2FHXB

Pseudomonas aeruginosa spm-1 metallo-beta-lactamase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
245
structure length
244
Chain Sequence
DHVDLPYNLTATKIDSDVFVVTDRDFYSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGMIKPKELGYLGDANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPM-1
publication title Crystal Structure of Pseudomonas aeruginosa SPM-1 Provides Insights into Variable Zinc Affinity of Metallo-beta-lactamases.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase, metal binding protein
total genus 73
structure length 244
sequence length 245
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2fhxB00
3X2ZA 4TZBA 4TYTA 5KILA 4EYLA 1DDKA 1QH3A 4RAWA 1WRAA 3ZNBA 2BFKA 3IOGA 5LCAA 3IE1A 5HIQA 3ESHA 3SD9A 3IELA 1KO2A 5AXRA 3AF6A 2H6AA 4TZ9A 2OHJA 5B1UA 4RL2A 2BMIA 4NQ4A 4UWPB 4TYFA 3ZWFA 4C1FA 1BVTA 4GYUA 4F6ZA 1ZKPA 2FU8A 4D1VA 5AXOA 4FR7A 4RBSA 4RL0A 2BGAA 4CHLA 4ZNBA 4BZ3A 3SRXA 4D1WA 5LM6A 5B3RA 5LE1A 2YNVB 3IE0A 2Q0IA 1KR3A 3KNSA 2NYPA 2Y87A 1KO3A 5EH9A 2FK6A 5LLDA 3TP9A 1X8GA 2YNTB 2E7YA 5EV6A 2YNVA 1E5DA 1L9YA 5AEBA 4U4LA 5ACSA 2BG7A 2BG2A 2YNTA 5HIPA 5A5ZA 1M2XA 1VMEA 3X30A 2WYMC 2YCBA 1MQOA 2BFLA 4XWWA 1JJTA 2FU6A 3PY6A 5AHRA 3VPEA 4UWOB 5KIKA 3SPUA 4UWSB 4C1DA 2FHXA 4V0HA 5FQAA 3I15A 3SFPA 1WUPA 5DPXA 2QDTA 3L6NA 1DXKA 2ZNBA 1ZTCA 2NZEA 4AWYB 4FSBA 1YCFA 5ACRA 3BK2A 2P97A 2OHIA 2R2DA 3X2XA 4EFZA 1WW1A 1VGNA 2P1EA 4RM5A 3BK1A 2GKLA 2QDSA 4C1GA 5LCFA 5B15A 4EY2A 4EXYA 5A87A 2ZO4A 3Q6VA 2P4ZA 3RKJA 1P9EA 5AYAA 4BP0A 4HKYA 3IDZA 4JO0A 4D02A 4TZFA 3JXPA 3IEMA 3H3EA 3IEKA 4DIKA 5LCHA 3MD7A 4EYFA 2XF4A 2OHHA 2WRSA 2QEDA 2GFJA 4UAMA 4AX1B 2ZZIA 4FEKA 5A0TA 5ACTA 4Z6XA 5ACWA 4ZO3A 4YSBA 2YNUA 4B87A 5EVBA 4ZO2A 3SW3A 4XUKA 5HIOA 2Q42A 1BMCA 4RAMA 4C1EA 3QH8A 1XM8A 2DOOA 4C1HA 4AWZA 4H0DA 2I7TA 4LE6A 4YSKA 4XWTA 4EXSA 3X2YA 5ACVA 3KL7A 1ZNBA 2FHXB 5ACPA 2DKFA 3ADRA 1A7TA 2I7VA 3BC2A 3P2UA 2WYMA 4NQ6A 5LMCA 1K07A 3DHBA 4Z60A 4Z5YA 3IE2A 3G1PA 1A8TA 3DHAA 3S0ZA 2I7XA 3I0VA 2GMNA 3KNRA 4C1CA 1X8HA 2NZFA 5EW0A 2XR1A 5EHTA 5LSCA 2AIOA 2CBNA 2BFZB 5ACQA 4HL2A 5K4NA 4F6HA 5FQCA 4PVOA 3PY5A 1DD6A 2QJSA 2BFZA 5HISA 2NXAA 2BR6A 1HLKA 5HH5A 1SMLA 4Z67A 3LVZA 3I14A 4ZEJA 5IQKA 2BTNA 4AD9A 2BG6A 5K4KA 5EWAA 2GFKA 3T3NA 3WXCA 4AX0B 2A7MA 2BG8B 3AJ3A 4C09A 3T3OA 1VJNA 4O98A 4UBQA 5K0WA 2YNWA 2Y8AA 4J5HA 3DH8A 3FAIA 2BG8A 4KEQA 2M5CA 2GCUA 2ZWRA 4UA4A 1WUOA 4D1UA 4TZEA 4YSLA 2FM6A 1JJEA 2UYXA 5AHOA 5ACXA 5HH4A 3FCZA 3RPCA 5FQBA 3BV6A 2Y8BA 3PG4A 1BC2A 4NQ2A 4KEPA 2Q9UA 3ZQ4A 5LS3A 2AZ4A 2BC2A 2FU7A 2WHGA 1JT1A 3R2UA 3IOFA 5EVDA 3RKKA 1YCGA 4J5FA 1X8IA 3ZR9A 4Z5ZA 2HB9A 4NQ5A 1QH5A 3AF5A 4GYQA 3I13A 2VW8A 4WD6A 2Q0JA 4D1TA 4DILA 3F9OA 5EV8A 2WYLA 2P18A 4GCWA 1Y44A 3I11A 5HH6A 4UWRB 1XTOA 5K4MA 3VQZA 4PVTA 3T9MA 2QINA 4HL1A 2FU9A 3DHCA 4Z7RA 5ACUA 2BIBA 2YZ3A 4EYBA 1YCHA 5EVKA 2M5DA 3SBLA 4P62A 5A0VA 3A4YA
chains in the Genus database with same CATH superfamily
3X2ZA 4TZBA 4TYTA 5KILA 4EYLA 4AV7A 1DDKA 1QH3A 4RAWA 1WRAA 3ZNBA 2BFKA 3IOGA 5LCAA 3IE1A 5HIQA 3ESHA 3SD9A 3IELA 1KO2A 5AXRA 3AF6A 2H6AA 4TZ9A 2OHJA 5B1UA 4RL2A 2BMIA 4NQ4A 4UWPB 4TYFA 3ZWFA 4C1FA 1BVTA 4GYUA 4F6ZA 1ZKPA 2FU8A 4D1VA 5AXOA 4FR7A 4RBSA 4RL0A 5AIJA 2BGAA 4CHLA 4ZNBA 4BZ3A 3SRXA 4D1WA 5LM6A 5B3RA 5LE1A 2YNVB 3IE0A 2Q0IA 1KR3A 3KNSA 2NYPA 2Y87A 1KO3A 5EH9A 2FK6A 5LLDA 3TP9A 1X8GA 2YNTB 2E7YA 5EV6A 2YNVA 1E5DA 1L9YA 5AEBA 4U4LA 5ACSA 2BG7A 2BG2A 2YNTA 5HIPA 5A5ZA 1M2XA 1VMEA 3X30A 2WYMC 2YCBA 1MQOA 2BFLA 4XWWA 1JJTA 2FU6A 3PY6A 5AHRA 3VPEA 4UWOB 5KIKA 3SPUA 4UWSB 4C1DA 4AXHA 2FHXA 4V0HA 5FQAA 3I15A 3SFPA 1WUPA 5DPXA 2QDTA 3L6NA 1DXKA 2ZNBA 1ZTCA 2NZEA 4AWYB 4FSBA 1YCFA 5ACRA 3BK2A 2P97A 2OHIA 2R2DA 3X2XA 4EFZA 1WW1A 1VGNA 2P1EA 4RM5A 3BK1A 2GKLA 2QDSA 4C1GA 5LCFA 5B15A 4EY2A 4EXYA 5A87A 2ZO4A 3Q6VA 2P4ZA 3RKJA 1P9EA 5AYAA 4BP0A 4HKYA 3IDZA 4JO0A 5AJLA 4D02A 4TZFA 3JXPA 3IEMA 3H3EA 3IEKA 4DIKA 5LCHA 3MD7A 4EYFA 2XF4A 2OHHA 2WRSA 2YHEA 2QEDA 2GFJA 4UAMA 4AX1B 2ZZIA 4FEKA 5A0TA 5ACTA 4Z6XA 5ACWA 4ZO3A 4YSBA 2YNUA 4B87A 5EVBA 4ZO2A 3SW3A 4XUKA 5HIOA 2Q42A 1BMCA 4RAMA 4C1EA 3QH8A 1XM8A 2DOOA 4C1HA 4PDXA 4AWZA 4H0DA 2I7TA 4LE6A 4YSKA 4XWTA 4EXSA 3X2YA 5ACVA 3KL7A 1ZNBA 2FHXB 5ACPA 2DKFA 3ADRA 1A7TA 2I7VA 3BC2A 3P2UA 2WYMA 4NQ6A 5LMCA 1K07A 3DHBA 4Z60A 4Z5YA 3IE2A 3G1PA 1A8TA 3DHAA 3S0ZA 2I7XA 3I0VA 2GMNA 3KNRA 4C1CA 1X8HA 2NZFA 5EW0A 2XR1A 5EHTA 5LSCA 2AIOA 2CBNA 2BFZB 5A23A 5ACQA 4HL2A 5K4NA 4F6HA 5FQCA 4PVOA 3PY5A 1DD6A 2QJSA 2BFZA 5HISA 2NXAA 2BR6A 1HLKA 5HH5A 1SMLA 4Z67A 3LVZA 3I14A 4ZEJA 5IQKA 2BTNA 4AD9A 2BG6A 5K4KA 5EWAA 2GFKA 3T3NA 3WXCA 4AX0B 2A7MA 2BG8B 3AJ3A 4C09A 3T3OA 1VJNA 4O98A 4UBQA 5K0WA 2YNWA 2Y8AA 2CG2A 4J5HA 3DH8A 3FAIA 2BG8A 4KEQA 2M5CA 2GCUA 2ZWRA 2CG3A 4UA4A 1WUOA 4D1UA 4TZEA 4NURA 4YSLA 2FM6A 1JJEA 2UYXA 5AHOA 2CFZA 5ACXA 5HH4A 3FCZA 3RPCA 5FQBA 3BV6A 2Y8BA 3PG4A 1BC2A 4NQ2A 4KEPA 2Q9UA 3ZQ4A 5LS3A 2AZ4A 2BC2A 2FU7A 2WHGA 1JT1A 3R2UA 3IOFA 5EVDA 3RKKA 1YCGA 4J5FA 1X8IA 3ZR9A 4Z5ZA 2HB9A 4NQ5A 1QH5A 3AF5A 4GYQA 3I13A 2VW8A 4WD6A 2Q0JA 4D1TA 4DILA 3F9OA 5EV8A 2WYLA 2P18A 4GCWA 1Y44A 3I11A 5HH6A 4UWRB 1XTOA 5K4MA 3VQZA 4PVTA 3T9MA 2QINA 4HL1A 2FU9A 3DHCA 4Z7RA 5ACUA 2BIBA 2YZ3A 4EYBA 1YCHA 5EVKA 2M5DA 3SBLA 4P62A 5A0VA 2CFUA 3A4YA
chains in the Genus database with same CATH topology
3X2ZA 4TZBA 4TYTA 5KILA 4EYLA 1DDKA 1QH3A 4RAWA 1WRAA 3ZNBA 2BFKA 3IOGA 5LCAA 3IE1A 5HIQA 3ESHA 3SD9A 3IELA 1KO2A 5AXRA 3AF6A 2H6AA 4TZ9A 2OHJA 5B1UA 4RL2A 2BMIA 4NQ4A 4UWPB 4TYFA 3ZWFA 4C1FA 1BVTA 4GYUA 4F6ZA 1ZKPA 2FU8A 4D1VA 5AXOA 4FR7A 4RBSA 4RL0A 2BGAA 4CHLA 4ZNBA 4BZ3A 3SRXA 4D1WA 5LM6A 5B3RA 5LE1A 2YNVB 3IE0A 2Q0IA 1KR3A 3KNSA 2NYPA 2Y87A 1KO3A 5EH9A 2FK6A 5LLDA 3TP9A 1X8GA 2YNTB 2E7YA 5EV6A 2YNVA 1E5DA 1L9YA 5AEBA 4U4LA 5ACSA 2BG7A 2BG2A 2YNTA 5HIPA 5A5ZA 1M2XA 1VMEA 3X30A 2WYMC 2YCBA 1MQOA 2BFLA 4XWWA 1JJTA 2FU6A 3PY6A 5AHRA 3VPEA 4UWOB 5KIKA 3SPUA 4UWSB 4C1DA 2FHXA 4V0HA 5FQAA 3I15A 3SFPA 1WUPA 5DPXA 2QDTA 3L6NA 1DXKA 2ZNBA 1ZTCA 2NZEA 4AWYB 4FSBA 1YCFA 5ACRA 3BK2A 2P97A 2OHIA 2R2DA 3X2XA 4EFZA 1WW1A 1VGNA 2P1EA 4RM5A 3BK1A 2GKLA 2QDSA 4C1GA 5LCFA 5B15A 4EY2A 4EXYA 5A87A 2ZO4A 3Q6VA 2P4ZA 3RKJA 1P9EA 5AYAA 4BP0A 4HKYA 3IDZA 4JO0A 4D02A 4TZFA 3JXPA 3IEMA 3H3EA 3IEKA 4DIKA 5LCHA 3MD7A 4EYFA 2XF4A 2OHHA 2WRSA 2QEDA 2GFJA 4UAMA 4AX1B 2ZZIA 4FEKA 5A0TA 5ACTA 4Z6XA 5ACWA 4ZO3A 4YSBA 2YNUA 4B87A 5EVBA 4ZO2A 3SW3A 4XUKA 5HIOA 2Q42A 1BMCA 4RAMA 4C1EA 3QH8A 1XM8A 2DOOA 4C1HA 4AWZA 4H0DA 2I7TA 4LE6A 4YSKA 4XWTA 4EXSA 3X2YA 5ACVA 3KL7A 1ZNBA 2FHXB 5ACPA 2DKFA 3ADRA 1A7TA 2I7VA 3BC2A 3P2UA 2WYMA 4NQ6A 5LMCA 1K07A 3DHBA 4Z60A 4Z5YA 3IE2A 3G1PA 1A8TA 3DHAA 3S0ZA 2I7XA 3I0VA 2GMNA 3KNRA 4C1CA 1X8HA 2NZFA 5EW0A 2XR1A 5EHTA 5LSCA 2AIOA 2CBNA 2BFZB 5ACQA 4HL2A 5K4NA 4F6HA 5FQCA 4PVOA 3PY5A 1DD6A 2QJSA 2BFZA 5HISA 2NXAA 2BR6A 1HLKA 5HH5A 1SMLA 4Z67A 3LVZA 3I14A 4ZEJA 5IQKA 2BTNA 4AD9A 2BG6A 5K4KA 5EWAA 2GFKA 3T3NA 3WXCA 4AX0B 2A7MA 2BG8B 3AJ3A 4C09A 3T3OA 1VJNA 4O98A 4UBQA 5K0WA 2YNWA 2Y8AA 4J5HA 3DH8A 3FAIA 2BG8A 4KEQA 2M5CA 2GCUA 2ZWRA 4UA4A 1WUOA 4D1UA 4TZEA 4YSLA 2FM6A 1JJEA 2UYXA 5AHOA 5ACXA 5HH4A 3FCZA 3RPCA 5FQBA 3BV6A 2Y8BA 3PG4A 1BC2A 4NQ2A 4KEPA 2Q9UA 3ZQ4A 5LS3A 2AZ4A 2BC2A 2FU7A 2WHGA 1JT1A 3R2UA 3IOFA 5EVDA 3RKKA 1YCGA 4J5FA 1X8IA 3ZR9A 4Z5ZA 2HB9A 4NQ5A 1QH5A 3AF5A 4GYQA 3I13A 2VW8A 4WD6A 2Q0JA 4D1TA 4DILA 3F9OA 5EV8A 2WYLA 2P18A 4GCWA 1Y44A 3I11A 5HH6A 4UWRB 1XTOA 5K4MA 3VQZA 4PVTA 3T9MA 2QINA 4HL1A 2FU9A 3DHCA 4Z7RA 5ACUA 2BIBA 2YZ3A 4EYBA 1YCHA 5EVKA 2M5DA 3SBLA 4P62A 5A0VA 3A4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2Z A;  4TZB A;  4TYT A;  5KIL A;  4EYL A;  1DDK A;  1QH3 A;  4RAW A;  1WRA A;  3ZNB A;  2BFK A;  3IOG A;  5LCA A;  3IE1 A;  5HIQ A;  3ESH A;  3SD9 A;  3IEL A;  1KO2 A;  5AXR A;  3AF6 A;  2H6A A;  4TZ9 A;  2OHJ A;  5B1U A;  4RL2 A;  2BMI A;  4NQ4 A;  4UWP B;  4TYF A;  3ZWF A;  4C1F A;  1BVT A;  4GYU A;  4F6Z A;  1ZKP A;  2FU8 A;  4D1V A;  5AXO A;  4FR7 A;  4RBS A;  4RL0 A;  2BGA A;  4CHL A;  4ZNB A;  4BZ3 A;  3SRX A;  4D1W A;  5LM6 A;  5B3R A;  5LE1 A;  2YNV B;  3IE0 A;  2Q0I A;  1KR3 A;  3KNS A;  2NYP A;  2Y87 A;  1KO3 A;  5EH9 A;  2FK6 A;  5LLD A;  3TP9 A;  1X8G A;  2YNT B;  2E7Y A;  5EV6 A;  2YNV A;  1E5D A;  1L9Y A;  5AEB A;  4U4L A;  5ACS A;  2BG7 A;  2BG2 A;  2YNT A;  5HIP A;  5A5Z A;  1M2X A;  1VME A;  3X30 A;  2WYM C;  2YCB A;  1MQO A;  2BFL A;  4XWW A;  1JJT A;  2FU6 A;  3PY6 A;  5AHR A;  3VPE A;  4UWO B;  5KIK A;  3SPU A;  4UWS B;  4C1D A;  2FHX A;  4V0H A;  5FQA A;  3I15 A;  3SFP A;  1WUP A;  5DPX A;  2QDT A;  3L6N A;  1DXK A;  2ZNB A;  1ZTC A;  2NZE A;  4AWY B;  4FSB A;  1YCF A;  5ACR A;  3BK2 A;  2P97 A;  2OHI A;  2R2D A;  3X2X A;  4EFZ A;  1WW1 A;  1VGN A;  2P1E A;  4RM5 A;  3BK1 A;  2GKL A;  2QDS A;  4C1G A;  5LCF A;  5B15 A;  4EY2 A;  4EXY A;  5A87 A;  2ZO4 A;  3Q6V A;  2P4Z A;  3RKJ A;  1P9E A;  5AYA A;  4BP0 A;  4HKY A;  3IDZ A;  4JO0 A;  4D02 A;  4TZF A;  3JXP A;  3IEM A;  3H3E A;  3IEK A;  4DIK A;  5LCH A;  3MD7 A;  4EYF A;  2XF4 A;  2OHH A;  2WRS A;  2QED A;  2GFJ A;  4UAM A;  4AX1 B;  2ZZI A;  4FEK A;  5A0T A;  5ACT A;  4Z6X A;  5ACW A;  4ZO3 A;  4YSB A;  2YNU A;  4B87 A;  5EVB A;  4ZO2 A;  3SW3 A;  4XUK A;  5HIO A;  2Q42 A;  1BMC A;  4RAM A;  4C1E A;  3QH8 A;  1XM8 A;  2DOO A;  4C1H A;  4AWZ A;  4H0D A;  2I7T A;  4LE6 A;  4YSK A;  4XWT A;  4EXS A;  3X2Y A;  5ACV A;  3KL7 A;  1ZNB A;  2FHX B;  5ACP A;  2DKF A;  3ADR A;  1A7T A;  2I7V A;  3BC2 A;  3P2U A;  2WYM A;  4NQ6 A;  5LMC A;  1K07 A;  3DHB A;  4Z60 A;  4Z5Y A;  3IE2 A;  3G1P A;  1A8T A;  3DHA A;  3S0Z A;  2I7X A;  3I0V A;  2GMN A;  3KNR A;  4C1C A;  1X8H A;  2NZF A;  5EW0 A;  2XR1 A;  5EHT A;  5LSC A;  2AIO A;  2CBN A;  2BFZ B;  5ACQ A;  4HL2 A;  5K4N A;  4F6H A;  5FQC A;  4PVO A;  3PY5 A;  1DD6 A;  2QJS A;  2BFZ A;  5HIS A;  2NXA A;  2BR6 A;  1HLK A;  5HH5 A;  1SML A;  4Z67 A;  3LVZ A;  3I14 A;  4ZEJ A;  5IQK A;  2BTN A;  4AD9 A;  2BG6 A;  5K4K A;  5EWA A;  2GFK A;  3T3N A;  3WXC A;  4AX0 B;  2A7M A;  2BG8 B;  3AJ3 A;  4C09 A;  3T3O A;  1VJN A;  4O98 A;  4UBQ A;  5K0W A;  2YNW A;  2Y8A A;  4J5H A;  3DH8 A;  3FAI A;  2BG8 A;  4KEQ A;  2M5C A;  2GCU A;  2ZWR A;  4UA4 A;  1WUO A;  4D1U A;  4TZE A;  4YSL A;  2FM6 A;  1JJE A;  2UYX A;  5AHO A;  5ACX A;  5HH4 A;  3FCZ A;  3RPC A;  5FQB A;  3BV6 A;  2Y8B A;  3PG4 A;  1BC2 A;  4NQ2 A;  4KEP A;  2Q9U A;  3ZQ4 A;  5LS3 A;  2AZ4 A;  2BC2 A;  2FU7 A;  2WHG A;  1JT1 A;  3R2U A;  3IOF A;  5EVD A;  3RKK A;  1YCG A;  4J5F A;  1X8I A;  3ZR9 A;  4Z5Z A;  2HB9 A;  4NQ5 A;  1QH5 A;  3AF5 A;  4GYQ A;  3I13 A;  2VW8 A;  4WD6 A;  2Q0J A;  4D1T A;  4DIL A;  3F9O A;  5EV8 A;  2WYL A;  2P18 A;  4GCW A;  1Y44 A;  3I11 A;  5HH6 A;  4UWR B;  1XTO A;  5K4M A;  3VQZ A;  4PVT A;  3T9M A;  2QIN A;  4HL1 A;  2FU9 A;  3DHC A;  4Z7R A;  5ACU A;  2BIB A;  2YZ3 A;  4EYB A;  1YCH A;  5EVK A;  2M5D A;  3SBL A;  4P62 A;  5A0V A;  3A4Y A; 
#chains in the Genus database with same CATH topology
 3X2Z A;  4TZB A;  4TYT A;  5KIL A;  4EYL A;  4AV7 A;  1DDK A;  1QH3 A;  4RAW A;  1WRA A;  3ZNB A;  2BFK A;  3IOG A;  5LCA A;  3IE1 A;  5HIQ A;  3ESH A;  3SD9 A;  3IEL A;  1KO2 A;  5AXR A;  3AF6 A;  2H6A A;  4TZ9 A;  2OHJ A;  5B1U A;  4RL2 A;  2BMI A;  4NQ4 A;  4UWP B;  4TYF A;  3ZWF A;  4C1F A;  1BVT A;  4GYU A;  4F6Z A;  1ZKP A;  2FU8 A;  4D1V A;  5AXO A;  4FR7 A;  4RBS A;  4RL0 A;  5AIJ A;  2BGA A;  4CHL A;  4ZNB A;  4BZ3 A;  3SRX A;  4D1W A;  5LM6 A;  5B3R A;  5LE1 A;  2YNV B;  3IE0 A;  2Q0I A;  1KR3 A;  3KNS A;  2NYP A;  2Y87 A;  1KO3 A;  5EH9 A;  2FK6 A;  5LLD A;  3TP9 A;  1X8G A;  2YNT B;  2E7Y A;  5EV6 A;  2YNV A;  1E5D A;  1L9Y A;  5AEB A;  4U4L A;  5ACS A;  2BG7 A;  2BG2 A;  2YNT A;  5HIP A;  5A5Z A;  1M2X A;  1VME A;  3X30 A;  2WYM C;  2YCB A;  1MQO A;  2BFL A;  4XWW A;  1JJT A;  2FU6 A;  3PY6 A;  5AHR A;  3VPE A;  4UWO B;  5KIK A;  3SPU A;  4UWS B;  4C1D A;  4AXH A;  2FHX A;  4V0H A;  5FQA A;  3I15 A;  3SFP A;  1WUP A;  5DPX A;  2QDT A;  3L6N A;  1DXK A;  2ZNB A;  1ZTC A;  2NZE A;  4AWY B;  4FSB A;  1YCF A;  5ACR A;  3BK2 A;  2P97 A;  2OHI A;  2R2D A;  3X2X A;  4EFZ A;  1WW1 A;  1VGN A;  2P1E A;  4RM5 A;  3BK1 A;  2GKL A;  2QDS A;  4C1G A;  5LCF A;  5B15 A;  4EY2 A;  4EXY A;  5A87 A;  2ZO4 A;  3Q6V A;  2P4Z A;  3RKJ A;  1P9E A;  5AYA A;  4BP0 A;  4HKY A;  3IDZ A;  4JO0 A;  5AJL A;  4D02 A;  4TZF A;  3JXP A;  3IEM A;  3H3E A;  3IEK A;  4DIK A;  5LCH A;  3MD7 A;  4EYF A;  2XF4 A;  2OHH A;  2WRS A;  2YHE A;  2QED A;  2GFJ A;  4UAM A;  4AX1 B;  2ZZI A;  4FEK A;  5A0T A;  5ACT A;  4Z6X A;  5ACW A;  4ZO3 A;  4YSB A;  2YNU A;  4B87 A;  5EVB A;  4ZO2 A;  3SW3 A;  4XUK A;  5HIO A;  2Q42 A;  1BMC A;  4RAM A;  4C1E A;  3QH8 A;  1XM8 A;  2DOO A;  4C1H A;  4PDX A;  4AWZ A;  4H0D A;  2I7T A;  4LE6 A;  4YSK A;  4XWT A;  4EXS A;  3X2Y A;  5ACV A;  3KL7 A;  1ZNB A;  2FHX B;  5ACP A;  2DKF A;  3ADR A;  1A7T A;  2I7V A;  3BC2 A;  3P2U A;  2WYM A;  4NQ6 A;  5LMC A;  1K07 A;  3DHB A;  4Z60 A;  4Z5Y A;  3IE2 A;  3G1P A;  1A8T A;  3DHA A;  3S0Z A;  2I7X A;  3I0V A;  2GMN A;  3KNR A;  4C1C A;  1X8H A;  2NZF A;  5EW0 A;  2XR1 A;  5EHT A;  5LSC A;  2AIO A;  2CBN A;  2BFZ B;  5A23 A;  5ACQ A;  4HL2 A;  5K4N A;  4F6H A;  5FQC A;  4PVO A;  3PY5 A;  1DD6 A;  2QJS A;  2BFZ A;  5HIS A;  2NXA A;  2BR6 A;  1HLK A;  5HH5 A;  1SML A;  4Z67 A;  3LVZ A;  3I14 A;  4ZEJ A;  5IQK A;  2BTN A;  4AD9 A;  2BG6 A;  5K4K A;  5EWA A;  2GFK A;  3T3N A;  3WXC A;  4AX0 B;  2A7M A;  2BG8 B;  3AJ3 A;  4C09 A;  3T3O A;  1VJN A;  4O98 A;  4UBQ A;  5K0W A;  2YNW A;  2Y8A A;  2CG2 A;  4J5H A;  3DH8 A;  3FAI A;  2BG8 A;  4KEQ A;  2M5C A;  2GCU A;  2ZWR A;  2CG3 A;  4UA4 A;  1WUO A;  4D1U A;  4TZE A;  4NUR A;  4YSL A;  2FM6 A;  1JJE A;  2UYX A;  5AHO A;  2CFZ A;  5ACX A;  5HH4 A;  3FCZ A;  3RPC A;  5FQB A;  3BV6 A;  2Y8B A;  3PG4 A;  1BC2 A;  4NQ2 A;  4KEP A;  2Q9U A;  3ZQ4 A;  5LS3 A;  2AZ4 A;  2BC2 A;  2FU7 A;  2WHG A;  1JT1 A;  3R2U A;  3IOF A;  5EVD A;  3RKK A;  1YCG A;  4J5F A;  1X8I A;  3ZR9 A;  4Z5Z A;  2HB9 A;  4NQ5 A;  1QH5 A;  3AF5 A;  4GYQ A;  3I13 A;  2VW8 A;  4WD6 A;  2Q0J A;  4D1T A;  4DIL A;  3F9O A;  5EV8 A;  2WYL A;  2P18 A;  4GCW A;  1Y44 A;  3I11 A;  5HH6 A;  4UWR B;  1XTO A;  5K4M A;  3VQZ A;  4PVT A;  3T9M A;  2QIN A;  4HL1 A;  2FU9 A;  3DHC A;  4Z7R A;  5ACU A;  2BIB A;  2YZ3 A;  4EYB A;  1YCH A;  5EVK A;  2M5D A;  3SBL A;  4P62 A;  5A0V A;  2CFU A;  3A4Y A; 
#chains in the Genus database with same CATH homology
 3X2Z A;  4TZB A;  4TYT A;  5KIL A;  4EYL A;  1DDK A;  1QH3 A;  4RAW A;  1WRA A;  3ZNB A;  2BFK A;  3IOG A;  5LCA A;  3IE1 A;  5HIQ A;  3ESH A;  3SD9 A;  3IEL A;  1KO2 A;  5AXR A;  3AF6 A;  2H6A A;  4TZ9 A;  2OHJ A;  5B1U A;  4RL2 A;  2BMI A;  4NQ4 A;  4UWP B;  4TYF A;  3ZWF A;  4C1F A;  1BVT A;  4GYU A;  4F6Z A;  1ZKP A;  2FU8 A;  4D1V A;  5AXO A;  4FR7 A;  4RBS A;  4RL0 A;  2BGA A;  4CHL A;  4ZNB A;  4BZ3 A;  3SRX A;  4D1W A;  5LM6 A;  5B3R A;  5LE1 A;  2YNV B;  3IE0 A;  2Q0I A;  1KR3 A;  3KNS A;  2NYP A;  2Y87 A;  1KO3 A;  5EH9 A;  2FK6 A;  5LLD A;  3TP9 A;  1X8G A;  2YNT B;  2E7Y A;  5EV6 A;  2YNV A;  1E5D A;  1L9Y A;  5AEB A;  4U4L A;  5ACS A;  2BG7 A;  2BG2 A;  2YNT A;  5HIP A;  5A5Z A;  1M2X A;  1VME A;  3X30 A;  2WYM C;  2YCB A;  1MQO A;  2BFL A;  4XWW A;  1JJT A;  2FU6 A;  3PY6 A;  5AHR A;  3VPE A;  4UWO B;  5KIK A;  3SPU A;  4UWS B;  4C1D A;  2FHX A;  4V0H A;  5FQA A;  3I15 A;  3SFP A;  1WUP A;  5DPX A;  2QDT A;  3L6N A;  1DXK A;  2ZNB A;  1ZTC A;  2NZE A;  4AWY B;  4FSB A;  1YCF A;  5ACR A;  3BK2 A;  2P97 A;  2OHI A;  2R2D A;  3X2X A;  4EFZ A;  1WW1 A;  1VGN A;  2P1E A;  4RM5 A;  3BK1 A;  2GKL A;  2QDS A;  4C1G A;  5LCF A;  5B15 A;  4EY2 A;  4EXY A;  5A87 A;  2ZO4 A;  3Q6V A;  2P4Z A;  3RKJ A;  1P9E A;  5AYA A;  4BP0 A;  4HKY A;  3IDZ A;  4JO0 A;  4D02 A;  4TZF A;  3JXP A;  3IEM A;  3H3E A;  3IEK A;  4DIK A;  5LCH A;  3MD7 A;  4EYF A;  2XF4 A;  2OHH A;  2WRS A;  2QED A;  2GFJ A;  4UAM A;  4AX1 B;  2ZZI A;  4FEK A;  5A0T A;  5ACT A;  4Z6X A;  5ACW A;  4ZO3 A;  4YSB A;  2YNU A;  4B87 A;  5EVB A;  4ZO2 A;  3SW3 A;  4XUK A;  5HIO A;  2Q42 A;  1BMC A;  4RAM A;  4C1E A;  3QH8 A;  1XM8 A;  2DOO A;  4C1H A;  4AWZ A;  4H0D A;  2I7T A;  4LE6 A;  4YSK A;  4XWT A;  4EXS A;  3X2Y A;  5ACV A;  3KL7 A;  1ZNB A;  2FHX B;  5ACP A;  2DKF A;  3ADR A;  1A7T A;  2I7V A;  3BC2 A;  3P2U A;  2WYM A;  4NQ6 A;  5LMC A;  1K07 A;  3DHB A;  4Z60 A;  4Z5Y A;  3IE2 A;  3G1P A;  1A8T A;  3DHA A;  3S0Z A;  2I7X A;  3I0V A;  2GMN A;  3KNR A;  4C1C A;  1X8H A;  2NZF A;  5EW0 A;  2XR1 A;  5EHT A;  5LSC A;  2AIO A;  2CBN A;  2BFZ B;  5ACQ A;  4HL2 A;  5K4N A;  4F6H A;  5FQC A;  4PVO A;  3PY5 A;  1DD6 A;  2QJS A;  2BFZ A;  5HIS A;  2NXA A;  2BR6 A;  1HLK A;  5HH5 A;  1SML A;  4Z67 A;  3LVZ A;  3I14 A;  4ZEJ A;  5IQK A;  2BTN A;  4AD9 A;  2BG6 A;  5K4K A;  5EWA A;  2GFK A;  3T3N A;  3WXC A;  4AX0 B;  2A7M A;  2BG8 B;  3AJ3 A;  4C09 A;  3T3O A;  1VJN A;  4O98 A;  4UBQ A;  5K0W A;  2YNW A;  2Y8A A;  4J5H A;  3DH8 A;  3FAI A;  2BG8 A;  4KEQ A;  2M5C A;  2GCU A;  2ZWR A;  4UA4 A;  1WUO A;  4D1U A;  4TZE A;  4YSL A;  2FM6 A;  1JJE A;  2UYX A;  5AHO A;  5ACX A;  5HH4 A;  3FCZ A;  3RPC A;  5FQB A;  3BV6 A;  2Y8B A;  3PG4 A;  1BC2 A;  4NQ2 A;  4KEP A;  2Q9U A;  3ZQ4 A;  5LS3 A;  2AZ4 A;  2BC2 A;  2FU7 A;  2WHG A;  1JT1 A;  3R2U A;  3IOF A;  5EVD A;  3RKK A;  1YCG A;  4J5F A;  1X8I A;  3ZR9 A;  4Z5Z A;  2HB9 A;  4NQ5 A;  1QH5 A;  3AF5 A;  4GYQ A;  3I13 A;  2VW8 A;  4WD6 A;  2Q0J A;  4D1T A;  4DIL A;  3F9O A;  5EV8 A;  2WYL A;  2P18 A;  4GCW A;  1Y44 A;  3I11 A;  5HH6 A;  4UWR B;  1XTO A;  5K4M A;  3VQZ A;  4PVT A;  3T9M A;  2QIN A;  4HL1 A;  2FU9 A;  3DHC A;  4Z7R A;  5ACU A;  2BIB A;  2YZ3 A;  4EYB A;  1YCH A;  5EVK A;  2M5D A;  3SBL A;  4P62 A;  5A0V A;  3A4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...