2FHXB

Pseudomonas aeruginosa spm-1 metallo-beta-lactamase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
245
structure length
244
Chain Sequence
b'DHVDLPYNLTATKIDSDVFVVTDRDFYSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGMIKPKELGYLGDANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Pseudomonas aeruginosa SPM-1 Provides Insights into Variable Zinc Affinity of Metallo-beta-lactamases.
pubmed doi rcsb
molecule keywords SPM-1
source organism Pseudomonas aeruginosa
molecule tags Hydrolase, metal binding protein
total genus 73
structure length 244
sequence length 245
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2fhxB00
2YNVA 2YNUA 2YNVB 5AEBA 4YSBA 3R2UA 4EXSA 3DH8A 4UWOB 1BC2A 1YCFA 1WW1A 5HH4A 2NXAA 1ZNBA 4J5HA 4H0DA 4NQ6A 5LCAA 3SPUA 4RAMA 3BC2A 1E5DA 2BG6A 4Z7RA 3RPCA 4P62A 3T3NA 2GCUA 4GYUA 2OHIA 4LE6A 2AZ4A 2WYMA 4EYLA 2FU9A 5ACWA 3I14A 2BG2A 5EVBA 3IEKA 5LSCA 4O98A 1XTOA 4HL2A 3VPEA 4EY2A 4XUKA 4TYFA 3IDZA 4J5FA 5EW0A 3I15A 5ACRA 3ZNBA 4CHLA 4PVTA 1JJEA 4D02A 5AXRA 4ZO2A 3P2UA 3AF6A 4RBSA 1WUOA 1K07A 3FCZA 5HIOA 5HH6A 5AYAA 2H6AA 4AWYB 4C1FA 4D1WA 1BVTA 5KILA 2ZWRA 2NYPA 3F9OA 2GFJA 5HIQA 3DHCA 4UWPB 5LMCA 2YNWA 2BFKA 4UAMA 5LCFA 1QH5A 4NQ4A 2WHGA 5EV6A 5ACSA 3IEMA 1JJTA 3PY5A 2Y87A 3RKKA 3ZWFA 2BFZB 2QDSA 2GMNA 4RL0A 1KR3A 5AHRA 1ZTCA 5FQCA 3IE1A 2FM6A 3KL7A 3SBLA 1DDKA 5EVKA 4TZEA 3WXCA 2YZ3A 1A8TA 3ZQ4A 4U4LA 1X8IA 4RL2A 4Z6XA 1JT1A 3ESHA 5LLDA 3I0VA 3Q6VA 3X30A 3L6NA 3AJ3A 5K4NA 2QDTA 5EWAA 2P4ZA 4DILA 2Q42A 2OHHA 5HH5A 2ZNBA 2FU6A 4FSBA 5ACUA 4EYBA 4C09A 1BMCA 2BC2A 4AX1B 2DKFA 2AIOA 4NQ2A 2A7MA 5K4KA 3ADRA 2FU8A 3AF5A 4TZBA 1SMLA 5ACVA 1YCHA 3RKJA 4B87A 4C1GA 4JO0A 4HKYA 1HLKA 4NQ5A 3I11A 2ZZIA 4PVOA 1VJNA 2XR1A 4Z67A 2BIBA 4XWWA 4UWRB 3JXPA 2NZEA 2BFLA 5ACTA 2P1EA 5HISA 3DHBA 2XF4A 2Q9UA 3X2ZA 4GYQA 4D1UA 2Y8BA 5B3RA 4AD9A 5B15A 3X2YA 5KIKA 4D1VA 3BV6A 5AHOA 3SD9A 3QH8A 5LS3A 3IELA 5EVDA 3TP9A 1X8HA 5LE1A 2BGAA 1WUPA 5A0TA 4BP0A 4C1HA 4RAWA 5LM6A 2I7VA 2I7XA 4D1TA 3VQZA 4TZ9A 2M5DA 2BTNA 4ZNBA 5FQAA 2FU7A 4BZ3A 5EV8A 2BG7A 2E7YA 1QH3A 4EYFA 3FAIA 4AX0B 4TZFA 5HIPA 5LCHA 4TYTA 2YNTA 3PG4A 4C1EA 1P9EA 5B1UA 2YNTB 2VW8A 4F6ZA 3IOFA 4YSKA 2YCBA 5ACXA 1YCGA 1MQOA 1DD6A 4DIKA 3SFPA 3G1PA 1M2XA 2FK6A 1XM8A 3H3EA 1X8GA 2BMIA 4FEKA 4ZO3A 3T9MA 3ZR9A 1WRAA 2CBNA 4XWTA 2BR6A 2GFKA 3SW3A 4C1CA 3A4YA 2QJSA 2P18A 4WD6A 2NZFA 2WYLA 4KEQA 2DOOA 1ZKPA 3MD7A 2WRSA 3I13A 4YSLA 5EHTA 1VMEA 4HL1A 4RM5A 4EXYA 5FQBA 2OHJA 4EFZA 3T3OA 1A7TA 4KEPA 1KO2A 2UYXA 1Y44A 2M5CA 2R2DA 2WYMC 2P97A 5A5ZA 5ACPA 2Q0IA 5ACQA 4ZEJA 2I7TA 2HB9A 5EH9A 2GKLA 3X2XA 4Z60A 3PY6A 2ZO4A 4FR7A 3SRXA 5K0WA 3DHAA 5A0VA 3IE0A 4Z5YA 4GCWA 2BG8A 1KO3A 3LVZA 2Q0JA 2BG8B 3KNSA 1DXKA 3BK1A 1VGNA 4Z5ZA 3KNRA 4UA4A 2QEDA 3IOGA 5K4MA 5A87A 3IE2A 2BFZA 2FHXA 2Y8AA 5AXOA 5IQKA 2FHXB 5DPXA 4F6HA 4C1DA 1L9YA 2QINA 3BK2A 4UWSB 4V0HA 3S0ZA 4AWZA 4UBQA
chains in the Genus database with same CATH superfamily
2YNVA 2YNUA 2YNVB 5AEBA 4YSBA 3R2UA 4EXSA 3DH8A 4UWOB 1BC2A 1YCFA 1WW1A 5HH4A 2NXAA 1ZNBA 4J5HA 4H0DA 4NQ6A 5LCAA 3SPUA 4RAMA 3BC2A 1E5DA 2CG2A 2BG6A 4Z7RA 3RPCA 4P62A 3T3NA 2GCUA 4GYUA 2OHIA 4LE6A 2AZ4A 2WYMA 4NURA 4EYLA 2FU9A 2CG3A 5ACWA 3I14A 4AV7A 2BG2A 5EVBA 3IEKA 5LSCA 4O98A 1XTOA 4HL2A 3VPEA 4EY2A 4XUKA 4TYFA 3IDZA 4J5FA 5EW0A 3I15A 5ACRA 3ZNBA 4CHLA 4PVTA 1JJEA 4D02A 5AXRA 4ZO2A 3P2UA 3AF6A 4RBSA 1WUOA 4PDXA 1K07A 3FCZA 5HIOA 5HH6A 5AYAA 2H6AA 4AWYB 4C1FA 4D1WA 1BVTA 5KILA 2ZWRA 2NYPA 3F9OA 2GFJA 5HIQA 3DHCA 4UWPB 5LMCA 2YNWA 2BFKA 4UAMA 5LCFA 1QH5A 4NQ4A 2WHGA 5EV6A 5ACSA 3IEMA 1JJTA 3PY5A 2Y87A 3RKKA 3ZWFA 2BFZB 2QDSA 2GMNA 4RL0A 1KR3A 5AHRA 1ZTCA 5FQCA 3IE1A 2FM6A 3KL7A 3SBLA 1DDKA 5EVKA 4TZEA 3WXCA 2YZ3A 1A8TA 3ZQ4A 4U4LA 1X8IA 4RL2A 4Z6XA 1JT1A 3ESHA 5LLDA 3I0VA 5AIJA 3Q6VA 3X30A 3L6NA 3AJ3A 5K4NA 2QDTA 5EWAA 2P4ZA 4DILA 2Q42A 2OHHA 5HH5A 2ZNBA 2FU6A 4FSBA 5ACUA 4EYBA 4C09A 1BMCA 2BC2A 4AX1B 2DKFA 2AIOA 4NQ2A 2A7MA 5K4KA 3ADRA 2FU8A 3AF5A 4TZBA 1SMLA 5ACVA 1YCHA 3RKJA 4B87A 4C1GA 4JO0A 4HKYA 1HLKA 4NQ5A 3I11A 2ZZIA 4PVOA 1VJNA 2XR1A 4Z67A 2BIBA 4XWWA 4UWRB 3JXPA 2NZEA 2BFLA 5ACTA 2P1EA 5HISA 3DHBA 2XF4A 2Q9UA 3X2ZA 4GYQA 4D1UA 2Y8BA 5B3RA 4AD9A 5B15A 3X2YA 2CFZA 5KIKA 4D1VA 3BV6A 5AHOA 3SD9A 3QH8A 5LS3A 3IELA 5EVDA 3TP9A 1X8HA 5LE1A 2BGAA 1WUPA 5A0TA 4BP0A 4C1HA 4RAWA 5LM6A 2I7VA 2I7XA 4D1TA 3VQZA 4TZ9A 2M5DA 2BTNA 4ZNBA 5FQAA 2FU7A 4BZ3A 5EV8A 2BG7A 2E7YA 1QH3A 4EYFA 3FAIA 4AX0B 4TZFA 5HIPA 5LCHA 4TYTA 2YNTA 3PG4A 4C1EA 1P9EA 2YHEA 2CFUA 5B1UA 2YNTB 2VW8A 4F6ZA 3IOFA 4YSKA 2YCBA 5ACXA 1YCGA 1MQOA 1DD6A 3SFPA 4DIKA 3G1PA 1M2XA 2FK6A 1XM8A 3H3EA 1X8GA 2BMIA 4FEKA 4ZO3A 3T9MA 3ZR9A 1WRAA 2CBNA 4XWTA 2BR6A 2GFKA 3SW3A 4C1CA 3A4YA 2QJSA 2P18A 4WD6A 2NZFA 2WYLA 4KEQA 2DOOA 1ZKPA 3MD7A 2WRSA 3I13A 4YSLA 5EHTA 1VMEA 4AXHA 4HL1A 4RM5A 4EXYA 5FQBA 2OHJA 4EFZA 3T3OA 1A7TA 4KEPA 1KO2A 2UYXA 1Y44A 2M5CA 2R2DA 2WYMC 2P97A 5A5ZA 5ACPA 2Q0IA 5ACQA 4ZEJA 2I7TA 2HB9A 5EH9A 2GKLA 3X2XA 4Z60A 3PY6A 2ZO4A 4FR7A 3SRXA 5K0WA 3DHAA 5A0VA 3IE0A 5AJLA 4Z5YA 4GCWA 2BG8A 1KO3A 3LVZA 2Q0JA 2BG8B 3KNSA 1DXKA 3BK1A 1VGNA 4Z5ZA 3KNRA 4UA4A 2QEDA 3IOGA 5K4MA 5A87A 3IE2A 2BFZA 2FHXA 2Y8AA 5AXOA 5IQKA 2FHXB 5DPXA 4F6HA 4C1DA 1L9YA 2QINA 3BK2A 4UWSB 5A23A 4V0HA 3S0ZA 4AWZA 4UBQA
chains in the Genus database with same CATH topology
2YNVA 2YNUA 2YNVB 5AEBA 4YSBA 3R2UA 4EXSA 3DH8A 4UWOB 1BC2A 1YCFA 1WW1A 5HH4A 2NXAA 1ZNBA 4J5HA 4H0DA 4NQ6A 5LCAA 3SPUA 4RAMA 3BC2A 1E5DA 2BG6A 4Z7RA 3RPCA 4P62A 3T3NA 2GCUA 4GYUA 2OHIA 4LE6A 2AZ4A 2WYMA 4EYLA 2FU9A 5ACWA 3I14A 2BG2A 5EVBA 3IEKA 5LSCA 4O98A 1XTOA 4HL2A 3VPEA 4EY2A 4XUKA 4TYFA 3IDZA 4J5FA 5EW0A 3I15A 5ACRA 3ZNBA 4CHLA 4PVTA 1JJEA 4D02A 5AXRA 4ZO2A 3P2UA 3AF6A 4RBSA 1WUOA 1K07A 3FCZA 5HIOA 5HH6A 5AYAA 2H6AA 4AWYB 4C1FA 4D1WA 1BVTA 5KILA 2ZWRA 2NYPA 3F9OA 2GFJA 5HIQA 3DHCA 4UWPB 5LMCA 2YNWA 2BFKA 4UAMA 5LCFA 1QH5A 4NQ4A 2WHGA 5EV6A 5ACSA 3IEMA 1JJTA 3PY5A 2Y87A 3RKKA 3ZWFA 2BFZB 2QDSA 2GMNA 4RL0A 1KR3A 5AHRA 1ZTCA 5FQCA 3IE1A 2FM6A 3KL7A 3SBLA 1DDKA 5EVKA 4TZEA 3WXCA 2YZ3A 1A8TA 3ZQ4A 4U4LA 1X8IA 4RL2A 4Z6XA 1JT1A 3ESHA 5LLDA 3I0VA 3Q6VA 3X30A 3L6NA 3AJ3A 5K4NA 2QDTA 5EWAA 2P4ZA 4DILA 2Q42A 2OHHA 5HH5A 2ZNBA 2FU6A 4FSBA 5ACUA 4EYBA 4C09A 1BMCA 2BC2A 4AX1B 2DKFA 2AIOA 4NQ2A 2A7MA 5K4KA 3ADRA 2FU8A 3AF5A 4TZBA 1SMLA 5ACVA 1YCHA 3RKJA 4B87A 4C1GA 4JO0A 4HKYA 1HLKA 4NQ5A 3I11A 2ZZIA 4PVOA 1VJNA 2XR1A 4Z67A 2BIBA 4XWWA 4UWRB 3JXPA 2NZEA 2BFLA 5ACTA 2P1EA 5HISA 3DHBA 2XF4A 2Q9UA 3X2ZA 4GYQA 4D1UA 2Y8BA 5B3RA 4AD9A 5B15A 3X2YA 5KIKA 4D1VA 3BV6A 5AHOA 3SD9A 3QH8A 5LS3A 3IELA 5EVDA 3TP9A 1X8HA 5LE1A 2BGAA 1WUPA 5A0TA 4BP0A 4C1HA 4RAWA 5LM6A 2I7VA 2I7XA 4D1TA 3VQZA 4TZ9A 2M5DA 2BTNA 4ZNBA 5FQAA 2FU7A 4BZ3A 5EV8A 2BG7A 2E7YA 1QH3A 4EYFA 3FAIA 4AX0B 4TZFA 5HIPA 5LCHA 4TYTA 2YNTA 3PG4A 4C1EA 1P9EA 5B1UA 2YNTB 2VW8A 4F6ZA 3IOFA 4YSKA 2YCBA 5ACXA 1YCGA 1MQOA 1DD6A 4DIKA 3SFPA 3G1PA 1M2XA 2FK6A 1XM8A 3H3EA 1X8GA 2BMIA 4FEKA 4ZO3A 3T9MA 3ZR9A 1WRAA 2CBNA 4XWTA 2BR6A 2GFKA 3SW3A 4C1CA 3A4YA 2QJSA 2P18A 4WD6A 2NZFA 2WYLA 4KEQA 2DOOA 1ZKPA 3MD7A 2WRSA 3I13A 4YSLA 5EHTA 1VMEA 4HL1A 4RM5A 4EXYA 5FQBA 2OHJA 4EFZA 3T3OA 1A7TA 4KEPA 1KO2A 2UYXA 1Y44A 2M5CA 2R2DA 2WYMC 2P97A 5A5ZA 5ACPA 2Q0IA 5ACQA 4ZEJA 2I7TA 2HB9A 5EH9A 2GKLA 3X2XA 4Z60A 3PY6A 2ZO4A 4FR7A 3SRXA 5K0WA 3DHAA 5A0VA 3IE0A 4Z5YA 4GCWA 2BG8A 1KO3A 3LVZA 2Q0JA 2BG8B 3KNSA 1DXKA 3BK1A 1VGNA 4Z5ZA 3KNRA 4UA4A 2QEDA 3IOGA 5K4MA 5A87A 3IE2A 2BFZA 2FHXA 2Y8AA 5AXOA 5IQKA 2FHXB 5DPXA 4F6HA 4C1DA 1L9YA 2QINA 3BK2A 4UWSB 4V0HA 3S0ZA 4AWZA 4UBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNV A;  2YNU A;  2YNV B;  5AEB A;  4YSB A;  3R2U A;  4EXS A;  3DH8 A;  4UWO B;  1BC2 A;  1YCF A;  1WW1 A;  5HH4 A;  2NXA A;  1ZNB A;  4J5H A;  4H0D A;  4NQ6 A;  5LCA A;  3SPU A;  4RAM A;  3BC2 A;  1E5D A;  2BG6 A;  4Z7R A;  3RPC A;  4P62 A;  3T3N A;  2GCU A;  4GYU A;  2OHI A;  4LE6 A;  2AZ4 A;  2WYM A;  4EYL A;  2FU9 A;  5ACW A;  3I14 A;  2BG2 A;  5EVB A;  3IEK A;  5LSC A;  4O98 A;  1XTO A;  4HL2 A;  3VPE A;  4EY2 A;  4XUK A;  4TYF A;  3IDZ A;  4J5F A;  5EW0 A;  3I15 A;  5ACR A;  3ZNB A;  4CHL A;  4PVT A;  1JJE A;  4D02 A;  5AXR A;  4ZO2 A;  3P2U A;  3AF6 A;  4RBS A;  1WUO A;  1K07 A;  3FCZ A;  5HIO A;  5HH6 A;  5AYA A;  2H6A A;  4AWY B;  4C1F A;  4D1W A;  1BVT A;  5KIL A;  2ZWR A;  2NYP A;  3F9O A;  2GFJ A;  5HIQ A;  3DHC A;  4UWP B;  5LMC A;  2YNW A;  2BFK A;  4UAM A;  5LCF A;  1QH5 A;  4NQ4 A;  2WHG A;  5EV6 A;  5ACS A;  3IEM A;  1JJT A;  3PY5 A;  2Y87 A;  3RKK A;  3ZWF A;  2BFZ B;  2QDS A;  2GMN A;  4RL0 A;  1KR3 A;  5AHR A;  1ZTC A;  5FQC A;  3IE1 A;  2FM6 A;  3KL7 A;  3SBL A;  1DDK A;  5EVK A;  4TZE A;  3WXC A;  2YZ3 A;  1A8T A;  3ZQ4 A;  4U4L A;  1X8I A;  4RL2 A;  4Z6X A;  1JT1 A;  3ESH A;  5LLD A;  3I0V A;  3Q6V A;  3X30 A;  3L6N A;  3AJ3 A;  5K4N A;  2QDT A;  5EWA A;  2P4Z A;  4DIL A;  2Q42 A;  2OHH A;  5HH5 A;  2ZNB A;  2FU6 A;  4FSB A;  5ACU A;  4EYB A;  4C09 A;  1BMC A;  2BC2 A;  4AX1 B;  2DKF A;  2AIO A;  4NQ2 A;  2A7M A;  5K4K A;  3ADR A;  2FU8 A;  3AF5 A;  4TZB A;  1SML A;  5ACV A;  1YCH A;  3RKJ A;  4B87 A;  4C1G A;  4JO0 A;  4HKY A;  1HLK A;  4NQ5 A;  3I11 A;  2ZZI A;  4PVO A;  1VJN A;  2XR1 A;  4Z67 A;  2BIB A;  4XWW A;  4UWR B;  3JXP A;  2NZE A;  2BFL A;  5ACT A;  2P1E A;  5HIS A;  3DHB A;  2XF4 A;  2Q9U A;  3X2Z A;  4GYQ A;  4D1U A;  2Y8B A;  5B3R A;  4AD9 A;  5B15 A;  3X2Y A;  5KIK A;  4D1V A;  3BV6 A;  5AHO A;  3SD9 A;  3QH8 A;  5LS3 A;  3IEL A;  5EVD A;  3TP9 A;  1X8H A;  5LE1 A;  2BGA A;  1WUP A;  5A0T A;  4BP0 A;  4C1H A;  4RAW A;  5LM6 A;  2I7V A;  2I7X A;  4D1T A;  3VQZ A;  4TZ9 A;  2M5D A;  2BTN A;  4ZNB A;  5FQA A;  2FU7 A;  4BZ3 A;  5EV8 A;  2BG7 A;  2E7Y A;  1QH3 A;  4EYF A;  3FAI A;  4AX0 B;  4TZF A;  5HIP A;  5LCH A;  4TYT A;  2YNT A;  3PG4 A;  4C1E A;  1P9E A;  5B1U A;  2YNT B;  2VW8 A;  4F6Z A;  3IOF A;  4YSK A;  2YCB A;  5ACX A;  1YCG A;  1MQO A;  1DD6 A;  4DIK A;  3SFP A;  3G1P A;  1M2X A;  2FK6 A;  1XM8 A;  3H3E A;  1X8G A;  2BMI A;  4FEK A;  4ZO3 A;  3T9M A;  3ZR9 A;  1WRA A;  2CBN A;  4XWT A;  2BR6 A;  2GFK A;  3SW3 A;  4C1C A;  3A4Y A;  2QJS A;  2P18 A;  4WD6 A;  2NZF A;  2WYL A;  4KEQ A;  2DOO A;  1ZKP A;  3MD7 A;  2WRS A;  3I13 A;  4YSL A;  5EHT A;  1VME A;  4HL1 A;  4RM5 A;  4EXY A;  5FQB A;  2OHJ A;  4EFZ A;  3T3O A;  1A7T A;  4KEP A;  1KO2 A;  2UYX A;  1Y44 A;  2M5C A;  2R2D A;  2WYM C;  2P97 A;  5A5Z A;  5ACP A;  2Q0I A;  5ACQ A;  4ZEJ A;  2I7T A;  2HB9 A;  5EH9 A;  2GKL A;  3X2X A;  4Z60 A;  3PY6 A;  2ZO4 A;  4FR7 A;  3SRX A;  5K0W A;  3DHA A;  5A0V A;  3IE0 A;  4Z5Y A;  4GCW A;  2BG8 A;  1KO3 A;  3LVZ A;  2Q0J A;  2BG8 B;  3KNS A;  1DXK A;  3BK1 A;  1VGN A;  4Z5Z A;  3KNR A;  4UA4 A;  2QED A;  3IOG A;  5K4M A;  5A87 A;  3IE2 A;  2BFZ A;  2FHX A;  2Y8A A;  5AXO A;  5IQK A;  2FHX B;  5DPX A;  4F6H A;  4C1D A;  1L9Y A;  2QIN A;  3BK2 A;  4UWS B;  4V0H A;  3S0Z A;  4AWZ A;  4UBQ A; 
#chains in the Genus database with same CATH topology
 2YNV A;  2YNU A;  2YNV B;  5AEB A;  4YSB A;  3R2U A;  4EXS A;  3DH8 A;  4UWO B;  1BC2 A;  1YCF A;  1WW1 A;  5HH4 A;  2NXA A;  1ZNB A;  4J5H A;  4H0D A;  4NQ6 A;  5LCA A;  3SPU A;  4RAM A;  3BC2 A;  1E5D A;  2CG2 A;  2BG6 A;  4Z7R A;  3RPC A;  4P62 A;  3T3N A;  2GCU A;  4GYU A;  2OHI A;  4LE6 A;  2AZ4 A;  2WYM A;  4NUR A;  4EYL A;  2FU9 A;  2CG3 A;  5ACW A;  3I14 A;  4AV7 A;  2BG2 A;  5EVB A;  3IEK A;  5LSC A;  4O98 A;  1XTO A;  4HL2 A;  3VPE A;  4EY2 A;  4XUK A;  4TYF A;  3IDZ A;  4J5F A;  5EW0 A;  3I15 A;  5ACR A;  3ZNB A;  4CHL A;  4PVT A;  1JJE A;  4D02 A;  5AXR A;  4ZO2 A;  3P2U A;  3AF6 A;  4RBS A;  1WUO A;  4PDX A;  1K07 A;  3FCZ A;  5HIO A;  5HH6 A;  5AYA A;  2H6A A;  4AWY B;  4C1F A;  4D1W A;  1BVT A;  5KIL A;  2ZWR A;  2NYP A;  3F9O A;  2GFJ A;  5HIQ A;  3DHC A;  4UWP B;  5LMC A;  2YNW A;  2BFK A;  4UAM A;  5LCF A;  1QH5 A;  4NQ4 A;  2WHG A;  5EV6 A;  5ACS A;  3IEM A;  1JJT A;  3PY5 A;  2Y87 A;  3RKK A;  3ZWF A;  2BFZ B;  2QDS A;  2GMN A;  4RL0 A;  1KR3 A;  5AHR A;  1ZTC A;  5FQC A;  3IE1 A;  2FM6 A;  3KL7 A;  3SBL A;  1DDK A;  5EVK A;  4TZE A;  3WXC A;  2YZ3 A;  1A8T A;  3ZQ4 A;  4U4L A;  1X8I A;  4RL2 A;  4Z6X A;  1JT1 A;  3ESH A;  5LLD A;  3I0V A;  5AIJ A;  3Q6V A;  3X30 A;  3L6N A;  3AJ3 A;  5K4N A;  2QDT A;  5EWA A;  2P4Z A;  4DIL A;  2Q42 A;  2OHH A;  5HH5 A;  2ZNB A;  2FU6 A;  4FSB A;  5ACU A;  4EYB A;  4C09 A;  1BMC A;  2BC2 A;  4AX1 B;  2DKF A;  2AIO A;  4NQ2 A;  2A7M A;  5K4K A;  3ADR A;  2FU8 A;  3AF5 A;  4TZB A;  1SML A;  5ACV A;  1YCH A;  3RKJ A;  4B87 A;  4C1G A;  4JO0 A;  4HKY A;  1HLK A;  4NQ5 A;  3I11 A;  2ZZI A;  4PVO A;  1VJN A;  2XR1 A;  4Z67 A;  2BIB A;  4XWW A;  4UWR B;  3JXP A;  2NZE A;  2BFL A;  5ACT A;  2P1E A;  5HIS A;  3DHB A;  2XF4 A;  2Q9U A;  3X2Z A;  4GYQ A;  4D1U A;  2Y8B A;  5B3R A;  4AD9 A;  5B15 A;  3X2Y A;  2CFZ A;  5KIK A;  4D1V A;  3BV6 A;  5AHO A;  3SD9 A;  3QH8 A;  5LS3 A;  3IEL A;  5EVD A;  3TP9 A;  1X8H A;  5LE1 A;  2BGA A;  1WUP A;  5A0T A;  4BP0 A;  4C1H A;  4RAW A;  5LM6 A;  2I7V A;  2I7X A;  4D1T A;  3VQZ A;  4TZ9 A;  2M5D A;  2BTN A;  4ZNB A;  5FQA A;  2FU7 A;  4BZ3 A;  5EV8 A;  2BG7 A;  2E7Y A;  1QH3 A;  4EYF A;  3FAI A;  4AX0 B;  4TZF A;  5HIP A;  5LCH A;  4TYT A;  2YNT A;  3PG4 A;  4C1E A;  1P9E A;  2YHE A;  2CFU A;  5B1U A;  2YNT B;  2VW8 A;  4F6Z A;  3IOF A;  4YSK A;  2YCB A;  5ACX A;  1YCG A;  1MQO A;  1DD6 A;  3SFP A;  4DIK A;  3G1P A;  1M2X A;  2FK6 A;  1XM8 A;  3H3E A;  1X8G A;  2BMI A;  4FEK A;  4ZO3 A;  3T9M A;  3ZR9 A;  1WRA A;  2CBN A;  4XWT A;  2BR6 A;  2GFK A;  3SW3 A;  4C1C A;  3A4Y A;  2QJS A;  2P18 A;  4WD6 A;  2NZF A;  2WYL A;  4KEQ A;  2DOO A;  1ZKP A;  3MD7 A;  2WRS A;  3I13 A;  4YSL A;  5EHT A;  1VME A;  4AXH A;  4HL1 A;  4RM5 A;  4EXY A;  5FQB A;  2OHJ A;  4EFZ A;  3T3O A;  1A7T A;  4KEP A;  1KO2 A;  2UYX A;  1Y44 A;  2M5C A;  2R2D A;  2WYM C;  2P97 A;  5A5Z A;  5ACP A;  2Q0I A;  5ACQ A;  4ZEJ A;  2I7T A;  2HB9 A;  5EH9 A;  2GKL A;  3X2X A;  4Z60 A;  3PY6 A;  2ZO4 A;  4FR7 A;  3SRX A;  5K0W A;  3DHA A;  5A0V A;  3IE0 A;  5AJL A;  4Z5Y A;  4GCW A;  2BG8 A;  1KO3 A;  3LVZ A;  2Q0J A;  2BG8 B;  3KNS A;  1DXK A;  3BK1 A;  1VGN A;  4Z5Z A;  3KNR A;  4UA4 A;  2QED A;  3IOG A;  5K4M A;  5A87 A;  3IE2 A;  2BFZ A;  2FHX A;  2Y8A A;  5AXO A;  5IQK A;  2FHX B;  5DPX A;  4F6H A;  4C1D A;  1L9Y A;  2QIN A;  3BK2 A;  4UWS B;  5A23 A;  4V0H A;  3S0Z A;  4AWZ A;  4UBQ A; 
#chains in the Genus database with same CATH homology
 2YNV A;  2YNU A;  2YNV B;  5AEB A;  4YSB A;  3R2U A;  4EXS A;  3DH8 A;  4UWO B;  1BC2 A;  1YCF A;  1WW1 A;  5HH4 A;  2NXA A;  1ZNB A;  4J5H A;  4H0D A;  4NQ6 A;  5LCA A;  3SPU A;  4RAM A;  3BC2 A;  1E5D A;  2BG6 A;  4Z7R A;  3RPC A;  4P62 A;  3T3N A;  2GCU A;  4GYU A;  2OHI A;  4LE6 A;  2AZ4 A;  2WYM A;  4EYL A;  2FU9 A;  5ACW A;  3I14 A;  2BG2 A;  5EVB A;  3IEK A;  5LSC A;  4O98 A;  1XTO A;  4HL2 A;  3VPE A;  4EY2 A;  4XUK A;  4TYF A;  3IDZ A;  4J5F A;  5EW0 A;  3I15 A;  5ACR A;  3ZNB A;  4CHL A;  4PVT A;  1JJE A;  4D02 A;  5AXR A;  4ZO2 A;  3P2U A;  3AF6 A;  4RBS A;  1WUO A;  1K07 A;  3FCZ A;  5HIO A;  5HH6 A;  5AYA A;  2H6A A;  4AWY B;  4C1F A;  4D1W A;  1BVT A;  5KIL A;  2ZWR A;  2NYP A;  3F9O A;  2GFJ A;  5HIQ A;  3DHC A;  4UWP B;  5LMC A;  2YNW A;  2BFK A;  4UAM A;  5LCF A;  1QH5 A;  4NQ4 A;  2WHG A;  5EV6 A;  5ACS A;  3IEM A;  1JJT A;  3PY5 A;  2Y87 A;  3RKK A;  3ZWF A;  2BFZ B;  2QDS A;  2GMN A;  4RL0 A;  1KR3 A;  5AHR A;  1ZTC A;  5FQC A;  3IE1 A;  2FM6 A;  3KL7 A;  3SBL A;  1DDK A;  5EVK A;  4TZE A;  3WXC A;  2YZ3 A;  1A8T A;  3ZQ4 A;  4U4L A;  1X8I A;  4RL2 A;  4Z6X A;  1JT1 A;  3ESH A;  5LLD A;  3I0V A;  3Q6V A;  3X30 A;  3L6N A;  3AJ3 A;  5K4N A;  2QDT A;  5EWA A;  2P4Z A;  4DIL A;  2Q42 A;  2OHH A;  5HH5 A;  2ZNB A;  2FU6 A;  4FSB A;  5ACU A;  4EYB A;  4C09 A;  1BMC A;  2BC2 A;  4AX1 B;  2DKF A;  2AIO A;  4NQ2 A;  2A7M A;  5K4K A;  3ADR A;  2FU8 A;  3AF5 A;  4TZB A;  1SML A;  5ACV A;  1YCH A;  3RKJ A;  4B87 A;  4C1G A;  4JO0 A;  4HKY A;  1HLK A;  4NQ5 A;  3I11 A;  2ZZI A;  4PVO A;  1VJN A;  2XR1 A;  4Z67 A;  2BIB A;  4XWW A;  4UWR B;  3JXP A;  2NZE A;  2BFL A;  5ACT A;  2P1E A;  5HIS A;  3DHB A;  2XF4 A;  2Q9U A;  3X2Z A;  4GYQ A;  4D1U A;  2Y8B A;  5B3R A;  4AD9 A;  5B15 A;  3X2Y A;  5KIK A;  4D1V A;  3BV6 A;  5AHO A;  3SD9 A;  3QH8 A;  5LS3 A;  3IEL A;  5EVD A;  3TP9 A;  1X8H A;  5LE1 A;  2BGA A;  1WUP A;  5A0T A;  4BP0 A;  4C1H A;  4RAW A;  5LM6 A;  2I7V A;  2I7X A;  4D1T A;  3VQZ A;  4TZ9 A;  2M5D A;  2BTN A;  4ZNB A;  5FQA A;  2FU7 A;  4BZ3 A;  5EV8 A;  2BG7 A;  2E7Y A;  1QH3 A;  4EYF A;  3FAI A;  4AX0 B;  4TZF A;  5HIP A;  5LCH A;  4TYT A;  2YNT A;  3PG4 A;  4C1E A;  1P9E A;  5B1U A;  2YNT B;  2VW8 A;  4F6Z A;  3IOF A;  4YSK A;  2YCB A;  5ACX A;  1YCG A;  1MQO A;  1DD6 A;  4DIK A;  3SFP A;  3G1P A;  1M2X A;  2FK6 A;  1XM8 A;  3H3E A;  1X8G A;  2BMI A;  4FEK A;  4ZO3 A;  3T9M A;  3ZR9 A;  1WRA A;  2CBN A;  4XWT A;  2BR6 A;  2GFK A;  3SW3 A;  4C1C A;  3A4Y A;  2QJS A;  2P18 A;  4WD6 A;  2NZF A;  2WYL A;  4KEQ A;  2DOO A;  1ZKP A;  3MD7 A;  2WRS A;  3I13 A;  4YSL A;  5EHT A;  1VME A;  4HL1 A;  4RM5 A;  4EXY A;  5FQB A;  2OHJ A;  4EFZ A;  3T3O A;  1A7T A;  4KEP A;  1KO2 A;  2UYX A;  1Y44 A;  2M5C A;  2R2D A;  2WYM C;  2P97 A;  5A5Z A;  5ACP A;  2Q0I A;  5ACQ A;  4ZEJ A;  2I7T A;  2HB9 A;  5EH9 A;  2GKL A;  3X2X A;  4Z60 A;  3PY6 A;  2ZO4 A;  4FR7 A;  3SRX A;  5K0W A;  3DHA A;  5A0V A;  3IE0 A;  4Z5Y A;  4GCW A;  2BG8 A;  1KO3 A;  3LVZ A;  2Q0J A;  2BG8 B;  3KNS A;  1DXK A;  3BK1 A;  1VGN A;  4Z5Z A;  3KNR A;  4UA4 A;  2QED A;  3IOG A;  5K4M A;  5A87 A;  3IE2 A;  2BFZ A;  2FHX A;  2Y8A A;  5AXO A;  5IQK A;  2FHX B;  5DPX A;  4F6H A;  4C1D A;  1L9Y A;  2QIN A;  3BK2 A;  4UWS B;  4V0H A;  3S0Z A;  4AWZ A;  4UBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...