2FHYA

Structure of human liver fpbase complexed with a novel benzoxazole as allosteric inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
326
structure length
317
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Benzoxazole benzenesulfonamides are novel allosteric inhibitors of fructose-1,6-bisphosphatase with a distinct binding mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 98
structure length 317
sequence length 326
chains with identical sequence D, H, L
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2fhyA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2fhyA02
1IMCA 1IMDA 1YYZA 2BJIA 4G61A 3BIHA 2Y5LA 5IZ1A 5T3JA 2P3VA 4HE0A 5ET7A 1FBHA 2QFLA 1EYKA 1G0HA 2QVRA 1RDZA 2JJKA 3IFAA 4IR8A 4FBPA 4O7IA 1FPGA 1NV2A 2Y5KA 3RYDA 2P3NA 1FBFA 4I40A 1NV1A 1EYIA 2QVUA 1DCUA 1FJ9A 4GX6A 4I3YA 1K9YA 1FBGA 5EYHA 3B8BA 1FBPA 3KC1A 4GX4A 5LDZA 1FSAA 1IMFA 1EYJA 5FBPA 1FPKA 1LBVA 4GBVA 1YXIA 1NV7A 2QVVA 1LBYA 1KA1A 4AS5A 5J16A 1DK4A 1JP4A 1NV6A 2F3BA 2F3DA 3BIGA 2WBBA 1QGXA 4HXVA 1D9QA 1NUYA 1FBDA 5DW8A 4GWZA 1VDWA 1NV4A 2Q74A 2Q8MA 1AWBA 1IMEA 2GQ1A 4GWUA 3D1RA 5I3SA 2HHMA 3IFCA 2R8TA 1FRPA 1FPIA 2OX3A 3KBZA 1SPIA 4KXPA 2CZHA 2DDKA 1YZ0A 1FPBA 5A5LA 1FTAA 1FPJA 3LUZA 1FPLA 2CZKA 1INPA 1FPDA 2FHYA 2WEFA 5ET8A 1XI6A 4GWSA 3QMFA 1FBCA 1FJ6A 1CNQA 4I3EA 2WBDA 1IMAA 1FPEA 4PTKA 1LBWA 4MJOA 1NV0A 5EQAA 5IZ3A 1G0IA 4GX3A 4GWYA 1FPFA 1LEVA 2FIEA 4GWXA 5IZ3B 4GBWA 1LBXA 4AS4A 5ESYA 5EQ9A 1NV5A 1NUXA 2CZIA 3FBPA 4QXDA 1NUZA 1LBZA 1KZ8A 1KA0A 1K9ZA 5F24A 3A29A 2OWZA 4H46A 4H45A 5ET5A 3RPLA 3KC0A 5EQ7A 4GWWA 1NI9A 1DBZA 5EQ8A 1IMBA 2FBPA 1NV3A 4HE2A 4N81A 5ET6A 3RPLB 1BK4A 3T0JA 2FIXA 5EYGA 2VT5A 4HE1A 1RDYA 1FBEA 1NUWA 3LV0A 1RDXA 2PCRA 3ROJA 1Q9DA 2FVZA
chains in the Genus database with same CATH superfamily
1YYZA 4JXIA 5IM2A 4G61A 2PFZA 4AB5A 4YKPA 2HXWA 2P3VA 4RJZA 1EH3A 3TZAA 4L17A 1JVYA 1SYHA 3K4UA 3OSQA 1GGGA 1LGBC 2I49A 1IXGA 3THIA 4PC9A 4QF9A 4O3AA 2DVCA 4G2ZA 1MQJA 4MFIA 3MJNA 4FAJA 1OQHA 2O51A 2W7YA 3FGSA 4WKMA 1US5A 4PFYA 5DEXB 4PFRA 1NV6A 4LATA 2DSFA 4H8IA 3VFJA 1NUYA 1B7ZA 2V4CA 3H6TA 3GYYA 4K3FA 3IOTA 4U21A 3LUYA 3B50A 1O64A 4LQ2A 4PFUA 1A99A 1JW5A 1OQGA 4Q0CA 2A5TA 3TTRA 4KI0E 4OEUA 4QHQA 3CG1A 4F3GA 2FHYA 3UGWA 1XI6A 4GWSA 1FQFA 2ANJA 3H7MA 3RY3A 4F2OA 4QFPA 1IMAA 3ILTB 2P2AA 4GWYA 3E9XA 4NWCA 3IL1B 4JSDA 4LZ5A 3HV1A 3IOUA 3O6HA 4G8HA 3VXCA 4FECA 4BDLA 5I58A 2QS2A 3QUJA 4ZEKA 5ET6A 4OTEA 5CMBA 4JVCA 4MX6A 1SD3A 3FV2A 1PEBA 3E4RA 2DOJA 1UTHB 4H65A 4F18A 2O1LA 5I2NB 4X8RA 5LTCA 4ZEDA 3RN8A 3ISPA 1B5HA 3TAJA 2V3TA 3MSTA 3PUYE 4YZZA 3MVZA 2HXRA 1P1NA 3U65A 4NN3A 1YTVA 4OESA 4R9FA 3LSFB 1VR5A 1HSJA 2PFYA 2XXKA 2DWIA 2F3DA 3FXQA 3RTFB 1URSA 2Q74A 1LB8A 3K01A 1M5BA 3HN0A 4PDDA 1UQWA 5I3SA 4F1YA 3TTLA 2IA4A 1FRPA 4O94A 4DCYA 4OVPA 2Q2CA 4F3PA 2GH9A 4BDOA 3LSXA 1XVYA 5KDTA 2R71A 2GFEA 4PGNA 1FPLA 1M5EA 1GVCA 1MXUA 5H8FA 2AL5A 4F3SA 1FBCA 3JV9A 3K6VA 4DLDA 5F1QA 2ALUA 4PTKA 4MMPA 2P0SA 1FTMA 3RPWA 1D9YA 4R75A 1B5JA 3CVGA 2DS9A 3KBRA 4XKPA 3FASA 1H44A 3FJ7A 4KYEA 3IO6A 3SKPA 5M2VA 4QFLA 5CMCA 3GBBA 1BK4A 1IXHA 4PQJA 1DMBA 3MZBA 1RDYA 4FEDA 4BDRA 5HPQA 4QFKA 2Z22A 3R6UA 2Y5LA 2ZNUA 1MPDA 4GL8A 2RC9A 2Z8DA 2F7BA 2Z23A 1M5DA 4TLLB 5KCJA 2THIA 1VFDA 4NX1A 1UTBA 4Q8RA 2UXAA 4MEVA 2D5WA 3SEXA 2DE3A 3M3FA 3BFUA 4PFBA 3MYUA 5K2XA 3V89B 5AA3A 5I57B 5EYHA 1I6BA 5H8QB 3RGYA 4TOZA 2DVZA 4OFOA 3PPPA 4GF8A 1Q1KA 4JWOA 3T9XB 3FATA 3V8XB 3VE1B 4OZ9A 1MY3A 1NV4A 4OFJA 2WKYA 2QPQA 5F7VA 2D21A 1P1UA 4OEVA 3EHUA 4F31B 3IB0A 2F6PA 3G3JA 4P0IA 4P56A 3C4MA 4LQ5A 4JVDA 2DE2A 5H8HB 1LBWA 3LBSA 4IGTA 3CFXA 4ND9A 1OMPA 2QS4A 2XXTA 3PUZE 3QK6A 4MF3A 4R74A 3MC2A 4YU0A 1S7YA 1Y9UA 2IEEA 3IOVA 4R72A 5CI5A 4P11A 1NI9A 5FHOA 1DBZA 2ABHA 2HPGA 4EDPA 1O63A 2ZYMA 1RDXA 4OVSA 5ISUA 4DCXA 1AIVA 1ZKBA 1DTGA 3OXNA 4EF2A 3K6WA 2ZZVA 2HQ0A 1I6QA 1MH4A 1XVXA 2FA7A 1DPEA 1MY0A 1URDA 3ZSFA 5CRYA 1TFDA 3QAXA 3B8BA 3RT6B 4R6KA 1TWYA 1MH3A 4QSEA 4IY5A 3OENA 2YPNA 4P1EA 4GRKA 1LAFE 4XKRA 4N13A 1NMUA 2XXYA 1SI1A 2F6GA 1GV8A 2H9BA 4PE5B 4N4UA 5I56B 3G3GA 4QSDA 5ELVA 1IZ1A 2DXRA 1ELJA 4OANA 2V84A 1SW2A 3SEUA 2DDKA 1P1WA 4OWDA 1B3GA 4R9GA 3TODA 2I4CA 1N3XA 4Q30B 1LFIA 5ICTA 1WODA 4XTCQ 5JTYB 2WBDA 1FPEA 2VPOA 1UTHA 1MDQA 4P1LA 4GX3A 4H8JA 1JEVA 1ZBMA 1PB8A 4N8GA 2OK2A 3MWBA 4YKKA 3CSBA 2ONRA 1DSNA 2RINA 4XIGQ 4X04A 2KR0A 4N81A 3V5AA 3KGCA 4N91A 2Y84A 1R6ZA 4FJPA 3MZ1A 3MAMA 2CZLA 4M4GA 3TCGA 3OO9A 3TCFA 3B6TA 3MP8A 1WDNA 1YAEA 3T66A 1SW4A 1JW4A 4IO3A 1QVSA 5TPAA 1NNTA 4IY6A 4OVRA 3QXMA 1FPGA 1FBFA 4MH5A 4H5FA 1H3DA 1MXZA 2YLNA 4LUBA 1FQEA 2Y7PA 1QKBA 2Q89A 4F29A 5FBPA 1NV7A 3B6QA 2FNCA 5L9OA 1IQ7A 1QGXA 2I3WA 1ATGA 1BLFA 4NF0A 4P9KA 4ZZEA 1B5IA 4ZS9A 3MPLA 4PCDA 2R8TA 3FJGA 5IKBA 3FVNA 1M5CA 5A5XB 3PV0E 2ZNSA 5CC2A 1AH5A 5HM4B 4JDFA 4UA8A 2NWJA 4GWOA 2HZLA 3QYTA 3WAFA 3U72A 1FJ6A 3ILUB 4N8YA 2UYEA 1ZMGA 2CEXA 4KD5A 4NF8B 3VDFA 1LB9A 2Q9TA 5IZ3B 1YPNA 2MKZA 2DQVA 3KEIA 4U4SA 1FQBA 3FV1A 3LSWA 1Y3QA 2PT1A 1LAGE 1Y4TA 2B3FA 3G3FA 3RPLB 2CEYA 4GOTA 3ROJA 3K6XA 1FW0A 2BJIA 2ZMBA 5L8DA 4GIZA 3O28A 4H6DA 3PMWA 2PMSA 3C36A 1FTJA 1MM6A 4H5GA 1B1XA 1D9VA 1QW0A 2V3QA 3FUZA 3Q25A 4IO6A 3CSGA 4I40A 2RKMA 2QVUA 3ECRA 3K2DA 3KFMA 5AA2A 3I3VA 5I2KB 3MUQA 1NNKA 5HBCA 2QL3A 1FBPA 3RLFE 1FSAA 1IITA 3LR1A 2REJA 4EQBA 2DXYA 2NUVA 2WX9A 4AS5A 3K1PA 3MBPA 3N94A 2O7IA 2XXUA 2Q8MA 5H8HA 2QMXA 5AA1A 1DTZA 2DWJA 1SPIA 1A8FA 4NHBA 4PAFA 3RQTA 5AA4A 2QS1A 3T9VA 2VHAA 5TP9B 4NF4B 5ICQA 4F19A 1NNPA 1Y20A 4X48A 1BTJA 3H6UA 1B0LA 1RYOA 2QSXA 4JWXA 2HEUA 3FZVA 3L6HA 2CZIA 1J1NA 1KA0A 2DE4A 1S9TA 4HCWA 4NAPA 3O2AA 3G3HA 3DM0A 5I59A 2FIXA 2Q8JA 2I58A 4U1ZA 4LZ8A 3LV0A 3EQ1A 4E0XA 1B7UA 1N76A 5DVFA 3BIHA 4KCDA 4XKNA 1USYH 2KLFA 2I4BA 3C33A 4QFOA 2I6EA 1RDZA 2JJKA 4IGRA 4LN5A 3E3KA 1B58A 3USDA 2HFBA 1FJ9A 3SDFA 4BDQA 4G4PA 4NF5B 3OEKA 3KG2A 1USYE 2B4LA 3BIGA 4HXVA 3M3LA 4MLVA 3G3KA 3GXAA 4U2RA 1CB6A 3Q26A 3A3CA 1B4HA 3PD8A 2WYKA 4RY1A 1MY1A 5IGAA 1HSEA 4DI3D 2CZHA 1CE2A 3Q27A 3TFLA 1LCFA 1YZ0A 1PDAA 3KN3A 1FTAA 2H25A 4DI4B 1INPA 2XXVA 4NEDA 3B7DA 2HAUA 1HSLA 3IB2A 3VLUA 2BJJX 3CI8A 5BWJA 1NH8A 1FTKA 1AL3A 3OEMA 5EQAA 1MQHA 2F34A 3FXBA 1A55A 3KSXA 4AS4A 5ESYA 4NTLA 1B3HA 4ZEBA 4AQ4A 5F24A 4EXKA 2OWZA 1JVXA 4JVIA 3CR9A 4LP2B 2ZXTA 1LAXA 1MQGA 5DVJA 2M8CA 2X26A 2VT5A 4YMBA 4HE1A 4PAKA 4YKJA 1SDXA 1P1QA 1IMDA 3TTNA 3W15C 4H1XA 4ZDMA 3O6GA 4GD5A 3TDJA 3AXFA 3FD3A 4R73A 1O7TA 3UK4A 2VP1A 4IR8A 5B70A 1EYIA 3HFUA 1MM7A 4ZE9A 3B6WA 5DTBA 1BKAA 2RC7A 2B3BA 3BKIB 3LSLA 3C31A 4GX4A 5LDZA 4DIGA 1YXIA 3PPNA 1MXVA 1KA1A 3PU5A 4THIA 1Y4CA 2XX8A 1JEUA 1N04A 5KZTA 4GWZA 4DXCA 1D3KA 2PVUA 3SERA 3PUVE 4N17A 3D1RA 1MRPA 5B7DA 4KR5A 2V3UA 3KOTA 2DP8A 2OX3A 4YB5A 4MCOA 4AB6A 3MW0A 1H76A 2WEFA 3PPRA 3IR1A 3UORA 1GTKA 3I5OA 4G68B 4I9DA 2FYIA 3DLNA 4POXA 3TYHA 3A09A 4GWXA 1A8EA 3GZGA 2HCAA 3PTYA 1OLCA 5ET5A 3K02A 4HCYA 1PC3A 4N6PA 4ZE8A 3SEVA 3U8QA 3ODBA 4KHZE 2R9JA 4DXBA 1QKAA 4FORA 3T22A 2F97A 1B52A 4POWA 2KQZA 1US4A 2PYYA 1POY1 3FXUA 4EUOA 4DDDA 2Z8EA 1EYKA 1Y1ZA 3SZPA 1L5TA 2P3NA 1SBPA 1BP5A 2O84X 1SW5A 4NGUA 3IX1A 2UVGA 3JYRA 1MY2A 1OVBA 1DOTA 5DEXA 3IJXB 3A3UA 4OVTA 2XXIA 5TP9A 4R2FA 4NF4A 2OBGA 1H43A 4IO7A 1IMEA 4NF6B 2ONKE 2LAOA 3O9PA 3OO6A 5JEIA 1MG1A 4F39A 1FPIA 2V93A 2OCUA 3IAZA 3KBZA 2HAVA 1TXFA 1FPBA 2A5TB 2F36A 2GHAA 4N6DA 2DWAA 2O69A 3OSRA 4PFWA 4KYSA 3DELB 4U22A 4YB6A 3TMGA 1P1OA 1MS7A 4F2QA 1IXCA 5DVIA 3RNNA 1B1HA 1KZ8A 4PBHA 1B2HA 4RPOA 3O6IA 1MY4A 3H4ZA 3KC0A 3Q28A 3VVFA 1IMBA 4H0WA 1NV3A 5IZZA 1SI0A 3VXBA 1VE4A 3FXRA 1QULA 1MQIA 1MPBA 2Q2AA 3PUXE 5I2NA 5IZ1A 1R9LA 3CHGA 3TQLA 4ESWA 2XWKA 1QJMA 1PBPA 2QVRA 3IFAA 4FBPA 3C34A 3H6VA 4IO4A 4RNSA 1EU8A 2XX9A 2R6GE 3KJ7A 1JETA 3QSLA 2AYSA 3N6TA 4H67A 4R6HA 3ZS6A 4RA1A 4OA4A 1LBYA 3LC8A 3TELA 5J16A 4FIMA 2Y7RA 2QS3A 4UACA 3EPEA 1XHYA 2HHMA 5L9MA 4ZEFA 2G29A 3RT8A 2OWTA 1B3LA 3FJMA 1FPJA 5KDTB 3S9NC 1ZJLA 3E13X 1QUKA 5H8FB 4EQ9A 4DZ1A 1B9JA 4FATA 4MIJA 4PETA 4E0WA 2XXPA 4MJOA 4RK2A 3MPKA 1IXIA 4QRZA 4UABA 3KJTA 3VVEA 2O7UA 4GBWA 4NE4A 4PE3A 2PBWA 4G77A 1NV5A 3QUFA 2UYFA 1NUZA 4PF6A 1LBCA 1K9ZA 4PP0A 1Z7NE 2F78A 4NWDA 4G68C 1EZ9A 3T9UA 5ITOA 1SVXB 3NOHA 1T0KA 4R6YA 2O1MA 1FCKA 1Y3PA 3MQ9A 2FVZA 1B3EA 2E1SA 2REGA 1I6AA 4HE0A 1POTA 2RF1A 1FBHA 3KN8A 1UIVA 5KCJB 4O7MA 1R9QA 2GHBA 1AMFA 1UTBB 1A7LA 5I57A 4XXUA 3BBRA 2OPDA 4OHNA 3FVKA 5H8QA 1M5FA 4NG7A 3K1NA 1MDP1 1LBVA 3GLBA 2VGQA 2F7AA 5DW8A 2A5SA 1PBQA 1VFEA 2E0SA 4DE8A 4GQOA 1N84A 2X7QA 2DWHA 2I0BA 4PFIA 4XKQA 4KXPA 1OIBA 3K0VA 2UVIA 4O3BA 2XWOA 4OENA 4I1DA 1NH7A 5ET8A 4GLIA 3S2VA 3TCHA 3H3GA 4I3EA 2OJTA 4ECFA 4ELPA 5FTHA 3U93A 4OVJA 2ZYKA 1B46A 4GFRA 4IO2A 4OYVA 5AA2D 2VD2A 1LCTA 1B7HA 4RK9A 2F35A 3PUWE 1MQDA 1R1NA 5FTIA 2I0CA 2UVHA 1YCJA 4H45A 3CIJA 5CMMA 3G3IA 2PCRA 1Q9DA 4G8MA 4XFEA 2X7PA 4XEQA 3MP1A 4OVQA 5ET7A 2H99A 3O66A 4U23A 1IIWA 1XS5A 3R26A 1KWHA 4NF6A 4O3CA 1B32A 5CMKA 3HCQA 2PT2A 1NV1A 1DCUA 3ZKLA 3ZKKA 4GXSB 4N6KA 2QVVA 3TTMA 4FEBA 5EHSA 4JBZA 5DT6A 5I7IA 1LFGA 3QIMA 2O68A 1FBDA 3D4GA 1A40A 1A54A 3PMVA 1Q35A 4KYDA 5I56A 5H8NB 4JSOA 4QBAA 4EF1A 4RXLA 1XOCA 3N26A 4YKIA 4MBPA 1RYXA 3CFLA 4LZ7A 3SEYA 3V83A 1P99A 4LONB 1ZLQA 1NFTA 2Y7IA 3P7IA 5JTYA 1CNQA 3K1MA 3MP6A 1LBBA 2Y7WA 1DPPA 3OO8A 1FPFA 4MHFA 1LEVA 4ZECA 4ZEIA 5CBSA 1NUXA 5DYHA 4I62A 3S9EA 4U1OA 1B40A 1B51A 2B65A 4HE2A 3HPIA 5ITPA 5AE4A 4TQUQ 1FBEA 2VPNA 2XWIA 5I84A 3L6GA 2QJEA 1JQFA 4PF8A 2ZNTA 5TPAB 4LA9A 1JW1A 3K00A 2XXQA 1Z7ME 1F9BA 4Z7EA 3TEPA 1TFAA 1TT1A 1N0TA 2OWSA 4F1UA 4M1VA 4OXVA 5BUUA 4P3LA 4PAIA 4RPNA 4BDMA 4C1UA 3O29A 2NVUB 1FPKA 3MVWA 2OPEA 4KPTA 2YJPA 3C35A 4MNIA 3S9LC 1DK4A 3E79A 1IEJA 2CMOA 1N3WA 4MNCA 3WAEA 2VOZA 3M8UA 1VDWA 4Q5TA 2H98A 2XXRA 3HSTA 4YAHX 1QUJA 1LFHA 2AIXA 4GVOA 4ISUA 4N07A 3IFCA 4NMYA 3PGFA 5A5XA 2L5VA 1B6HA 1II5A 2XA5A 2GRVA 3UP9A 1ZU0A 3FVGA 3OOAA 5EHMA 1FPDA 3TQWA 1IUDA 2ZZWA 5H8SA 1MXXA 5L9SA 5LOMA 2V25A 3EHSA 4NF8A 3GBAA 3DP8A 4OERA 5IZ3A 4PDHA 3HO7A 2HZKA 1LBXA 4YB7A 3HHGA 4EQ7A 4BLAA 1LBZA 2QMWA 2F8DA 3E78A 2H5YA 1SQYA 3RPLA 1N7WA 4HTGA 3Q29A 3CRBA 3T0JA 3UA8A 1MPCA 1ZIUA 4JWYA 1FQDA 1FTLA 4HW8A 3MVXA 3T96B 3PMXA 5T3JA 4ONYA 2NOOA 4ESXA 3DP6A 1RKMA 2ESNA 1OVTA 4PFTA 3TUSA 3H06B 1Y1MA 4IO5A 1B3FA 3KSJA 1MXYA 1D4NA 2XHDA 3VLVA 4O7IA 1NV2A 3U94A 1NKXA 1XC1A 3RUMA 5I2KA 4GX6A 3CG3A 5AA2B 3EF7A 2ZZXA 1EYJA 2ZYOA 3IOWA 2XX7A 3S4UA 2F3BA 2WBBA 1FTOA 2F5XA 4OQOA 2F7CA 3D4CA 2Y7KA 1AWBA 3SETA 4HS7A 4WXJA 3VLWA 4YMAA 3U1OA 4PGPA 2RCBA 3VV5A 2D3IA 2UVJA 5AA4B 4YICA 1URGA 4F3BA 1B0HA 4OETA 4P8BA 1MXWA 1AOVA 3EKIA 3EHTA 1Y3NA 1NV0A 1G0IA 1LSTA 3HHFA 2FIEA 4QFNA 3T93B 4ZZAA 3M3KA 3PPQA 3EN3A 4I8CA 2DYXA 4H46A 1FQAA 2OLBA 3C9HA 5FHMA 3G7WA 3OELA 5EQ8A 4ELQA 3OD7A 1JNFA 1FQCA 4C1TA 5I59B 3VVDA 1NNFA 2B4MA 3N5LA 2H4IA 4WEPA 4JB7A 2QFLA 1B05A 2Q88A 5H8NA 4KQPA 4RYAA 5I58B 2ZYNA 3TKDA 3O97A 4NF5A 4I3YA 1FBGA 2PX1A 3KZGA 3T1BA 1XT8A 3KC1A 3OMBA 4OMBA 4GBVA 5K2YA 3K6UA 1OLAA 2Z8FA 3UN6A 3I6VA 3PD9A 2QRYA 4C0RA 3U92A 4P0GA 3H6WA 4P47A 3UIFA 3MVYA 4MNPA 3IORA 4MAGA 1SYIA 5FHNA 3KOSA 1UIUA 3W9VA 4KCCA 3QMFA 4LVQA 3RTWB 3H03A 4DXUA 5JK4A 2P1SA 2O6AA 3W9WA 2AL4A 2XXWA 1WVJA 2G93A 3IO4A 2RCAA 3S9MC 4TLMB 3SEWA 3ONMA 5EQ9A 4OFLA 4FE8A 4BDNA 3FBPA 4QXDA 4NQ8A 4X1BA 2XD2A 3R7XA 2RC8A 3PPOA 1QUIA 4PBQA 5J1DA 3A29A 5I5PA 5EQ7A 4GWWA 1N7XA 3C32A 2FBPA 5CM6A 3TPAA 1H45A 4GL0A 4XF5A 1NUWA 1EZOA 4G8NA 1IMCA 3DP4A 4KFQA 2XWVA 3IK6B 3SESA 1GR2A 5CBRA 4MLQA 1G0HA 4U4XA 2Y5KA 3RYDA 4WEDA 1BIYA 2I3VA 1LAHE 1K9YA 4X1DA 2XD3A 3IJOB 4R2BA 4Z0IA 3F11A 4ELOA 4EXLA 3N6UA 1IMFA 5EYFA 3T9HB 4O8MA 1B4ZA 2OZZA 1JP4A 1D9QA 2WYPA 1LLSA 3TTKA 4X9TA 4ELRA 2GQ1A 4GWUA 1ZTYA 3FVOA 5TU0A 3KN7A 4F1VA 1NL5A 1ANFA 3FIRA 2NXOA 1PB7A 1VSOA 5A5LA 3LUZA 3JZJA 2CZKA 4F22A 4G68A 2VD3A 1I69A 1S50A 2XXXA 3CFZA 2ONSA 4IB2A 1EZPA 5IAIA 1PB9A 3IB1A 1SW1A 3BFTA 5EYGA 4QSCA 2I48A 4GXAA 3OO7A 2XXHA 4N15A 3MZ9A
chains in the Genus database with same CATH topology
1YYZA 5IM2A 4G61A 2PFZA 2KQZA 2P3VA 1EYKA 4PF8A 4PC9A 4OVRA 3SZPA 1FPGA 2P3NA 1FBFA 4F1UA 4M1VA 4NGUA 4P3LA 4PAIA 5FBPA 1FPKA 1NV7A 4MNIA 4PFRA 1DK4A 4OVTA 1NV6A 3E79A 1QGXA 1NUYA 4MNCA 2V4CA 1VDWA 4NF0A 4P9KA 3GYYA 1IMEA 3B50A 4PCDA 3IFCA 2R8TA 1FPIA 2L5VA 3KBZA 2XA5A 1FPBA 2HZLA 4N6DA 1FPDA 2FHYA 1XI6A 4GWSA 2ZZWA 1FJ6A 4N8YA 1IMAA 2CEXA 5IZ3A 4PDHA 4GWYA 2HZKA 2Q9TA 5IZ3B 1LBXA 2MKZA 1LBZA 1KZ8A 4PBHA 3E78A 3RPLA 3KC0A 1IMBA 3RPLB 1NV3A 5ET6A 2CEYA 3T0JA 5IZZA 4JVCA 4MX6A 3ROJA 4F18A 2BJIA 5IZ1A 5T3JA 3CHGA 4X8RA 5LTCA 2XWKA 2QVRA 3IFAA 2V3QA 4FBPA 3ISPA 4O7IA 1NV2A 3MSTA 4I40A 4YZZA 2QVUA 4GX6A 2HXRA 3U65A 4NN3A 1FBPA 2ZZXA 1FSAA 1EYJA 4OA4A 1LBYA 2PFYA 2WX9A 2XXKA 4AS5A 5J16A 2F3BA 2F3DA 2WBBA 2F5XA 2Q74A 2Q8MA 1AWBA 4PDDA 5I3SA 2HHMA 1FRPA 4O94A 4PGPA 4OVPA 1SPIA 4NHBA 4PAFA 4PGNA 1FPJA 1FPLA 4YICA 1FBCA 4P8BA 4F19A 3EKIA 4PTKA 4MIJA 4MMPA 4PETA 4MJOA 1NV0A 4UABA 1G0IA 2FIEA 4GBWA 4PE3A 1NV5A 2CZIA 1NUZA 4PF6A 1KA0A 2DE4A 1K9ZA 4HCWA 4H46A 4NAPA 5EQ8A 1BK4A 2FIXA 1RDYA 3NOHA 3LV0A 2B4MA 2Y5LA 2FVZA 3BIHA 4HE0A 1FBHA 2QFLA 4NX1A 1RDZA 2JJKA 4O7MA 4LN5A 4MEVA 2DE3A 4PFBA 3MYUA 1FJ9A 4I3YA 1FBGA 3T1BA 5EYHA 4NG7A 3KC1A 1LBVA 4GBVA 2DVZA 2B4LA 3BIGA 4HXVA 5DW8A 1NV4A 2QPQA 2WYKA 4PFIA 5IGAA 4DI3D 4KXPA 2CZHA 4P47A 4MNPA 2XWOA 1YZ0A 1FTAA 4MAGA 4DI4B 3W9VA 1INPA 5ET8A 3QMFA 4I3EA 5JK4A 4P56A 4JVDA 3W9WA 2DE2A 1LBWA 5EQAA 3FXBA 4AS4A 5ESYA 5EQ9A 3FBPA 4QXDA 4NQ8A 5F24A 4PBQA 5J1DA 3A29A 2OWZA 4H45A 4JVIA 5I5PA 5EQ7A 4GWWA 1NI9A 1DBZA 2FBPA 2HPGA 5CM6A 2VT5A 4HE1A 4XF5A 4PAKA 1NUWA 1RDXA 2PCRA 4OVSA 1Q9DA 1IMCA 1IMDA 4XFEA 4XEQA 4OVQA 5ET7A 2XWVA 2ZZVA 1G0HA 4IR8A 2Y5KA 3RYDA 1NV1A 1EYIA 1DCUA 3HFUA 1K9YA 3B8BA 4GX4A 5LDZA 1IMFA 1YXIA 4N6KA 2QVVA 4O8MA 1KA1A 4P1EA 1JP4A 1D9QA 5I7IA 1FBDA 2WYPA 4GWZA 4X9TA 4N17A 2GQ1A 4GWUA 4N4UA 3D1RA 4QBAA 4F1VA 4OANA 2OX3A 2DDKA 4MCOA 5A5LA 3LUZA 2CZKA 2WEFA 1CNQA 2WBDA 1FPEA 2VPOA 4P1LA 4GX3A 4MHFA 1FPFA 1LEVA 4GWXA 1NUXA 4N8GA 3PTYA 5ET5A 4HCYA 4X04A 2KR0A 4HE2A 4N81A 4N91A 5EYGA 1FBEA 2VPNA 2XWIA 4N15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IMC A;  1IMD A;  1YYZ A;  2BJI A;  4G61 A;  3BIH A;  2Y5L A;  5IZ1 A;  5T3J A;  2P3V A;  4HE0 A;  5ET7 A;  1FBH A;  2QFL A;  1EYK A;  1G0H A;  2QVR A;  1RDZ A;  2JJK A;  3IFA A;  4IR8 A;  4FBP A;  4O7I A;  1FPG A;  1NV2 A;  2Y5K A;  3RYD A;  2P3N A;  1FBF A;  4I40 A;  1NV1 A;  1EYI A;  2QVU A;  1DCU A;  1FJ9 A;  4GX6 A;  4I3Y A;  1K9Y A;  1FBG A;  5EYH A;  3B8B A;  1FBP A;  3KC1 A;  4GX4 A;  5LDZ A;  1FSA A;  1IMF A;  1EYJ A;  5FBP A;  1FPK A;  1LBV A;  4GBV A;  1YXI A;  1NV7 A;  2QVV A;  1LBY A;  1KA1 A;  4AS5 A;  5J16 A;  1DK4 A;  1JP4 A;  1NV6 A;  2F3B A;  2F3D A;  3BIG A;  2WBB A;  1QGX A;  4HXV A;  1D9Q A;  1NUY A;  1FBD A;  5DW8 A;  4GWZ A;  1VDW A;  1NV4 A;  2Q74 A;  2Q8M A;  1AWB A;  1IME A;  2GQ1 A;  4GWU A;  3D1R A;  5I3S A;  2HHM A;  3IFC A;  2R8T A;  1FRP A;  1FPI A;  2OX3 A;  3KBZ A;  1SPI A;  4KXP A;  2CZH A;  2DDK A;  1YZ0 A;  1FPB A;  5A5L A;  1FTA A;  1FPJ A;  3LUZ A;  1FPL A;  2CZK A;  1INP A;  1FPD A;  2FHY A;  2WEF A;  5ET8 A;  1XI6 A;  4GWS A;  3QMF A;  1FBC A;  1FJ6 A;  1CNQ A;  4I3E A;  2WBD A;  1IMA A;  1FPE A;  4PTK A;  1LBW A;  4MJO A;  1NV0 A;  5EQA A;  5IZ3 A;  1G0I A;  4GX3 A;  4GWY A;  1FPF A;  1LEV A;  2FIE A;  4GWX A;  5IZ3 B;  4GBW A;  1LBX A;  4AS4 A;  5ESY A;  5EQ9 A;  1NV5 A;  1NUX A;  2CZI A;  3FBP A;  4QXD A;  1NUZ A;  1LBZ A;  1KZ8 A;  1KA0 A;  1K9Z A;  5F24 A;  3A29 A;  2OWZ A;  4H46 A;  4H45 A;  5ET5 A;  3RPL A;  3KC0 A;  5EQ7 A;  4GWW A;  1NI9 A;  1DBZ A;  5EQ8 A;  1IMB A;  2FBP A;  1NV3 A;  4HE2 A;  4N81 A;  5ET6 A;  3RPL B;  1BK4 A;  3T0J A;  2FIX A;  5EYG A;  2VT5 A;  4HE1 A;  1RDY A;  1FBE A;  1NUW A;  3LV0 A;  1RDX A;  2PCR A;  3ROJ A;  1Q9D A;  2FVZ A; 
#chains in the Genus database with same CATH topology
 1YYZ A;  4JXI A;  5IM2 A;  4G61 A;  2PFZ A;  4AB5 A;  4YKP A;  2HXW A;  2P3V A;  4RJZ A;  1EH3 A;  3TZA A;  4L17 A;  1JVY A;  1SYH A;  3K4U A;  3OSQ A;  1GGG A;  1LGB C;  2I49 A;  1IXG A;  3THI A;  4PC9 A;  4QF9 A;  4O3A A;  2DVC A;  4G2Z A;  1MQJ A;  4MFI A;  3MJN A;  4FAJ A;  1OQH A;  2O51 A;  2W7Y A;  3FGS A;  4WKM A;  1US5 A;  4PFY A;  5DEX B;  4PFR A;  1NV6 A;  4LAT A;  2DSF A;  4H8I A;  3VFJ A;  1NUY A;  1B7Z A;  2V4C A;  3H6T A;  3GYY A;  4K3F A;  3IOT A;  4U21 A;  3LUY A;  3B50 A;  1O64 A;  4LQ2 A;  4PFU A;  1A99 A;  1JW5 A;  1OQG A;  4Q0C A;  2A5T A;  3TTR A;  4KI0 E;  4OEU A;  4QHQ A;  3CG1 A;  4F3G A;  2FHY A;  3UGW A;  1XI6 A;  4GWS A;  1FQF A;  2ANJ A;  3H7M A;  3RY3 A;  4F2O A;  4QFP A;  1IMA A;  3ILT B;  2P2A A;  4GWY A;  3E9X A;  4NWC A;  3IL1 B;  4JSD A;  4LZ5 A;  3HV1 A;  3IOU A;  3O6H A;  4G8H A;  3VXC A;  4FEC A;  4BDL A;  5I58 A;  2QS2 A;  3QUJ A;  4ZEK A;  5ET6 A;  4OTE A;  5CMB A;  4JVC A;  4MX6 A;  1SD3 A;  3FV2 A;  1PEB A;  3E4R A;  2DOJ A;  1UTH B;  4H65 A;  4F18 A;  2O1L A;  5I2N B;  4X8R A;  5LTC A;  4ZED A;  3RN8 A;  3ISP A;  1B5H A;  3TAJ A;  2V3T A;  3MST A;  3PUY E;  4YZZ A;  3MVZ A;  2HXR A;  1P1N A;  3U65 A;  4NN3 A;  1YTV A;  4OES A;  4R9F A;  3LSF B;  1VR5 A;  1HSJ A;  2PFY A;  2XXK A;  2DWI A;  2F3D A;  3FXQ A;  3RTF B;  1URS A;  2Q74 A;  1LB8 A;  3K01 A;  1M5B A;  3HN0 A;  4PDD A;  1UQW A;  5I3S A;  4F1Y A;  3TTL A;  2IA4 A;  1FRP A;  4O94 A;  4DCY A;  4OVP A;  2Q2C A;  4F3P A;  2GH9 A;  4BDO A;  3LSX A;  1XVY A;  5KDT A;  2R71 A;  2GFE A;  4PGN A;  1FPL A;  1M5E A;  1GVC A;  1MXU A;  5H8F A;  2AL5 A;  4F3S A;  1FBC A;  3JV9 A;  3K6V A;  4DLD A;  5F1Q A;  2ALU A;  4PTK A;  4MMP A;  2P0S A;  1FTM A;  3RPW A;  1D9Y A;  4R75 A;  1B5J A;  3CVG A;  2DS9 A;  3KBR A;  4XKP A;  3FAS A;  1H44 A;  3FJ7 A;  4KYE A;  3IO6 A;  3SKP A;  5M2V A;  4QFL A;  5CMC A;  3GBB A;  1BK4 A;  1IXH A;  4PQJ A;  1DMB A;  3MZB A;  1RDY A;  4FED A;  4BDR A;  5HPQ A;  4QFK A;  2Z22 A;  3R6U A;  2Y5L A;  2ZNU A;  1MPD A;  4GL8 A;  2RC9 A;  2Z8D A;  2F7B A;  2Z23 A;  1M5D A;  4TLL B;  5KCJ A;  2THI A;  1VFD A;  4NX1 A;  1UTB A;  4Q8R A;  2UXA A;  4MEV A;  2D5W A;  3SEX A;  2DE3 A;  3M3F A;  3BFU A;  4PFB A;  3MYU A;  5K2X A;  3V89 B;  5AA3 A;  5I57 B;  5EYH A;  1I6B A;  5H8Q B;  3RGY A;  4TOZ A;  2DVZ A;  4OFO A;  3PPP A;  4GF8 A;  1Q1K A;  4JWO A;  3T9X B;  3FAT A;  3V8X B;  3VE1 B;  4OZ9 A;  1MY3 A;  1NV4 A;  4OFJ A;  2WKY A;  2QPQ A;  5F7V A;  2D21 A;  1P1U A;  4OEV A;  3EHU A;  4F31 B;  3IB0 A;  2F6P A;  3G3J A;  4P0I A;  4P56 A;  3C4M A;  4LQ5 A;  4JVD A;  2DE2 A;  5H8H B;  1LBW A;  3LBS A;  4IGT A;  3CFX A;  4ND9 A;  1OMP A;  2QS4 A;  2XXT A;  3PUZ E;  3QK6 A;  4MF3 A;  4R74 A;  3MC2 A;  4YU0 A;  1S7Y A;  1Y9U A;  2IEE A;  3IOV A;  4R72 A;  5CI5 A;  4P11 A;  1NI9 A;  5FHO A;  1DBZ A;  2ABH A;  2HPG A;  4EDP A;  1O63 A;  2ZYM A;  1RDX A;  4OVS A;  5ISU A;  4DCX A;  1AIV A;  1ZKB A;  1DTG A;  3OXN A;  4EF2 A;  3K6W A;  2ZZV A;  2HQ0 A;  1I6Q A;  1MH4 A;  1XVX A;  2FA7 A;  1DPE A;  1MY0 A;  1URD A;  3ZSF A;  5CRY A;  1TFD A;  3QAX A;  3B8B A;  3RT6 B;  4R6K A;  1TWY A;  1MH3 A;  4QSE A;  4IY5 A;  3OEN A;  2YPN A;  4P1E A;  4GRK A;  1LAF E;  4XKR A;  4N13 A;  1NMU A;  2XXY A;  1SI1 A;  2F6G A;  1GV8 A;  2H9B A;  4PE5 B;  4N4U A;  5I56 B;  3G3G A;  4QSD A;  5ELV A;  1IZ1 A;  2DXR A;  1ELJ A;  4OAN A;  2V84 A;  1SW2 A;  3SEU A;  2DDK A;  1P1W A;  4OWD A;  1B3G A;  4R9G A;  3TOD A;  2I4C A;  1N3X A;  4Q30 B;  1LFI A;  5ICT A;  1WOD A;  4XTC Q;  5JTY B;  2WBD A;  1FPE A;  2VPO A;  1UTH A;  1MDQ A;  4P1L A;  4GX3 A;  4H8J A;  1JEV A;  1ZBM A;  1PB8 A;  4N8G A;  2OK2 A;  3MWB A;  4YKK A;  3CSB A;  2ONR A;  1DSN A;  2RIN A;  4XIG Q;  4X04 A;  2KR0 A;  4N81 A;  3V5A A;  3KGC A;  4N91 A;  2Y84 A;  1R6Z A;  4FJP A;  3MZ1 A;  3MAM A;  2CZL A;  4M4G A;  3TCG A;  3OO9 A;  3TCF A;  3B6T A;  3MP8 A;  1WDN A;  1YAE A;  3T66 A;  1SW4 A;  1JW4 A;  4IO3 A;  1QVS A;  5TPA A;  1NNT A;  4IY6 A;  4OVR A;  3QXM A;  1FPG A;  1FBF A;  4MH5 A;  4H5F A;  1H3D A;  1MXZ A;  2YLN A;  4LUB A;  1FQE A;  2Y7P A;  1QKB A;  2Q89 A;  4F29 A;  5FBP A;  1NV7 A;  3B6Q A;  2FNC A;  5L9O A;  1IQ7 A;  1QGX A;  2I3W A;  1ATG A;  1BLF A;  4NF0 A;  4P9K A;  4ZZE A;  1B5I A;  4ZS9 A;  3MPL A;  4PCD A;  2R8T A;  3FJG A;  5IKB A;  3FVN A;  1M5C A;  5A5X B;  3PV0 E;  2ZNS A;  5CC2 A;  1AH5 A;  5HM4 B;  4JDF A;  4UA8 A;  2NWJ A;  4GWO A;  2HZL A;  3QYT A;  3WAF A;  3U72 A;  1FJ6 A;  3ILU B;  4N8Y A;  2UYE A;  1ZMG A;  2CEX A;  4KD5 A;  4NF8 B;  3VDF A;  1LB9 A;  2Q9T A;  5IZ3 B;  1YPN A;  2MKZ A;  2DQV A;  3KEI A;  4U4S A;  1FQB A;  3FV1 A;  3LSW A;  1Y3Q A;  2PT1 A;  1LAG E;  1Y4T A;  2B3F A;  3G3F A;  3RPL B;  2CEY A;  4GOT A;  3ROJ A;  3K6X A;  1FW0 A;  2BJI A;  2ZMB A;  5L8D A;  4GIZ A;  3O28 A;  4H6D A;  3PMW A;  2PMS A;  3C36 A;  1FTJ A;  1MM6 A;  4H5G A;  1B1X A;  1D9V A;  1QW0 A;  2V3Q A;  3FUZ A;  3Q25 A;  4IO6 A;  3CSG A;  4I40 A;  2RKM A;  2QVU A;  3ECR A;  3K2D A;  3KFM A;  5AA2 A;  3I3V A;  5I2K B;  3MUQ A;  1NNK A;  5HBC A;  2QL3 A;  1FBP A;  3RLF E;  1FSA A;  1IIT A;  3LR1 A;  2REJ A;  4EQB A;  2DXY A;  2NUV A;  2WX9 A;  4AS5 A;  3K1P A;  3MBP A;  3N94 A;  2O7I A;  2XXU A;  2Q8M A;  5H8H A;  2QMX A;  5AA1 A;  1DTZ A;  2DWJ A;  1SPI A;  1A8F A;  4NHB A;  4PAF A;  3RQT A;  5AA4 A;  2QS1 A;  3T9V A;  2VHA A;  5TP9 B;  4NF4 B;  5ICQ A;  4F19 A;  1NNP A;  1Y20 A;  4X48 A;  1BTJ A;  3H6U A;  1B0L A;  1RYO A;  2QSX A;  4JWX A;  2HEU A;  3FZV A;  3L6H A;  2CZI A;  1J1N A;  1KA0 A;  2DE4 A;  1S9T A;  4HCW A;  4NAP A;  3O2A A;  3G3H A;  3DM0 A;  5I59 A;  2FIX A;  2Q8J A;  2I58 A;  4U1Z A;  4LZ8 A;  3LV0 A;  3EQ1 A;  4E0X A;  1B7U A;  1N76 A;  5DVF A;  3BIH A;  4KCD A;  4XKN A;  1USY H;  2KLF A;  2I4B A;  3C33 A;  4QFO A;  2I6E A;  1RDZ A;  2JJK A;  4IGR A;  4LN5 A;  3E3K A;  1B58 A;  3USD A;  2HFB A;  1FJ9 A;  3SDF A;  4BDQ A;  4G4P A;  4NF5 B;  3OEK A;  3KG2 A;  1USY E;  2B4L A;  3BIG A;  4HXV A;  3M3L A;  4MLV A;  3G3K A;  3GXA A;  4U2R A;  1CB6 A;  3Q26 A;  3A3C A;  1B4H A;  3PD8 A;  2WYK A;  4RY1 A;  1MY1 A;  5IGA A;  1HSE A;  4DI3 D;  2CZH A;  1CE2 A;  3Q27 A;  3TFL A;  1LCF A;  1YZ0 A;  1PDA A;  3KN3 A;  1FTA A;  2H25 A;  4DI4 B;  1INP A;  2XXV A;  4NED A;  3B7D A;  2HAU A;  1HSL A;  3IB2 A;  3VLU A;  2BJJ X;  3CI8 A;  5BWJ A;  1NH8 A;  1FTK A;  1AL3 A;  3OEM A;  5EQA A;  1MQH A;  2F34 A;  3FXB A;  1A55 A;  3KSX A;  4AS4 A;  5ESY A;  4NTL A;  1B3H A;  4ZEB A;  4AQ4 A;  5F24 A;  4EXK A;  2OWZ A;  1JVX A;  4JVI A;  3CR9 A;  4LP2 B;  2ZXT A;  1LAX A;  1MQG A;  5DVJ A;  2M8C A;  2X26 A;  2VT5 A;  4YMB A;  4HE1 A;  4PAK A;  4YKJ A;  1SDX A;  1P1Q A;  1IMD A;  3TTN A;  3W15 C;  4H1X A;  4ZDM A;  3O6G A;  4GD5 A;  3TDJ A;  3AXF A;  3FD3 A;  4R73 A;  1O7T A;  3UK4 A;  2VP1 A;  4IR8 A;  5B70 A;  1EYI A;  3HFU A;  1MM7 A;  4ZE9 A;  3B6W A;  5DTB A;  1BKA A;  2RC7 A;  2B3B A;  3BKI B;  3LSL A;  3C31 A;  4GX4 A;  5LDZ A;  4DIG A;  1YXI A;  3PPN A;  1MXV A;  1KA1 A;  3PU5 A;  4THI A;  1Y4C A;  2XX8 A;  1JEU A;  1N04 A;  5KZT A;  4GWZ A;  4DXC A;  1D3K A;  2PVU A;  3SER A;  3PUV E;  4N17 A;  3D1R A;  1MRP A;  5B7D A;  4KR5 A;  2V3U A;  3KOT A;  2DP8 A;  2OX3 A;  4YB5 A;  4MCO A;  4AB6 A;  3MW0 A;  1H76 A;  2WEF A;  3PPR A;  3IR1 A;  3UOR A;  1GTK A;  3I5O A;  4G68 B;  4I9D A;  2FYI A;  3DLN A;  4POX A;  3TYH A;  3A09 A;  4GWX A;  1A8E A;  3GZG A;  2HCA A;  3PTY A;  1OLC A;  5ET5 A;  3K02 A;  4HCY A;  1PC3 A;  4N6P A;  4ZE8 A;  3SEV A;  3U8Q A;  3ODB A;  4KHZ E;  2R9J A;  4DXB A;  1QKA A;  4FOR A;  3T22 A;  2F97 A;  1B52 A;  4POW A;  2KQZ A;  1US4 A;  2PYY A;  1POY 1;  3FXU A;  4EUO A;  4DDD A;  2Z8E A;  1EYK A;  1Y1Z A;  3SZP A;  1L5T A;  2P3N A;  1SBP A;  1BP5 A;  2O84 X;  1SW5 A;  4NGU A;  3IX1 A;  2UVG A;  3JYR A;  1MY2 A;  1OVB A;  1DOT A;  5DEX A;  3IJX B;  3A3U A;  4OVT A;  2XXI A;  5TP9 A;  4R2F A;  4NF4 A;  2OBG A;  1H43 A;  4IO7 A;  1IME A;  4NF6 B;  2ONK E;  2LAO A;  3O9P A;  3OO6 A;  5JEI A;  1MG1 A;  4F39 A;  1FPI A;  2V93 A;  2OCU A;  3IAZ A;  3KBZ A;  2HAV A;  1TXF A;  1FPB A;  2A5T B;  2F36 A;  2GHA A;  4N6D A;  2DWA A;  2O69 A;  3OSR A;  4PFW A;  4KYS A;  3DEL B;  4U22 A;  4YB6 A;  3TMG A;  1P1O A;  1MS7 A;  4F2Q A;  1IXC A;  5DVI A;  3RNN A;  1B1H A;  1KZ8 A;  4PBH A;  1B2H A;  4RPO A;  3O6I A;  1MY4 A;  3H4Z A;  3KC0 A;  3Q28 A;  3VVF A;  1IMB A;  4H0W A;  1NV3 A;  5IZZ A;  1SI0 A;  3VXB A;  1VE4 A;  3FXR A;  1QUL A;  1MQI A;  1MPB A;  2Q2A A;  3PUX E;  5I2N A;  5IZ1 A;  1R9L A;  3CHG A;  3TQL A;  4ESW A;  2XWK A;  1QJM A;  1PBP A;  2QVR A;  3IFA A;  4FBP A;  3C34 A;  3H6V A;  4IO4 A;  4RNS A;  1EU8 A;  2XX9 A;  2R6G E;  3KJ7 A;  1JET A;  3QSL A;  2AYS A;  3N6T A;  4H67 A;  4R6H A;  3ZS6 A;  4RA1 A;  4OA4 A;  1LBY A;  3LC8 A;  3TEL A;  5J16 A;  4FIM A;  2Y7R A;  2QS3 A;  4UAC A;  3EPE A;  1XHY A;  2HHM A;  5L9M A;  4ZEF A;  2G29 A;  3RT8 A;  2OWT A;  1B3L A;  3FJM A;  1FPJ A;  5KDT B;  3S9N C;  1ZJL A;  3E13 X;  1QUK A;  5H8F B;  4EQ9 A;  4DZ1 A;  1B9J A;  4FAT A;  4MIJ A;  4PET A;  4E0W A;  2XXP A;  4MJO A;  4RK2 A;  3MPK A;  1IXI A;  4QRZ A;  4UAB A;  3KJT A;  3VVE A;  2O7U A;  4GBW A;  4NE4 A;  4PE3 A;  2PBW A;  4G77 A;  1NV5 A;  3QUF A;  2UYF A;  1NUZ A;  4PF6 A;  1LBC A;  1K9Z A;  4PP0 A;  1Z7N E;  2F78 A;  4NWD A;  4G68 C;  1EZ9 A;  3T9U A;  5ITO A;  1SVX B;  3NOH A;  1T0K A;  4R6Y A;  2O1M A;  1FCK A;  1Y3P A;  3MQ9 A;  2FVZ A;  1B3E A;  2E1S A;  2REG A;  1I6A A;  4HE0 A;  1POT A;  2RF1 A;  1FBH A;  3KN8 A;  1UIV A;  5KCJ B;  4O7M A;  1R9Q A;  2GHB A;  1AMF A;  1UTB B;  1A7L A;  5I57 A;  4XXU A;  3BBR A;  2OPD A;  4OHN A;  3FVK A;  5H8Q A;  1M5F A;  4NG7 A;  3K1N A;  1MDP 1;  1LBV A;  3GLB A;  2VGQ A;  2F7A A;  5DW8 A;  2A5S A;  1PBQ A;  1VFE A;  2E0S A;  4DE8 A;  4GQO A;  1N84 A;  2X7Q A;  2DWH A;  2I0B A;  4PFI A;  4XKQ A;  4KXP A;  1OIB A;  3K0V A;  2UVI A;  4O3B A;  2XWO A;  4OEN A;  4I1D A;  1NH7 A;  5ET8 A;  4GLI A;  3S2V A;  3TCH A;  3H3G A;  4I3E A;  2OJT A;  4ECF A;  4ELP A;  5FTH A;  3U93 A;  4OVJ A;  2ZYK A;  1B46 A;  4GFR A;  4IO2 A;  4OYV A;  5AA2 D;  2VD2 A;  1LCT A;  1B7H A;  4RK9 A;  2F35 A;  3PUW E;  1MQD A;  1R1N A;  5FTI A;  2I0C A;  2UVH A;  1YCJ A;  4H45 A;  3CIJ A;  5CMM A;  3G3I A;  2PCR A;  1Q9D A;  4G8M A;  4XFE A;  2X7P A;  4XEQ A;  3MP1 A;  4OVQ A;  5ET7 A;  2H99 A;  3O66 A;  4U23 A;  1IIW A;  1XS5 A;  3R26 A;  1KWH A;  4NF6 A;  4O3C A;  1B32 A;  5CMK A;  3HCQ A;  2PT2 A;  1NV1 A;  1DCU A;  3ZKL A;  3ZKK A;  4GXS B;  4N6K A;  2QVV A;  3TTM A;  4FEB A;  5EHS A;  4JBZ A;  5DT6 A;  5I7I A;  1LFG A;  3QIM A;  2O68 A;  1FBD A;  3D4G A;  1A40 A;  1A54 A;  3PMV A;  1Q35 A;  4KYD A;  5I56 A;  5H8N B;  4JSO A;  4QBA A;  4EF1 A;  4RXL A;  1XOC A;  3N26 A;  4YKI A;  4MBP A;  1RYX A;  3CFL A;  4LZ7 A;  3SEY A;  3V83 A;  1P99 A;  4LON B;  1ZLQ A;  1NFT A;  2Y7I A;  3P7I A;  5JTY A;  1CNQ A;  3K1M A;  3MP6 A;  1LBB A;  2Y7W A;  1DPP A;  3OO8 A;  1FPF A;  4MHF A;  1LEV A;  4ZEC A;  4ZEI A;  5CBS A;  1NUX A;  5DYH A;  4I62 A;  3S9E A;  4U1O A;  1B40 A;  1B51 A;  2B65 A;  4HE2 A;  3HPI A;  5ITP A;  5AE4 A;  4TQU Q;  1FBE A;  2VPN A;  2XWI A;  5I84 A;  3L6G A;  2QJE A;  1JQF A;  4PF8 A;  2ZNT A;  5TPA B;  4LA9 A;  1JW1 A;  3K00 A;  2XXQ A;  1Z7M E;  1F9B A;  4Z7E A;  3TEP A;  1TFA A;  1TT1 A;  1N0T A;  2OWS A;  4F1U A;  4M1V A;  4OXV A;  5BUU A;  4P3L A;  4PAI A;  4RPN A;  4BDM A;  4C1U A;  3O29 A;  2NVU B;  1FPK A;  3MVW A;  2OPE A;  4KPT A;  2YJP A;  3C35 A;  4MNI A;  3S9L C;  1DK4 A;  3E79 A;  1IEJ A;  2CMO A;  1N3W A;  4MNC A;  3WAE A;  2VOZ A;  3M8U A;  1VDW A;  4Q5T A;  2H98 A;  2XXR A;  3HST A;  4YAH X;  1QUJ A;  1LFH A;  2AIX A;  4GVO A;  4ISU A;  4N07 A;  3IFC A;  4NMY A;  3PGF A;  5A5X A;  2L5V A;  1B6H A;  1II5 A;  2XA5 A;  2GRV A;  3UP9 A;  1ZU0 A;  3FVG A;  3OOA A;  5EHM A;  1FPD A;  3TQW A;  1IUD A;  2ZZW A;  5H8S A;  1MXX A;  5L9S A;  5LOM A;  2V25 A;  3EHS A;  4NF8 A;  3GBA A;  3DP8 A;  4OER A;  5IZ3 A;  4PDH A;  3HO7 A;  2HZK A;  1LBX A;  4YB7 A;  3HHG A;  4EQ7 A;  4BLA A;  1LBZ A;  2QMW A;  2F8D A;  3E78 A;  2H5Y A;  1SQY A;  3RPL A;  1N7W A;  4HTG A;  3Q29 A;  3CRB A;  3T0J A;  3UA8 A;  1MPC A;  1ZIU A;  4JWY A;  1FQD A;  1FTL A;  4HW8 A;  3MVX A;  3T96 B;  3PMX A;  5T3J A;  4ONY A;  2NOO A;  4ESX A;  3DP6 A;  1RKM A;  2ESN A;  1OVT A;  4PFT A;  3TUS A;  3H06 B;  1Y1M A;  4IO5 A;  1B3F A;  3KSJ A;  1MXY A;  1D4N A;  2XHD A;  3VLV A;  4O7I A;  1NV2 A;  3U94 A;  1NKX A;  1XC1 A;  3RUM A;  5I2K A;  4GX6 A;  3CG3 A;  5AA2 B;  3EF7 A;  2ZZX A;  1EYJ A;  2ZYO A;  3IOW A;  2XX7 A;  3S4U A;  2F3B A;  2WBB A;  1FTO A;  2F5X A;  4OQO A;  2F7C A;  3D4C A;  2Y7K A;  1AWB A;  3SET A;  4HS7 A;  4WXJ A;  3VLW A;  4YMA A;  3U1O A;  4PGP A;  2RCB A;  3VV5 A;  2D3I A;  2UVJ A;  5AA4 B;  4YIC A;  1URG A;  4F3B A;  1B0H A;  4OET A;  4P8B A;  1MXW A;  1AOV A;  3EKI A;  3EHT A;  1Y3N A;  1NV0 A;  1G0I A;  1LST A;  3HHF A;  2FIE A;  4QFN A;  3T93 B;  4ZZA A;  3M3K A;  3PPQ A;  3EN3 A;  4I8C A;  2DYX A;  4H46 A;  1FQA A;  2OLB A;  3C9H A;  5FHM A;  3G7W A;  3OEL A;  5EQ8 A;  4ELQ A;  3OD7 A;  1JNF A;  1FQC A;  4C1T A;  5I59 B;  3VVD A;  1NNF A;  2B4M A;  3N5L A;  2H4I A;  4WEP A;  4JB7 A;  2QFL A;  1B05 A;  2Q88 A;  5H8N A;  4KQP A;  4RYA A;  5I58 B;  2ZYN A;  3TKD A;  3O97 A;  4NF5 A;  4I3Y A;  1FBG A;  2PX1 A;  3KZG A;  3T1B A;  1XT8 A;  3KC1 A;  3OMB A;  4OMB A;  4GBV A;  5K2Y A;  3K6U A;  1OLA A;  2Z8F A;  3UN6 A;  3I6V A;  3PD9 A;  2QRY A;  4C0R A;  3U92 A;  4P0G A;  3H6W A;  4P47 A;  3UIF A;  3MVY A;  4MNP A;  3IOR A;  4MAG A;  1SYI A;  5FHN A;  3KOS A;  1UIU A;  3W9V A;  4KCC A;  3QMF A;  4LVQ A;  3RTW B;  3H03 A;  4DXU A;  5JK4 A;  2P1S A;  2O6A A;  3W9W A;  2AL4 A;  2XXW A;  1WVJ A;  2G93 A;  3IO4 A;  2RCA A;  3S9M C;  4TLM B;  3SEW A;  3ONM A;  5EQ9 A;  4OFL A;  4FE8 A;  4BDN A;  3FBP A;  4QXD A;  4NQ8 A;  4X1B A;  2XD2 A;  3R7X A;  2RC8 A;  3PPO A;  1QUI A;  4PBQ A;  5J1D A;  3A29 A;  5I5P A;  5EQ7 A;  4GWW A;  1N7X A;  3C32 A;  2FBP A;  5CM6 A;  3TPA A;  1H45 A;  4GL0 A;  4XF5 A;  1NUW A;  1EZO A;  4G8N A;  1IMC A;  3DP4 A;  4KFQ A;  2XWV A;  3IK6 B;  3SES A;  1GR2 A;  5CBR A;  4MLQ A;  1G0H A;  4U4X A;  2Y5K A;  3RYD A;  4WED A;  1BIY A;  2I3V A;  1LAH E;  1K9Y A;  4X1D A;  2XD3 A;  3IJO B;  4R2B A;  4Z0I A;  3F11 A;  4ELO A;  4EXL A;  3N6U A;  1IMF A;  5EYF A;  3T9H B;  4O8M A;  1B4Z A;  2OZZ A;  1JP4 A;  1D9Q A;  2WYP A;  1LLS A;  3TTK A;  4X9T A;  4ELR A;  2GQ1 A;  4GWU A;  1ZTY A;  3FVO A;  5TU0 A;  3KN7 A;  4F1V A;  1NL5 A;  1ANF A;  3FIR A;  2NXO A;  1PB7 A;  1VSO A;  5A5L A;  3LUZ A;  3JZJ A;  2CZK A;  4F22 A;  4G68 A;  2VD3 A;  1I69 A;  1S50 A;  2XXX A;  3CFZ A;  2ONS A;  4IB2 A;  1EZP A;  5IAI A;  1PB9 A;  3IB1 A;  1SW1 A;  3BFT A;  5EYG A;  4QSC A;  2I48 A;  4GXA A;  3OO7 A;  2XXH A;  4N15 A;  3MZ9 A; 
#chains in the Genus database with same CATH homology
 1YYZ A;  5IM2 A;  4G61 A;  2PFZ A;  2KQZ A;  2P3V A;  1EYK A;  4PF8 A;  4PC9 A;  4OVR A;  3SZP A;  1FPG A;  2P3N A;  1FBF A;  4F1U A;  4M1V A;  4NGU A;  4P3L A;  4PAI A;  5FBP A;  1FPK A;  1NV7 A;  4MNI A;  4PFR A;  1DK4 A;  4OVT A;  1NV6 A;  3E79 A;  1QGX A;  1NUY A;  4MNC A;  2V4C A;  1VDW A;  4NF0 A;  4P9K A;  3GYY A;  1IME A;  3B50 A;  4PCD A;  3IFC A;  2R8T A;  1FPI A;  2L5V A;  3KBZ A;  2XA5 A;  1FPB A;  2HZL A;  4N6D A;  1FPD A;  2FHY A;  1XI6 A;  4GWS A;  2ZZW A;  1FJ6 A;  4N8Y A;  1IMA A;  2CEX A;  5IZ3 A;  4PDH A;  4GWY A;  2HZK A;  2Q9T A;  5IZ3 B;  1LBX A;  2MKZ A;  1LBZ A;  1KZ8 A;  4PBH A;  3E78 A;  3RPL A;  3KC0 A;  1IMB A;  3RPL B;  1NV3 A;  5ET6 A;  2CEY A;  3T0J A;  5IZZ A;  4JVC A;  4MX6 A;  3ROJ A;  4F18 A;  2BJI A;  5IZ1 A;  5T3J A;  3CHG A;  4X8R A;  5LTC A;  2XWK A;  2QVR A;  3IFA A;  2V3Q A;  4FBP A;  3ISP A;  4O7I A;  1NV2 A;  3MST A;  4I40 A;  4YZZ A;  2QVU A;  4GX6 A;  2HXR A;  3U65 A;  4NN3 A;  1FBP A;  2ZZX A;  1FSA A;  1EYJ A;  4OA4 A;  1LBY A;  2PFY A;  2WX9 A;  2XXK A;  4AS5 A;  5J16 A;  2F3B A;  2F3D A;  2WBB A;  2F5X A;  2Q74 A;  2Q8M A;  1AWB A;  4PDD A;  5I3S A;  2HHM A;  1FRP A;  4O94 A;  4PGP A;  4OVP A;  1SPI A;  4NHB A;  4PAF A;  4PGN A;  1FPJ A;  1FPL A;  4YIC A;  1FBC A;  4P8B A;  4F19 A;  3EKI A;  4PTK A;  4MIJ A;  4MMP A;  4PET A;  4MJO A;  1NV0 A;  4UAB A;  1G0I A;  2FIE A;  4GBW A;  4PE3 A;  1NV5 A;  2CZI A;  1NUZ A;  4PF6 A;  1KA0 A;  2DE4 A;  1K9Z A;  4HCW A;  4H46 A;  4NAP A;  5EQ8 A;  1BK4 A;  2FIX A;  1RDY A;  3NOH A;  3LV0 A;  2B4M A;  2Y5L A;  2FVZ A;  3BIH A;  4HE0 A;  1FBH A;  2QFL A;  4NX1 A;  1RDZ A;  2JJK A;  4O7M A;  4LN5 A;  4MEV A;  2DE3 A;  4PFB A;  3MYU A;  1FJ9 A;  4I3Y A;  1FBG A;  3T1B A;  5EYH A;  4NG7 A;  3KC1 A;  1LBV A;  4GBV A;  2DVZ A;  2B4L A;  3BIG A;  4HXV A;  5DW8 A;  1NV4 A;  2QPQ A;  2WYK A;  4PFI A;  5IGA A;  4DI3 D;  4KXP A;  2CZH A;  4P47 A;  4MNP A;  2XWO A;  1YZ0 A;  1FTA A;  4MAG A;  4DI4 B;  3W9V A;  1INP A;  5ET8 A;  3QMF A;  4I3E A;  5JK4 A;  4P56 A;  4JVD A;  3W9W A;  2DE2 A;  1LBW A;  5EQA A;  3FXB A;  4AS4 A;  5ESY A;  5EQ9 A;  3FBP A;  4QXD A;  4NQ8 A;  5F24 A;  4PBQ A;  5J1D A;  3A29 A;  2OWZ A;  4H45 A;  4JVI A;  5I5P A;  5EQ7 A;  4GWW A;  1NI9 A;  1DBZ A;  2FBP A;  2HPG A;  5CM6 A;  2VT5 A;  4HE1 A;  4XF5 A;  4PAK A;  1NUW A;  1RDX A;  2PCR A;  4OVS A;  1Q9D A;  1IMC A;  1IMD A;  4XFE A;  4XEQ A;  4OVQ A;  5ET7 A;  2XWV A;  2ZZV A;  1G0H A;  4IR8 A;  2Y5K A;  3RYD A;  1NV1 A;  1EYI A;  1DCU A;  3HFU A;  1K9Y A;  3B8B A;  4GX4 A;  5LDZ A;  1IMF A;  1YXI A;  4N6K A;  2QVV A;  4O8M A;  1KA1 A;  4P1E A;  1JP4 A;  1D9Q A;  5I7I A;  1FBD A;  2WYP A;  4GWZ A;  4X9T A;  4N17 A;  2GQ1 A;  4GWU A;  4N4U A;  3D1R A;  4QBA A;  4F1V A;  4OAN A;  2OX3 A;  2DDK A;  4MCO A;  5A5L A;  3LUZ A;  2CZK A;  2WEF A;  1CNQ A;  2WBD A;  1FPE A;  2VPO A;  4P1L A;  4GX3 A;  4MHF A;  1FPF A;  1LEV A;  4GWX A;  1NUX A;  4N8G A;  3PTY A;  5ET5 A;  4HCY A;  4X04 A;  2KR0 A;  4HE2 A;  4N81 A;  4N91 A;  5EYG A;  1FBE A;  2VPN A;  2XWI A;  4N15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...