A;  4NQ2 A;  3SPU A;  2BG7 A;  4YSB A;  2I7T A;  1K07 A;  2M5C A;  3RPC A;  3VPE A;  3X2X A;  2FM6 A;  3FAI A;  1M2X A;  3BC2 A;  4Z5Y A;  1BVT A;  1A8T A;  1SML A;  3PG4 A;  3X2Y A;  4C1H A;  3I15 A;  2BG8 A;  2Y8B A;  4BZ3 A;  4JO0 A;  4UBQ A;  3X30 A;  5EH9 A;  4EFZ A;  1XM8 A;  4FR7 A;  4RL0 A;  4HKY A;  1JJT A;  4ZO3 A;  4ZNB A;  1WUP A;  2ZWR A;  2FU9 A;  3KL7 A;  3G1P A;  3L6N A;  5KIL A;  4C1D A;  3TP9 A;  2FU6 A;  5EVB A;  2E7Y A;  2QJS A;  4TZF A;  1XTO A;  3QH8 A;  5A0V A;  4AX1 B;  2NZE A;  1HLK A;  2QDS A;  4EY2 A;  4AWZ A;  4HL1 A;  4RL2 A;  5HIQ A;  2YNT B;  5ACQ A;  4C1G A;  2FU7 A;  5ACU A;  3BV6 A;  5AHR A;  2XF4 A;  3RKK A;  2BG2 A;  2AZ4 A;  3T3N A;  4EXS A;  4V0H A;  3IEL A;  1BMC A;  3LVZ A;  4RAM A;  2BMI A;  1BC2 A;  5HH5 A;  4CHL A;  4GYQ A;  1JJE A;  2P1E A;  2XR1 A;  3KNR A;  2BFL A;  4EXY A;  3S0Z A;  4TZ9 A;  1ZTC A;  2QED A;  2DKF A;  1YCG A;  2BG6 A;  4ZO2 A;  2P4Z A;  4FSB A;  2NXA A;  3ZNB A;  3AJ3 A;  4NQ4 A;  5LMC A;  4UWP B;  5LE1 A;  2FK6 A;  5IQK A;  5FQA A;  5B15 A;  1ZNB A;  3SBL A;  5A5Z A;  4BP0 A;  2Q42 A;  2GFK A;  2WYL A;  2YNW A;  5LS3 A;  2QDT A;  4HL2 A;  2GKL A;  3IOG A;  2YNT A;  3IE1 A;  5KIK A;  4Z67 A;  4J5F A;  4D1V A;  4Z60 A;  4XWW A;  3P2U A;  4Z5Z A;  3SFP A;  3ZWF A;  4J5H A;  5LCA A;  5ACR A;  2Q9U A;  5LLD A;  3X2Z A;  2FU8 A;  1DDK A;  3AF6 A;  3PY6 A;  3RKJ A;  4GYU A;  1X8G A;  4C09 A;  5HH6 A;  4B87 A;  4DIL A;  2BFZ A;  4PVT A;  2GMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...