2FI5E

Crystal structure of a bpti variant (cys38->ser) in complex with trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Functional and structural roles of the Cys14-Cys38 disulfide of bovine pancreatic trypsin inhibitor.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fi5E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fi5E02
3BTQE 2GD4B 3MFJA 2ZDNA 2P3FH 2FDAA 2ZGCA 5ESTE 5C3NA 2WPKS 4ISLA 1O33A 2XRCA 1IQMA 1HFDA 1O3NA 1UO6A 4DY7B 5GWZA 1YKTA 4NWKA 1GL0E 2TGAA 3E0NB 3RXOA 3IG6B 3PWBA 4X0WU 1GMCG 2PUXB 2A4RA 1AIXH 2ZCKP 1ZGVA 2ULLA 2C8XB 3IITA 1D3DB 1P9UA 1Z8IB 3LU9B 1ABIH 2HGTH 2RCEA 5C5OA 3A89A 1K9OE 3SV7A 1OYQA 1OWEA 1TBQH 3E1XB 1C1PA 2GCTB 1O31A 1ZSJA 1GBJA 5HM2A 2FEQH 2A31A 1OPHB 3Q76A 4YOJA 2A5KA 2NU2E 1YCPH 1O5BB 2W3KA 4FUDA 5J4QA 3FP8E 4CBNA 1P2JA 4WY3A 5IYTA 3BSQA 3GISB 2WPLS 1EPTB 3ZZAA 3MO9A 1EUFA 1P11E 1VCWA 2V35A 5DP8A 4VGCC 5ETXA 2FM2A 1MU8B 1TGBA 1SGNE 1C9PA 1MD8A 1AVXA 2HPPH 1A5GH 1D4PB 3NKKA 2C8YB 4OS6A 4XFQA 3LGIA 2PTNA 1QRXA 4UD9H 1MTUA 1N1LA 2BDYA 1O2LA 3BTDE 1O2TA 1QCPA 4E7NA 3KL6A 2O8WA 3UR9A 4KTCA 2D2DA 2VH6A 2QXJA 1HUTH 3RMNH 3SU4A 5DP3A 1QBVH 5A2MH 2JH5D 3S69A 2VIDA 2A7HA 2EC9H 2I6SA 5IDKA 1BMMH 5AHGH 2D8WA 3EAJA 2ZFQH 1PQ5A 5F8TA 4CHAC 1CO7E 3RMOH 1FMGA 1A5IA 3NZIA 3U8TH 1W7XH 2W5EA 4YTAA 2OBQA 4UE7H 1TNHA 2Z9KA 1L1GA 1Y3WA 3T27A 2KAIA 2GGVB 2H6MA 4UEHH 1G3BA 1CA0C 1GHYH 1GI5A 1AKSA 1SGDE 2GVFA 1C5QA 4GVUA 1O2OA 3MO3A 3D49H 3U1JB 4Y0ZE 3TJVA 4DG4A 1ELGA 2QIQA 4Z6AH 1GBIA 1C5MD 1C4U2 1ZHRA 2ZU1A 2FTLE 1C1WH 5EG4A 1KXEA 2ZWLH 3A7TA 1CHGA 3ZV8A 3RM0H 3P8GA 2QC2A 3C1KA 1GBTA 1HAZB 2LNCA 2IN2A 1UTJA 4U30A 1HYLA 4GPGA 4Y76A 1LHDH 1C1VH 1NO9H 1TMTH 3RXSA 3O8RA 1MCVA 2FZZA 3A81A 1K1LA 1A0JA 1TNLA 2GCHF 4HZHA 3RLYH 5HYOA 5DP7A 1ARCA 3H7OA 3TPIZ 4BANB 1QR3E 1C2IA 1L0ZA 4BAKB 1SB1H 3TK9A 4DVAU 2ZFFH 1TPSA 1MBMA 1WBGB 5EQQA 1HRTH 1A61H 1FPHH 1SGQE 2ZU5A 4ZROA 4LXBH 1AB9C 1NU9A 1HGTH 3ZVFA 1WQVH 1DLEA 1C4V2 1FAXA 2F91A 3ATIA 3BEIB 3I29A 5EW2H 3RXVA 5T3HA 2EI7A 3RXUA 1JRTA 1AE5A 1K22H 3TGIE 1SFQB 3BEUA 1C9TA 2QYIA 1YGCH 3HGNA 3NK8A 2QV1A 4ABGA 4BAMB 2P16A 4YZUA 1HAGE 4JZEH 4I7YH 3PTBA 2XW9A 3TJOA 3ZZ9A 3A83A 2H1UA 1IQLA 1DDJA 1V2LT 2ZGBH 3E3TA 1W14U 5G4BA 3KQEA 4AG1A 2ZTXA 1PQ7A 1HAVB 1OWJA 1KY9A 1QQ4A 2VH0A 1S6FA 1GPZA 2A4GA 3OTJE 1GHWH 4I8KA 2O8UA 1BRCE 3CS0A 1HXFH 1C2EA 1GBBA 2VIWA 4FU9A 2R0LA 4YOIA 2BY7X 2A45B 1NRPH 5CHAC 1BT7A 1BJUA 1DXPA 4DT7B 2ZHFH 1TPOA 1PJPA 3F9EA 1AMHA 1QRZA 3ELAH 4CR5A 1PYTD 4NCYA 3GY3A 4B76A 1KIGH 1WUNH 1MTNC 1QBOA 4NWLA 1CT0E 1P2MA 2VWMA 1IQEA 5T6FA 1UCYK 1O3BA 3ODDA 4I8JA 3SU3A 1BTZA 1ZPZA 4ZH8A 1VCPA 1L2EA 3E8LA 1O3AA 3U69H 2DUCA 1ZMLA 5C1YA 1C1TA 1SGFG 1EB1H 1NC6A 2H2ZA 1DWDH 1ZTKA 1GMHF 1A4WH 1Z1JA 1AZZA 1C2MA 2OC7A 2BX3A 2FOCA 2BD2A 2ZQ2A 3RC6A 1YPHC 1DUEA 3T2NA 1YCPK 2PKAA 3QO6A 4O03A 1O5DH 1GBKA 3T25A 4CR9A 7LPRA 1MCTA 5E0HA 3RU4E 1D3PB 4YO9A 4LZ4B 5DP6A 5EOKA 3SV2H 2STAE 1AVGH 2FPZA 5FX6A 1J15A 3RXRA 3GDSA 3EA8A 5EGMA 1NS3A 2O8LA 5LH8A 4NA9H 3KQCA 1HBTH 1G3CA 3L3TA 3T5FH 2AERH 1YPHE 3DUXH 4UDWH 4E06H 2J4IA 3TK6A 1DPOA 2AGEX 1OP0A 3QZRA 1P04A 3A84A 3ATMA 1EAIA 2ZCLP 3ZV9A 3N7OA 4CRDA 4J2YB 1MH0A 1C5WB 3SJIA 2R3YA 4GAWA 3ZVAA 3A8BA 5DO4H 1VGCC 3SO3A 1ELVA 2HWLB 3URCA 4WH6A 1Y3VA 3V13A 1GHVH 1V2PT 2FO9A 3SI4H 2ZHQH 5DPAA 1GJ9B 1AWHB 1NFYA 3GOVB 4FVBA 1GBCA 2FP7B 1TRNA 3TU7H 3AAUA 1GMCF 1E37B 3D62A 3FP7E 3G01A 1A3EH 5GDSH 1AFQB 2G4UA 1LPZB 2A4OA 1UTPA 1PPEE 1V2OT 3QUMP 3QWCH 3SU1A 4ASHA 1BTWA 1B0EA 1SOTA 4ZKSU 1GWAA 3BIVH 3NCLA 1J8AA 1QJ6B 3QK1A 4NIXA 1G2MA 2A5AA 2ZGXH 4ABEA 1QTFA 4YESB 4AORA 3O8CA 5FPYA 1XXFA 4CREA 2UWLA 3BG8A 1ANEA 2ZDVH 4IGDA 1QHRB 4X1NU 4I31A 4YT7H 3MU8A 3M35A 5PTPA 1D3QB 3TITA 1UHBB 3ODFA 3K2UA 5AFZH 1NT1A 1SGEE 1SBWA 2AGIX 5GCHG 4X2XA 2Z9LA 1GCTC 3D65E 4OS2A 1WCZA 1YPLH 3RXGA 1EATA 1QIXB 2CMYA 3PO1B 3S7KB 1TABE 1O37A 2ODPA 4Q7ZA 2GCHG 4H42U 4Z0KA 5LPRA 1HAPH 1DFPA 2Z9GA 3BTWE 1ZJKA 3AASA 4H4FA 1CSOE 1UVSH 1JRSA 1THRH 2R2MB 1HXEH 2VNTA 1A0HB 1MMJN 2ZO3H 3FFGA 4I32A 1FNIA 2A5IA 1UTKA 2BLWA 1AD8H 4FVDA 1TALA 1SFIA 1ID5H 4AX9H 1MTVA 4ABDA 2R2WU 3AAVA 1W13U 1IHSH 1HIAA 3RXAA 1TE0A 2BDBA 2CGAA 3D23A 2PFEA 1DWEH 3UUZA 1O3KA 1AU8A 1C1UH 2BOHB 4NZLA 1ACBE 3HKJB 3UREA 4BXSA 3SUGA 1TBRH 2W7UA 1P9SA 3JZ2B 2P3UB 2OLGA 1GG6B 2FESH 3K9XB 4Q80A 2NWNA 2B0FA 4INHA 2PGQB 1OOKB 1FY8E 2AMPA 1BMLA 1LQEA 4Q7YA 3U8RH 5FCKA 1J17T 4X2WA 3M7QA 2ZPSA 3P8NA 3V7TA 1P0SH 1WAYB 4JYVH 3RXQA 1ZPBA 1BA8B 1BTPA 1F5LA 1C5XB 2J9NA 4K1EA 3NUMA 3URDA 1M9UA 1FN8A 2BD5A 1O2XA 1SSXA 2OUAA 2GMTC 4TY7A 1LMWB 1MZDA 4AN7A 3SGBE 2W7SA 1SGIB 1F7ZA 1N8OB 4ABHA 2GDDA 1ZLRA 2F3CE 1W10U 3RXIA 1NRRH 1SG8B 1JIRA 1FY1A 1L4ZA 2XC0A 1NM6A 2GV7A 1QRWA 3OU0A 2J95A 1ZYOA 3GY7A 3LH1A 3W95A 1GBFA 3SW2B 2RDLA 1Z8RA 1JXPA 1O2RA 1BTXA 7ESTE 5I25A 2FYRA 1SQTA 1NFWA 4B2BA 1QB1A 2ZTZA 1GI0A 3MH6A 3PLKA 4X1PU 3TH2H 1UK3A 3AVZA 1HJAB 4MG3A 2SNVA 4RN6A 4ABFA 5TCCA 1TGCA 2J94A 1BBRK 4AGJA 2BZAA 1GMHG 2HRVA 1CGJE 1LPKB 4XBBA 1OSSA 3NWUA 2TBSA 1XUGA 4A1TA 1YPGH 1GGDC 2GT8A 4JYUH 2P95A 2QF0A 3TLOA 3UWJH 3HK6B 3ZZDA 1GL1A 2UWOA 3CENA 4LZ1H 1O3MA 1TYNA 1KTSB 3BTEE 2FOMB 5A8XA 3QGJA 5E0JA 4B1TA 1YPEH 3SQEE 2PTCE 4WMEA 3UOPA 4IBLH 3EDXB 1HCGA 3A7VA 1O3CA 3PM3A 3FP6E 1FJSA 2CF9H 1OP8A 2A32A 1UTMA 4CRBA 1TMUH 5DK1A 4HFPB 4X1QU 1KLIH 3FVFB 4UFFH 1GHZA 1SLUB 3TJUA 3DHKH 3ITIA 1DSUA 1KTTB 1G2LA 3EE0B 2VGCC 2XCFA 2R9PA 3SQHE 1TMBH 1HAHH 1OP2A 1O3OA 1GBMA 3EGKH 4Y0YE 3E16B 1GVZA 3AW1A 3ZVCA 4FU7A 4LK4A 3H7TA 3ZZ5A 1PPFE 1HB0B 1RJXB 4ISNA 3RC4A 3A8AA 2H9HA 1JMOH 5C2ZA 1Y5UT 4Q2KA 2QXHA 3VEQB 4AFUA 1GBEA 1Q2WA 2AMDA 3GICB 1O5CB 3SV8A 3F68H 3SBKA 2BQ7B 4YOGA 4FUHA 4E05H 3F6UH 1OWDA 6GCHF 4FUCA 1EPTA 3P17H 3MNCA 3SJOA 3A8CA 5B6OA 1LHCH 3QGNB 1GJBB 2QXGA 4ABIA 4A1VA 3LONA 2G5VA 1T8LA 5H4IB 2JETB 1W8BH 1HLTH 1EXFA 1EKBB 5EQSA 4F49A 4DJZB 2FI5E 1OXGA 4WXIA 3M61U 1Q31A 4MPVA 1TNJA 3Q77A 1NROH 1FZZA 1ZSLA 3Q3KA 2B5TB 2VIVA 3ATKA 3BTGE 4AFSA 1W0YH 1K28D 2BLVA 2TPIZ 1EAUA 1GBAA 4X1RU 3VB6A 1D9IA 4NGAH 2FOHA 2H5DA 4OGYA 2QCYA 4J1YA 1C5ZB 4GSOA 2PKSB 1DE7H 4X6OA 1P57B 2BY8X 5TJXA 1W11U 1E0FD 3SNDA 1FDPA 4DGJA 4F4OC 4MLFB 3LGWA 1BMNH 2BLOA 3VGCB 3R0FA 1C2HA 1T4UH 4UFDH 1O38A 4GCHF 1V2NT 4NZQA 2FS8A 2NU0E 1BRUP 1GVKB 1T32A 3KNXA 4A6LA 4CRGA 4Y10E 1S81A 3B9FH 1ELDE 1QJ7B 3PLPA 1GI9B 4A7IB 1GCDA 3SORA 3U1IB 2VINA 2Z6BD 1LKBA 1TNIA 1A0LA 1UVUH 4A92A 3W94A 1RRKA 1ZSKA 1MD7A 1O2KA 2CHAB 2H9EH 1AN1E 1RXPA 5EW1H 3QTOH 3CP7A 5CE1A 1TGNA 1C5PA 1ZHMA 5J4SA 1NTPA 2OQUA 4KELA 1XVOA 1CA8B 1T31A 4MDSA 1D3TB 1GDQA 3PROA 4JYTA 1P2QA 5JPMH 5GCHF 1RTLA 1SGYE 2ZC9H 3RXCA 3SUEA 4JMYA 2ZPQA 1AZ8A 4Q7XA 1AUTC 3LDXH 1SGPE 2G5NA 4X8TH 3LGTA 1GDNA 8KME2 3SUDA 3E0PB 5T6DA 5DJ7A 2XWAA 2WV4A 3UR6A 1RTFB 3SZNA 1C5YB 2ZQ1A 3RXLA 2ANWA 4NIVA 2ZHWH 1ARBA 1EAXA 1GI3A 3MNXA 3Q3XA 3MWIU 1K1MA 1C2FA 1K1JA 1EJAA 5JYIA 4AGKA 1P10A 1QB9A 3EA7A 1HAVA 2DE8A 2BD9A 2ZNKH 2ZDKA 1G32B 3A8DA 2R3UA 1GJDB 2ZA5A 1TX6A 2M5TA 4BAHB 4BXWA 2BD8A 4GUXA 3PMAB 2W3IA 2GZ8A 3S9AA 1KDQB 1S0QA 3H5CB 1NRQH 3STIA 1Q3XA 3MU0A 5F03A 3UQVA 3ZVBA 1YPKH 2PR3A 3UOUA 1S0RA 1C5TA 1TPAE 3MH5A 1LKAA 4H6TA 2XBXA 2J38A 2TRMA 4RSPA 4UONA 1C1SA 1C5RA 2G51A 2JKHA 1CGIE 1MUEB 2FODA 1HAIH 1GJ5H 1QFKH 2C8ZB 7KMEH 4LOYH 1V2QT 4KTSA 1Y5BT 1VR1H 1A46H 2HNTC 1O36A 1GI4A 2XXLA 2TGPZ 2G4TA 1ZRKA 1S84A 1QA0A 4XSKU 2ZF0H 4VGCB 1DANH 2SGDE 1ZTLA 1C5UA 4X1SU 4B74A 1XKBC 5A0BA 1TX7A 2QN5T 4O3TA 2VU8E 4FXGH 3T28A 2Z3CA 2BDGA 1O34A 1KXDA 3PO1C 2FS9A 3M3SA 4AFQA 2HNTE 2XC4A 2PHBA 4X2YA 2ZGHA 1C5SA 3C27B 5A8ZA 1TBZH 3UNQA 1QURH 3UNSA 1WQSA 2G8TA 4X2VA 1MAYA 3LT3A 1QA7A 5EODA 1G9IE 1YBWA 3M5OA 6GCHG 3RUOA 4O9VA 2OBOA 1UCYE 2F9UA 1YPJH 1LHGH 2BD7A 2CF8H 3TNSA 2D1JA 1VITH 3LIWA 1KXCA 2HALA 4HI3A 1D6WA 5DP4A 3SU2A 1GVLA 4NIWA 2ODQA 4WMFA 4MPWA 5FAHA 9ESTA 3PB1E 3KHVA 1O3IA 2PW8H 3KIDU 2VIQA 3M5NA 5FCRA 1XUIA 1ZOMA 3SV6A 1E35B 4Y8XA 1XUHA 2PUQH 4DURA 1C2GA 1GBLA 1O2GH 1Z7KA 2XBYA 1BUIA 1NPMA 1C2LA 3A7YA 4Y8YA 2STBE 2EI6A 2ESTE 1V2KT 4JZIA 1PQAA 2FI4E 2UUKB 1H4WA 3PLBA 1IQGA 2OP9A 5JBTA 3SHCH 2ASUB 3P6ZB 3SGAE 3SU6A 3RP2A 5E2PA 1MTSA 1VITF 3LC5A 4KTUA 1ELTA 1HNEE 1O2YA 3HK3B 1WTGH 1AGJA 5DP5A 5JBAS 2ALVA 3SJ8A 1EP5A 5FPTA 4SGBE 4JK6A 3BEFB 1MKWH 3LPRA 2JH6D 1J9CH 1FQ3A 1B0FA 2AIPA 4ZXYH 1IHTH 3LGVA 1MKXH 1YLCA 3OY6U 1AB9B 3ZVDA 2O8MA 3HGPA 1N6XA 1BHXF 2AS9A 4GCHG 3SJ9A 1LCYA 3QZQA 2PKAB 1FONA 1FXYA 1UHBA 2BZ6H 3ESTA 5T6GA 1FY5A 1RIWC 1SR5C 2ZZUH 3ZVEA 3SHAH 5BRRE 3VFEA 3NPSA 1RFNA 1NFXA 2ZU4A 1SGCA 1TFXA 1KLJH 4X8SH 3SV9A 2D26C 1DY9A 1A5HA 1OWHA 1P03A 1BCUH 3I78A 2HPQH 3A80A 2ZG0H 2FOEA 1NY22 1ELEE 1VJ9U 5K0HA 2VIOA 3M3TA 1GI1A 1SQAA 4FUFA 5FBEA 3RC5A 3EA9A 3MH4A 2K1QA 3A7WA 2BY6X 3TH3H 2ZEBA 1BITA 2J92A 3GCHB 1TONA 4GLYA 4Y7BA 5A09A 1ZHPA 1UTNA 1O3HA 1UTQA 1F5RA 1P2IA 2EA3A 2OD3B 4KP0A 1BB0B 5AVDA 1Z71A 4WMDA 5JB9S 1JWTA 3BG4C 3RXDA 4IS5A 5C1UA 1WOFA 1XUKA 3RXBA 4NSVA 1F0TA 3GCOA 2XYAA 4K8YA 1E36B 4NFEA 3BTME 1QL8A 2ZHDA 3M5MA 4XBDA 6CHAC 5EXMA 1G3EA 1LO6A 1TWXB 5DKMA 1O2PA 3CS7A 2Z3DA 3ZZCA 5F8XA 1V3XA 2FWWA 5K7RA 3BTHE 1T8NA 4NG9H 3RMMH 3ZZ3A 2BVRH 4D8NA 1K21H 4IN1A 3TGJE 2FX6A 1EAWA 1ESTA 1LVOA 3LOXA 1FIWA 1PPZA 2A4QA 2B9LA 1O5EH 3TGKE 5LPFA 4ABBA 1ZRBA 4IMQA 1KXBA 1TPPA 4ABJA 3SGQE 2R0KA 3QX5H 5FXLA 3M37A 3RXJA 1H8IH 2SGEE 1CGHA 4ZKNU 1D6RA 2VVCA 4YT6H 2YOLA 3MU4A 3PMJA 1FPCH 2Z9IA 3OYPA 3P8OA 5EQRA 5EXLA 3V3MA 1GJ7B 4FUGA 4Y6DA 1K1PA 3RU4D 1O3FA 3M5LA 4YLUA 5HM9A 3RXEA 1V2UT 1CVWH 2P8OB 1TRYA 3OSYA 2GCTC 2SFAA 1GI7B 2GV6A 1GBHA 1TAWA 4IC6A 1FI8A 4INLA 4B2AA 1HDTH 1YPMH 3LGUA 3GYMA 1H9IE 4D76A 2LPRA 4TWWA 4BNRA 3T62A 4X8VH 1UTLM 3SI3H 3MI4A 2A7JA 1KSNA 1O3DA 1FAKH 1LTOA 5A0CA 1EPTC 3K65B 1O35A 2PSYA 3I77A 4ZUHA 1GI2A 5EU8A 2F9PA 3SN8A 1O2NA 3WY8A 1C5LH 3KQDA 3SUFA 1QL7A 1VGCB 1EJMA 2PLXA 4MTBA 4AB8A 3RU4T 1FY4A 3MU1A 1P2KA 1PQ8A 4ZXXH 1K1NA 1TNKA 2OCVB 1YCPM 2FOBA 5GXPA 2OINA 3GDUA 1TA6A 1A3BH 2PSXA 2GZ9A 3PWCA 3Q3YA 1HPGA 1PPBH 1EOJA 2VVUA 3A87A 3RXPA 1TLDA 2ODYB 2F9OA 1G30B 4MVNA 1O5AB 1SHYA 3UIRA 4XDEA 2OC1A 1ETSH 1BRBE 1QNJA 2BDCA 4MPUA 2RA0A 1BBRE 2Y7ZA 1Z1IA 2OC8A 3DA9B 2ZFSA 3F9HA 1CBWB 4K60A 3GDVA 1W3CA 4MPXA 1LVBA 2AYWA 2CXVA 4NA7A 1VITG 2EEKA 2ZU3A 4JZ1A 5EPYA 5EXNA 3U8OH 1AY6H 1LDTT 1P8VC 4R0IA 2FTMA 4GHTA 4D7GA 1GJ6A 1DLKB 5AFYH 1SLVB 1GCTB 1DUAA 1L4DA 1ESAA 2EI8A 4BTUB 2AFQB 1EB2A 8GCHF 1SL3A 2VVVA 2C8WB 5FBIA 1VCQA 1TQ7B 4DW2U 5A8YA 2F9BH 1MQ5A 3RM2H 4Y8ZA 1C1QA 3LJOA 5E8EH 3L33A 1FY3A 1T8MA 3ZZ4A 3DFJA 2AH4X 7GCHF 2ZDLA 1GJCB 3GCNA 1IQJA 1A2CH 3LKWA 2BQ6B 2G81E 1BDAA 1XXDA 3PMBB 1V2WT 1Z8GA 1ANCA 1ELCA 3LC3A 1ZTJA 2Y5GA 1K1IA 3B8JA 1Z8JB 2UWPA 1ZZZA 2ILNA 1GHAF 3OX7U 2BY5X 4TY6A 2ZKSA 3PMHB 5C1XA 2UUYA 1UCYH 1F0RA 3M7TA 1TOCB 2TIOA 1ELAA 2CN0H 1PPCE 3E6PH 5EPNA 4A1XA 2Y80A 3S0NA 1SI5H 1C1NA 2XWBI 3MNSA 1MAXA 3RXFA 2VB0A 2HNTF 4I8GA 5E0GA 2Z9JA 1IQHA 1OS8A 2Z3EA 2SGAA 1TOMH 1HAYB 1GHBF 1TIOA 3QDZB 4OS1A 1CHOF 1Y3UA 1V2MT 3ZYDA 1E38B 2FOAA 3A82A 1O3PB 4A5TS 4BTTB 4DIHH 3JZ1B 3RXMA 1PYTC 2GKVE 1OKXA 1ZMJA 2GMTB 1WSSH 2Z7FE 1YP9A 3VXEH 3SNAA 1S82A 1F0UA 4CH2B 2FOGA 2IOTA 3VB5A 3GCTF 1UVTH 1THPB 1IQKA 1S5SA 1INCA 1XVMA 1PFXC 2BDAA 4CRCA 4YM9A 2GTBA 1TB6H 1O2IA 1AE8H 1NN6A 2Q6FA 2XCNA 4B2CA 1LHFH 2Y81A 4D9QA 1GDUA 1MQ6A 2RG3A 1BHXB 1NU7B 3DD2H 4B71A 4QT8C 3VXFH 4JZDH 1V2RT 5I46H 5FPSA 1JBUH 3M3VA 1WU1A 2C4FH 1G37A 3Q00A 1KLTA 1JIMA 1TNGA 2FXRA 4Y11E 4ISOA 1GGDB 1SGRE 4OS5A 3HKIB 1IAUA 5HMAA 1RGQA 3M7UA 1H8DH 2SGPE 3MO6A 3TVJB 4DCDA 2UUJB 4UFEH 1IOEA 4MNYA 2Q6DA 3V0XA 2V3HH 2Y6TA 4HGCA 1O3EA 3SOSA 4E7RG 4K69A 1NFUA 5SGAE 2BB4A 3MHWU 2ZFTA 1ETTH 2OC0A 3GY2A 1AI8H 1P12E 1BMAA 1P2OA 2P94A 3FZDA 1IQFA 2G55A 5F6MA 4K2YA 1P3CA 1KDQA 2IJOB 2BOKA 2QAAA 1V2ST 3TK5A 4WH8A 1WTHD 2ZI2H 3BTFE 2BD4A 1C5NH 2VGCB 2BX4A 1F0SA 2H5CA 2SNWA 2ZFPH 1YM0A 4U32A 5BPEA 1BTHH 6LPRA 1O3JA 1C2JA 4AOQA 1ZMNA 3O8DA 1BZXE 5AF9H 2QA9E 1CE5A 1L1JA 1LQDB 3PYHA 1SOZA 3P92A 2KAIB 2IPHA 1ETRH 1O2MA 1AKSB 1SQOA 5TCAA 1GI6A 1BRAA 3L6PA 1EQ9A 1O3LA 5CMXH 2XBVA 4ZAEA 1P09A 2YNBA 2P59A 3ZZ6A 1L1NA 2PGBB 2VWOA 4B75A 3U9AH 2QXIA 1UJ1A 1P05A 1OWKA 5HGGA 2BM2A 5GPIB 2A0QB 2ZDMA 3PTNA 2FYQA 4TPYA 3P8FA 2A7CA 1FN6A 3P95A 2ANKH 1DS2E 2I6QA 1AFQC 2WPHS 5L2YH 1V2TT 4K1SA 1B5GH 4ZHAA 1HV7A 5LGOA 5JBCS 2V6NA 2ZTYA 1KXAA 2BDIA 1OWIA 1XUJA 1O0DH 1V6DA 1O2VA 3R3GB 4FU8A 2VWNA 2F9VA 2XC5A 1SVPA 4KGAA 1BOQA 1ANDA 1OYTH 2WPJS 1AVWA 1BTYA 2O8TA 1DX5M 1V2VT 4YLQH 1MBQA 3MMGA 3KCGH 2ZIQH 1TX8A 4SGAE 4B73A 8GCHG 1NESE 3GCHC 3A86A 1EZSC 2FLBH 1YYY1 1W12U 2BXUH 1DWCH 4ZHMU 1BTUA 1ABJH 4INKA 4OGXA 3U98H 1DITH 1ZPCA 1V2JT 4WWYA 2ZP0H 4RKOB 4Y79A 5JBBS 1HAOH 1Y3YA 2YNAA 4CRAA 4BAOB 1GJ8B 3ZVGA 1ZR0A 5JDUB 4RKJB 2J2UA 2FX4A 3VB4A 2AMQA 1THSH 1O3GA 1HJ8A 2BVXH 3A7XA 3NXPA 7GCHG 1DWBH 1QQUA 5ABWA 1Y3XA 6ESTA 2QY0B 1MTWA 1RD3B 1DXWA 4X6MA 1QJ1B 2THFB 1MZAA 2HVXA 1ZJDA 3BF6H 4ISHH 1TGTA 4CHAB 3QLPH 5JB8S 4FUIA 4TYDA 3SNCA 2P93A 4OS7A 2SGQE 3TNTA 1XMNB 1GHAG 3MYWA 1W2KH 1HJ9A 2A2QH 1A1RA 1RTKA 1WYKA 2H9TH 1UTOA 3BTTE 3RXHA 4ZKOU 2NU3E 3A88A 1FV9A 1K2I1 9LPRA 2WPIS 3AW0A 1CA0B 4XE4A 4DIIH 1B7XB 1P3EA 3ZZ8A 3HPTB 3A85A 4IC5A 1T4VH 4NA8A 5DP9A 2BTCE 1GJ4H 2XTTB 3O8BA 4FUJA 1ZGIA 5GIBA 4AB9A 4ZMAH 3MTYA 3QTVH 1YC0A 1DOJA 1P02A 2WYGA 2OQ5A 1GG6C 3F9FA 5C5NA 1O5GH 2ZFRH 3MH7A 1O2WA 1SGTA 2GX4A 4MNWA 1BBRH 2AGGX 1C1RA 4XOJA 4D7FA 3KQBA 1GHBG 1UMAH 4IW4E 3BTKE 2JH0D 3SU0A 4AZ2B 1AWFH 1G36A 2C3SA 1CHOG 4I8LA 2ZGJA 2P8OC 2ZU2A 1O2UA 4CRFA 3QN7A 1YF4A 2VWLA 3E91A 2PWXA 1ELFA 1QY6A 1SGFA 1H1BA 1J16A 3VB7A 1H9HE 1K1OA 2BLQA 5L30H 2FI3E 1EZQA 2ZDAH 3GCTG 2C90B 4KKDA 2GT7A 1UK4A 1ESBA 1EP6A 1KYNA 1N8OC 2TGTA 1Y59T 5C67A 1QGFA 1Z6JH 2BHGA 1BJVA 4ESTE 1NRNH 2GDEH 2G00A 1IQIA 1GHXH 1FLEE 2Y7XA 3LJJA 1NZQH 1GMDF 1GJAB 2W26A 2ANYA 1SLXB 1BIOA 1QL9A 1EJNA 1C5OH 1FUJA 2XBWA 1O2ZA 2CJIA 3BV9B 4NIYA 2BY9X 1ORFA 5LPEA 3LH3A 3VB3A 3FANA 1T7CA 1VJAU 4BTIB 3M36A 1HJAC 1O32A 2QGRA 5DGJA 5FX5A 8ESTE 3F9GA 1NRSH 3T29A 1PPGE 4HTCH 4THNH 2A1DB 3GY5A 2OXSA 4MNVA 5ESBA 4OS4A 1QBNA 3SNEA 2ZPRA 1X7AC 5L2ZH 1A7SA 1WV7H 3UQOA 3MU5A 1LVMA 4TWYA 1U6QA 3GY4A 3GY6A 1EZXC 1CBWC 3E90B 3HATH 1O2QA 3B23B 2CV3A 1O5FH 3EQ0H 1PPHE 1DY8A 2WUBA 2OTVA 5CHAB 2BYAX 2ZECA 4WVPE 1W7GH 3MOCA 1FIZA 4H6SB 1SLWB 3BIUH 1F2SE 2ZHEH 2BDHA 1GBDA 3UPEA 4K8BA 3KGPA 1MTNB 2NU1E 2RA3A 4MQAA 2A2XH 2VIPA 5C20A 4ZHLU 1AO5A 3RXTA 1Z6EA 1C4Y2 4WJG2 1J14A 1P06A 4Y71A 1F5KU 1SMFE 3RLWH 2WV5A 3UTUH 1AQ7A 1O2HA 3ZZ7A 1N6YA 2ALPA 2FLRH 4NFFA 4FUBA 2ZCHP 2AEIH 3S7HB 2QF3A 1XKAC 4X8UH 3STJA 3DT0H 1DICA 1IQNA 1S83A 3ZYEA 2PV9B 1BQYA 3GYLB 1P2NA 1KXFA 5HXFA 4WXVA 4BOHA 1ELBA 4CBOA 1C2DA 1S6HA 4XBCA 5DG6A 4O3UA 3T26A 4FUEA 2WINI 2XNIA 4R8TB 1W0ZU 2B8OH 1H9LB 4PROA 4IMZA 1AFEH 2JETC 1EASA 3EYDA 1EZUC 4JK5A 2BMGB 1O2SA 4AYYB 1C2KA 4NSYA 4JZFH 1UVOA 3LGYA 2HLCA 3K6YA 1GI8B 2WPMS 3K6ZA 1XM1A 1MU6B 1AUJA 3SU5A 3TJNA 1C5VA 4AG2A 2DE9A 4CH8B 2V3OH 3UFAA 1XX9A 2G52A 3A7ZA 1ANBA 2Q6GA 3V12A 4AYVB 1DVAH 1HIAB 1T8OA 2UUFB 1G3DA 4Y7AA 2HOBA 4IN2A 8LPRA 1O30A 4JCNA 2NU4E 2TGDA 2BD3A 2PKSC 4K1TA 5L6NH 3UY9A 3OY5U 4UFGH 2SGFE 2BVSH 4K5ZA 3UNRA 1QB6A 1EOLA 3ATLA 3P70B 3S9CA 1SC8U 5GJ4B 3VGCC 4K3JA 1RIWB 1JOUB 4ZKRU 2VJ1A 3ENSB 4I8HA 3MNBA 1CT2E 2V0BA 4ISIH 1XUFA 2Y5FA 4U2WA 1C1MA 4M7GA 2Z94A 2BQWB 2O9QA 1Y5AT 3SNBA 3S9BA 3FAOA 4AFZA 2Q1JA 1CU1A 1UK2A 1TQ0B 1P01A 1LHEH 2GZ7A 3ZZBA 3IWMA 1VZQH 1LVYA 1TRMA 4GHQA 5FHTA 3GY8A 1DM4B 2CHAC 3KN2A 4O97A 4D9RA 1LPGB 2Y82A 4X6NA 1UVPA 5A0AE 3TIUA 1O2JA 2FMJA 3UWIA 1E34B 5E2OA 2AIQA 2BXTH 3RXKA 3TH4H 3BG4B 1DT2A 2C93B 2Y5HA 1F92A 2FOFA 4U01A 1MKWK 2GP9B 1DSTA 2B7DH 2FIRH 2F9NA 1MKXK 3F1SB 1CT4E 1YLDA 1HAXB 3RMLH 1TGSZ 3DFLA 4WF8A 1SHHB 3KEEA 1SPJA 1Y8TA 3SJKA 1O39A 1TA2A 4I33A 1OX1A 2WUCA 3RDZA 6CHAB 2J34A 1AHTH 3BN9A 1EX3A 1CQQA 3KF2A 4X6PA 2F83A 4TPIZ 4BAQB 2WYJA 1C1OA 3VPKA 4ABAA 4MNXA 5F8ZA 1GMDG 1S85A 3PV4A 2P3TB 3ATWA 4DOQA 1RS0A 3FZZA 2ANMH
chains in the Genus database with same CATH superfamily
3BTQE 2GD4B 3MFJA 2ZDNA 2P3FH 2FDAA 4Q4LA 2ZGCA 5ESTE 5C3NA 2WPKS 4ISLA 1O33A 2XRCA 4B6FA 1IQMA 1HFDA 1O3NA 1UO6A 4DY7B 5GWZA 1YKTA 4NWKA 1GL0E 2TGAA 3E0NB 3RXOA 3IG6B 3PWBA 4X0WU 1GMCG 2PUXB 2A4RA 1AIXH 2ZCKP 1ZGVA 2ULLA 2C8XB 3IITA 1D3DB 1P9UA 1Z8IB 3LU9B 1ABIH 2HGTH 2RCEA 5C5OA 3A89A 1K9OE 3SV7A 1OYQA 1OWEA 1TBQH 3E1XB 1C1PA 2GCTB 1O31A 3H09A 1ZSJA 1GBJA 5HM2A 2FEQH 2A31A 1OPHB 3Q76A 4YOJA 2A5KA 2NU2E 1YCPH 3N99A 1O5BB 2W3KA 4FUDA 5J4QA 3FP8E 4CBNA 1P2JA 4WY3A 5IYTA 3BSQA 3GISB 2WPLS 1EPTB 3ZZAA 3MO9A 1EUFA 1P11E 1VCWA 2V35A 5DP8A 4VGCC 5ETXA 2FM2A 1MU8B 2JDID 1TGBA 1SGNE 1C9PA 1MD8A 1AVXA 2HPPH 1A5GH 1D4PB 3NKKA 2C8YB 4OS6A 4XFQA 3LGIA 2PTNA 2QF5A 1QRXA 4UD9H 1MTUA 1N1LA 2BDYA 1O2LA 1SKYE 3BTDE 1O2TA 1QCPA 4E7NA 3KL6A 2O8WA 3UR9A 4KTCA 3VG8A 2D2DA 2VH6A 2QXJA 4XRNA 1HUTH 3RMNH 3SU4A 5DP3A 1QBVH 5A2MH 2JH5D 3S69A 2VIDA 2A7HA 2EC9H 2I6SA 5IDKA 1BMMH 5AHGH 2D8WA 3EAJA 2ZFQH 1PQ5A 5F8TA 4CHAC 1CO7E 3RMOH 1FMGA 1A5IA 1W0KD 3NZIA 3U8TH 1W7XH 2W5EA 4YTAA 2OBQA 4UE7H 1TNHA 2Z9KA 1L1GA 1Y3WA 3T27A 2KAIA 2GGVB 2H6MA 4UEHH 1G3BA 1CA0C 1GHYH 1GI5A 1AKSA 1SGDE 2GVFA 1C5QA 4GVUA 1O2OA 3MO3A 3D49H 3U1JB 4Y0ZE 3TJVA 4DG4A 1ELGA 1S6LA 2QIQA 4Z6AH 1GBIA 1C5MD 1C4U2 1ZHRA 2ZU1A 2FTLE 1C1WH 5EG4A 1KXEA 2ZWLH 3A7TA 3OFND 1CHGA 3ZV8A 3RM0H 3P8GA 2QC2A 3KYFA 3C1KA 1GBTA 1HAZB 2LNCA 2IN2A 1UTJA 4U30A 1HYLA 4GPGA 4Y76A 1LHDH 1C1VH 1NO9H 1TMTH 3RXSA 3O8RA 1MCVA 2FZZA 3A81A 1K1LA 1A0JA 1TNLA 2GCHF 4HZHA 3RLYH 5HYOA 5DP7A 1ARCA 3H7OA 3TPIZ 4BANB 1QR3E 1C2IA 1L0ZA 4BAKB 1SB1H 3TK9A 4DVAU 2ZFFH 1TPSA 1MBMA 1WBGB 5EQQA 1HRTH 1A61H 1FPHH 1SGQE 2ZU5A 4ZROA 4LXBH 1AB9C 1NU9A 1HGTH 3ZVFA 1WQVH 1DLEA 1C4V2 1FAXA 2F91A 2K8IA 3ATIA 3BEIB 3I29A 5EW2H 3RXVA 5T3HA 2EI7A 3RXUA 1JRTA 2F4LA 1AE5A 1K22H 3TGIE 1SFQB 3BEUA 1BMFD 1C9TA 2QYIA 1YGCH 3HGNA 3NK8A 2QV1A 4ABGA 4BAMB 2P16A 4YZUA 1HAGE 4JZEH 4I7YH 3PTBA 2XW9A 2J97A 3TJOA 3ZZ9A 3A83A 2H1UA 1IQLA 1DDJA 1V2LT 2ZGBH 3E3TA 1W14U 5G4BA 3KQEA 4AG1A 2ZTXA 1PQ7A 1HAVB 1OWJA 1KY9A 1QQ4A 2VH0A 1S6FA 1UW7A 2L74A 1GPZA 2A4GA 1MABB 3OTJE 1GHWH 4I8KA 2O8UA 1BRCE 3CS0A 1HXFH 1C2EA 1GBBA 2VIWA 4FU9A 2R0LA 4YOIA 2BY7X 2A45B 1NRPH 5CHAC 1BT7A 1BJUA 1DXPA 3W1EA 2ZHFH 4DT7B 1TPOA 1PJPA 3F9EA 1AMHA 1QRZA 3ELAH 4CR5A 1PYTD 4NCYA 3GY3A 4B76A 1WDIA 1KIGH 1WUNH 1MTNC 1QBOA 4NWLA 1CT0E 1P2MA 2VWMA 1IQEA 5T6FA 1UCYK 1O3BA 3ODDA 4I8JA 3SU3A 1BTZA 1ZPZA 4ZH8A 1VCPA 1L2EA 3E8LA 1VKYA 1O3AA 3U69H 2DUCA 1ZMLA 2JIZD 5C1YA 1C1TA 1SGFG 1EB1H 1NC6A 2H2ZA 1DWDH 4F48B 1ZTKA 1GMHF 1A4WH 1Z1JA 1AZZA 1C2MA 2OC7A 2BX3A 2FOCA 2BD2A 2ZQ2A 3RC6A 1YPHC 1DUEA 3T2NA 1YCPK 2PKAA 3PV2A 3QO6A 4O03A 1O5DH 1GBKA 3T25A 4CR9A 7LPRA 1MCTA 5E0HA 3RU4E 1D3PB 4YO9A 4LZ4B 5DP6A 5EOKA 3SV2H 2STAE 1AVGH 2FPZA 5FX6A 1J15A 3RXRA 3GDSA 4RI0A 3EA8A 5EGMA 1NS3A 2O8LA 5LH8A 5KGOA 4NA9H 3KQCA 1HBTH 1G3CA 3L3TA 3T5FH 2AERH 1YPHE 3DUXH 4UDWH 4E06H 2J4IA 2WZQA 3TK6A 1DPOA 2AGEX 1OP0A 3QZRA 1P04A 3A84A 3ATMA 1EAIA 2ZCLP 3ZV9A 3N7OA 4CRDA 4J2YB 1MH0A 1C5WB 3SJIA 2R3YA 4GAWA 3ZVAA 3A8BA 5DO4H 1VGCC 3SO3A 1ELVA 2HWLB 3URCA 4WH6A 1Y3VA 3V13A 1GHVH 3DSGA 1V2PT 2FO9A 3SI4H 2ZHQH 5DPAA 1GJ9B 1AWHB 1NFYA 1YY3A 3GOVB 4FVBA 1GBCA 2FP7B 3PRBA 1TRNA 3TU7H 5EJZA 3AAUA 1GMCF 1E37B 3D62A 5HIYA 1W0JD 3FP7E 1A3EH 3G01A 5GDSH 1AFQB 2G4UA 1LPZB 2KCYA 2A4OA 1UTPA 1PPEE 1V2OT 3QUMP 3QWCH 3SU1A 3UAIC 4ASHA 1BTWA 1B0EA 1SOTA 4ZKSU 1GWAA 2V3MA 3BIVH 3NCLA 1J8AA 3OEHD 5T1VA 1QJ6B 2AHME 3QK1A 4NIXA 1G2MA 2A5AA 2ZGXH 4ABEA 1QTFA 4YESB 4AORA 3O8CA 5FPYA 1XXFA 4CREA 2UWLA 3BG8A 1ANEA 2ZDVH 4IGDA 1QHRB 4X1NU 4I31A 3OEED 4YT7H 3MU8A 3M35A 5PTPA 1D3QB 3TITA 1UHBB 3ODFA 3K2UA 5AFZH 1NT1A 1SGEE 1SBWA 3N7EA 2AGIX 5GCHG 4X2XA 2Z9LA 1GCTC 3D65E 4OS2A 1WCZA 1YPLH 3RXGA 1EATA 1QIXB 2CMYA 3PO1B 3S7KB 1TABE 1O37A 2ODPA 4Q7ZA 2GCHG 4H42U 4Z0KA 5LPRA 1HAPH 1DFPA 2Z9GA 3BTWE 1ZJKA 3AASA 4H4FA 4P00A 1CSOE 1UVSH 1JRSA 1THRH 2R2MB 1HXEH 4FETA 2VNTA 1A0HB 1MMJN 2ZO3H 3FFGA 4I32A 1FNIA 2A5IA 1UTKA 2BLWA 1AD8H 4FVDA 1TALA 1SFIA 1ID5H 4AX9H 1MTVA 4ABDA 2R2WU 3AAVA 1W13U 1IHSH 1HIAA 3RXAA 1TE0A 2BDBA 2CGAA 3D23A 2PFEA 1DWEH 3UUZA 1O3KA 1AU8A 1C1UH 2BOHB 4NZLA 1ACBE 3HKJB 4TSFD 3UREA 4BXSA 3SUGA 1TBRH 2W7UA 1P9SA 3JZ2B 2P3UB 2OLGA 3F0OA 1GG6B 2FESH 3K9XB 4Q80A 2NWNA 2B0FA 4INHA 2PGQB 1OOKB 1FY8E 2AMPA 1BMLA 1LQEA 4Q7YA 3U8RH 5FCKA 1J17T 4X2WA 3M7QA 2ZPSA 3P8NA 3V7TA 1P0SH 1WAYB 4JYVH 3RXQA 1ZPBA 1BA8B 1BTPA 1F5LA 1C5XB 2J9NA 4K1EA 3NUMA 3URDA 1M9UA 1FN8A 2BD5A 1O2XA 5EJLA 1SSXA 2OUAA 2GMTC 4TY7A 1LMWB 1MZDA 4AN7A 3SGBE 2W7SA 1SGIB 1F7ZA 1N8OB 4ABHA 2GDDA 1ZLRA 2F3CE 5KECA 1W10U 3RXIA 1NRRH 1SG8B 1JIRA 2EQNA 1FY1A 1L4ZA 2XC0A 1NM6A 2GV7A 1QRWA 3OU0A 2J95A 1ZYOA 3GY7A 3LH1A 3W95A 1GBFA 3SW2B 2RDLA 1Z8RA 5FL7D 1JXPA 1O2RA 1BTXA 7ESTE 1EFRD 5I25A 2FYRA 1SQTA 1NFWA 4B2BA 1QB1A 2ZTZA 1GI0A 3MH6A 3PLKA 4X1PU 3CNRA 3TH2H 1UK3A 3AVZA 1HJAB 4MG3A 2SNVA 4RN6A 4ABFA 2WPDD 1TGCA 5TCCA 2J94A 1BBRK 4AGJA 2BZAA 1GMHG 2HRVA 1CGJE 1LPKB 4XBBA 1OSSA 3NWUA 2TBSA 1XUGA 4A1TA 1YPGH 1GGDC 2GT8A 4JYUH 2P95A 2QF0A 3TLOA 3UWJH 3HK6B 3ZZDA 1GL1A 5CDFE 2UWOA 3CENA 4LZ1H 1O3MA 1TYNA 1KTSB 3BTEE 2FOMB 5A8XA 3QGJA 5E0JA 4B1TA 1YPEH 3SQEE 2PTCE 4WMEA 3UOPA 4IBLH 3EDXB 1HCGA 3A7VA 1O3CA 3PM3A 3FP6E 1FJSA 2CF9H 1OP8A 2A32A 1UTMA 4CRBA 1TMUH 5DK1A 4OM9A 4HFPB 4X1QU 1KLIH 3FVFB 2GJGA 4UFFH 1GHZA 1SLUB 3TJUA 3DHKH 3ITIA 1DSUA 2K0QA 1KTTB 1G2LA 3EE0B 2VGCC 2XCFA 2R9PA 3SQHE 1TMBH 1HAHH 1OP2A 1O3OA 1GBMA 3EGKH 4Y0YE 3UB0A 3E16B 1H8HD 1GVZA 3AW1A 3ZVCA 4FU7A 4LK4A 3H7TA 3ZZ5A 1PPFE 1HB0B 1RJXB 2W6ID 4ISNA 3RC4A 3A8AA 2H9HA 1JMOH 5C2ZA 1Y5UT 4Q2KA 2QXHA 3VEQB 4AFUA 1GBEA 1Q2WA 2AMDA 3GICB 1O5CB 3SV8A 3F3BA 4ZCNA 3F68H 3SBKA 2BQ7B 4YOGA 4FUHA 4E05H 3F6UH 1OWDA 6GCHF 4FUCA 1EPTA 3P17H 3MNCA 3SJOA 3A8CA 3EE7A 5B6OA 1LHCH 3QGNB 1GJBB 2QXGA 4ABIA 4A1VA 3LONA 2G5VA 1YWUA 1T8LA 2EY4C 5H4IB 2JETB 1W8BH 1HLTH 1EXFA 2YMSC 1EKBB 5EQSA 4F49A 4DJZB 2FI5E 2XNDD 1OXGA 4WXIA 3M61U 1Q31A 4MPVA 1TNJA 3Q77A 1NROH 1FZZA 1ZSLA 3Q3KA 2B5TB 2VIVA 5DN6D 3ATKA 3BTGE 4AFSA 3WWFA 1W0YH 1K28D 2BLVA 2TPIZ 1EAUA 1GBAA 4X1RU 3VB6A 1D9IA 4NGAH 2FOHA 2H5DA 4OGYA 2QCYA 4J1YA 1C5ZB 4GSOA 2PKSB 1DE7H 4X6OA 1P57B 2BY8X 5TJXA 1W11U 1E0FD 3SNDA 1FDPA 4DGJA 4F4OC 4MLFB 3LGWA 1BMNH 2BLOA 3VGCB 3R0FA 1C2HA 1T4UH 4UFDH 1O38A 1NBMD 1V2NT 4GCHF 4NZQA 2FS8A 2NU0E 1BRUP 4I86A 1GVKB 1T32A 3FKSD 3KNXA 4A6LA 4CRGA 4Y10E 1S81A 3B9FH 3OE7D 1ELDE 1QJ7B 3PLPA 1GI9B 4A7IB 1GCDA 3SORA 3U1IB 2VINA 2Z6BD 1LKBA 1TNIA 1A0LA 1UVUH 4A92A 3W94A 1RRKA 1ZSKA 1MD7A 1O2KA 2CHAB 2H9EH 1AN1E 1RXPA 5EW1H 3QTOH 3CP7A 5CE1A 3OAAD 1TGNA 1C5PA 1ZHMA 5J4SA 1NTPA 2OQUA 4KELA 1XVOA 1CA8B 1T31A 4MDSA 1D3TB 1GDQA 3PROA 4JYTA 1P2QA 5JPMH 5GCHF 1RTLA 1SGYE 2ZC9H 1YLNA 3RXCA 3SUEA 4JMYA 2ZPQA 1AZ8A 4Q7XA 1AUTC 3LDXH 1SGPE 2G5NA 4X8TH 3LGTA 1GDNA 8KME2 3SUDA 3E0PB 5T6DA 5DJ7A 2XWAA 2WV4A 3UR6A 1RTFB 3SZNA 1C5YB 2ZQ1A 3RXLA 2ANWA 4NIVA 2ZHWH 1ARBA 1EAXA 1GI3A 3MNXA 3Q3XA 3MWIU 1SQRA 1K1MA 1C2FA 2QF4A 1K1JA 1EJAA 5JYIA 4AGKA 1P10A 1QB9A 3EA7A 1HAVA 2DE8A 2BD9A 2ZNKH 2ZDKA 1G32B 3A8DA 2R3UA 1WXRA 1GJDB 2ZA5A 1TX6A 2M5TA 4BAHB 4BXWA 2BD8A 4GUXA 3PMAB 2W3IA 2GZ8A 3S9AA 1KDQB 1S0QA 3H5CB 1NRQH 3STIA 1Q3XA 3MU0A 5F03A 3UQVA 3ZVBA 1YPKH 2PR3A 3UOUA 1S0RA 1C5TA 1TPAE 3FN8A 3MH5A 3KQ5A 1LKAA 4H6TA 2XBXA 2J38A 2TRMA 4RSPA 4UONA 1C1SA 1C5RA 4TT3D 2G51A 2JKHA 1CGIE 1MUEB 2FODA 1HAIH 1GJ5H 1QFKH 2C8ZB 7KMEH 4LOYH 1V2QT 2RDEA 4KTSA 1Y5BT 1VR1H 1A46H 2HNTC 1O36A 1GI4A 2XXLA 2TGPZ 2G4TA 1ZRKA 1S84A 1QA0A 4XSKU 2ZF0H 2YMSD 4VGCB 1DANH 2SGDE 1ZTLA 1C5UA 3SZEA 4X1SU 4B74A 1XKBC 5A0BA 1TX7A 2QN5T 4O3TA 2VU8E 4FXGH 3T28A 2Z3CA 2BDGA 1O34A 1OHHD 4AC9A 1KXDA 3PO1C 2FS9A 3M3SA 4AFQA 2HNTE 2XC4A 2PHBA 4X2YA 2ZGHA 1C5SA 3C27B 5A8ZA 1TBZH 3UNQA 1QURH 3UNSA 1WQSA 2G8TA 4X2VA 1MAYA 3LT3A 1QA7A 5EODA 1G9IE 1YBWA 3M5OA 6GCHG 3RUOA 4O9VA 3AK5A 2OBOA 1UCYE 2F9UA 1YPJH 1LHGH 2BD7A 2CF8H 3TNSA 2D1JA 1VITH 3LIWA 1KXCA 2HALA 5C17A 4HI3A 1D6WA 5DP4A 3SU2A 1GVLA 4NIWA 2ODQA 4WMFA 4MPWA 5FAHA 9ESTA 3PB1E 3KHVA 1O3IA 2PW8H 3KIDU 1COWD 2VIQA 3M5NA 5FCRA 1XUIA 1ZOMA 3SV6A 1E35B 4Y8XA 1XUHA 2PUQH 4DURA 1C2GA 5C0TA 1GBLA 1O2GH 1E1RD 1Z7KA 2XBYA 1BUIA 1NPMA 1C2LA 3A7YA 4Y8YA 2STBE 2EI6A 2ESTE 5DSFA 1V2KT 4JZIA 1PQAA 2FI4E 2UUKB 1H4WA 3PLBA 1IQGA 2OP9A 5JBTA 3SHCH 2ASUB 3P6ZB 3SGAE 3SU6A 3RP2A 5E2PA 1MTSA 1VITF 3LC5A 4KTUA 1ELTA 1HNEE 1O2YA 3HK3B 1WTGH 1AGJA 5DP5A 5JBAS 2ALVA 3SJ8A 1EP5A 5FPTA 4SGBE 4JK6A 3BEFB 1MKWH 3LPRA 2JH6D 1J9CH 1FQ3A 1B0FA 2AIPA 4ZXYH 1IHTH 3LGVA 1MKXH 1YLCA 3OY6U 1AB9B 3ZVDA 2JJ1D 2O8MA 3HGPA 1N6XA 1BHXF 2AS9A 4GCHG 3SJ9A 1LCYA 3QZQA 2PKAB 1FONA 2WSSD 5C94A 1FXYA 1UHBA 2BZ6H 3ESTA 5T6GA 1FY5A 1RIWC 1SR5C 2ZZUH 3ZVEA 3SHAH 5BRRE 3VFEA 3NPSA 1RFNA 1NFXA 2ZU4A 1SGCA 1TFXA 1KLJH 4X8SH 3SV9A 2D26C 1DY9A 1A5HA 1OWHA 1P03A 1BCUH 3I78A 2HPQH 3A80A 2CK3D 2ZG0H 2FOEA 1NY22 1ELEE 1VJ9U 5K0HA 2VIOA 3M3TA 1GI1A 1SQAA 4FUFA 5FBEA 3RC5A 3EA9A 5EJ1A 3MH4A 2K1QA 3A7WA 2BY6X 3TH3H 2ZEBA 4B6EA 1BITA 2J92A 3GCHB 1TONA 4GLYA 4Y7BA 5A09A 1ZHPA 1UTNA 1O3HA 1UTQA 1F5RA 1P2IA 2EA3A 2OD3B 4KP0A 1BB0B 5AVDA 1Z71A 4WMDA 5JB9S 1JWTA 3BG4C 3RXDA 4IS5A 5C1UA 1WOFA 1XUKA 3RXBA 4NSVA 1F0TA 3GCOA 2XYAA 4K8YA 1E36B 4NFEA 3BTME 1QL8A 2ZHDA 3M5MA 4XBDA 6CHAC 5EXMA 1G3EA 1LO6A 1TWXB 5DKMA 1O2PA 3CS7A 2Z3DA 3ZZCA 5F8XA 1V3XA 2FWWA 5K7RA 3BTHE 1T8NA 4NG9H 3RMMH 3ZZ3A 2BVRH 4D8NA 1K21H 4IN1A 3TGJE 2FX6A 1EAWA 1ESTA 1LVOA 3LOXA 4RT1A 1FIWA 1PPZA 2A4QA 2B9LA 1O5EH 3TGKE 5LPFA 4ABBA 1ZRBA 4IMQA 2OK5A 2KM0A 1KXBA 1TPPA 4ABJA 3SGQE 2R0KA 2J98B 3QX5H 5FXLA 3M37A 3RXJA 1H8IH 2SGEE 1CGHA 4ZKNU 1D6RA 2VVCA 4YT6H 2YOLA 3MU4A 3PMJA 1FPCH 2Z9IA 3OYPA 3P8OA 5EQRA 5EXLA 3V3MA 1GJ7B 4FUGA 4Y6DA 1K1PA 3RU4D 1O3FA 3M5LA 4YLUA 5HM9A 3RXEA 1V2UT 1CVWH 2P8OB 1TRYA 3OSYA 2GCTC 2SFAA 1GI7B 2GV6A 1GBHA 1TAWA 4IC6A 1FI8A 4INLA 4B2AA 1HDTH 1YPMH 3LGUA 3GYMA 1H9IE 2J5UA 2LELA 4D76A 2LPRA 4TWWA 4BNRA 3T62A 4X8VH 1UTLM 3SI3H 3MI4A 2A7JA 1KSNA 1O3DA 1FAKH 1LTOA 5A0CA 1EPTC 3F2FA 3K65B 1O35A 2PSYA 3I77A 4ZUHA 1GI2A 5EU8A 2F9PA 3SN8A 1O2NA 3WY8A 1C5LH 3KQDA 3SUFA 1QL7A 1VGCB 1EJMA 2PLXA 2IPQX 4MTBA 4AB8A 3RU4T 1FY4A 3MU1A 1P2KA 1PQ8A 4Q63A 4ZXXH 1K1NA 1TNKA 2OCVB 1YCPM 2FOBA 5GXPA 2OINA 3GDUA 2XOKD 1TA6A 5C0UA 1A3BH 2PSXA 2GZ9A 3PWCA 3Q3YA 1HPGA 1PPBH 1EOJA 2VVUA 3A87A 3RXPA 2IJD1 1TLDA 2KFWA 2ODYB 2F9OA 1G30B 4MVNA 1O5AB 1SHYA 3UIRA 4XDEA 2OC1A 1ETSH 1BRBE 1QNJA 2BDCA 4MPUA 2RA0A 1BBRE 4Z1MD 2Y7ZA 1Z1IA 2OC8A 2KX4A 3DA9B 2VBCA 2ZFSA 3F9HA 1CBWB 4K60A 3GDVA 1W3CA 4MPXA 1LVBA 2AYWA 2CXVA 4NA7A 1VITG 2EEKA 2ZU3A 4JZ1A 5EPYA 5EXNA 3U8OH 1AY6H 1LDTT 1P8VC 4FOUC 4R0IA 2FTMA 4GHTA 4D7GA 1GJ6A 4ASUD 1DLKB 5AFYH 1SLVB 1GCTB 1DUAA 1L4DA 1ESAA 2EI8A 4BTUB 2AFQB 1EB2A 8GCHF 1SL3A 2VVVA 2C8WB 5FBIA 1VCQA 1TQ7B 4DW2U 5A8YA 2F9BH 1MQ5A 3RM2H 4Y8ZA 5F53A 1C1QA 3LJOA 5E8EH 3L33A 1FY3A 1T8MA 3ZZ4A 5KEDA 3DFJA 2AH4X 7GCHF 2ZDLA 4XD7D 1GJCB 3GCNA 1IQJA 1A2CH 3LKWA 2BQ6B 2G81E 1BDAA 1XXDA 3PMBB 1V2WT 1Z8GA 1ANCA 1ELCA 3LC3A 1ZTJA 2Y5GA 1K1IA 3B8JA 1Z8JB 2UWPA 1ZZZA 2ILNA 1GHAF 3OX7U 2BY5X 4TY6A 2ZKSA 3PMHB 5C1XA 2UUYA 1UCYH 1F0RA 3M7TA 1TOCB 2TIOA 1ELAA 2CN0H 1PPCE 3E6PH 5EPNA 4A1XA 2Y80A 3S0NA 1SI5H 1C1NA 2XWBI 3MNSA 1MAXA 3RXFA 2VB0A 2HNTF 4I8GA 2KCOA 5E0GA 2Z9JA 1IQHA 1OS8A 2Z3EA 3WW7A 2SGAA 1TOMH 1HAYB 1GHBF 1TIOA 3QDZB 4OS1A 1CHOF 1Y3UA 1V2MT 3ZYDA 1E38B 2FOAA 3A82A 1O3PB 4A5TS 4BTTB 4P02A 4DIHH 3JZ1B 3RXMA 1PYTC 2GKVE 1OKXA 1ZMJA 5GNDA 2GMTB 1WSSH 2Z7FE 1YP9A 3VXEH 3SNAA 1S82A 1F0UA 4CH2B 2FOGA 2IOTA 3VB5A 3GCTF 1UVTH 1THPB 1IQKA 1S5SA 1INCA 1XVMA 1PFXC 2BDAA 4CRCA 4YM9A 2GTBA 1TB6H 1O2IA 1AE8H 1NN6A 2Q6FA 2XCNA 4B2CA 1LHFH 2Y81A 4D9QA 1GDUA 1MQ6A 2W6JD 2RG3A 1BHXB 1NU7B 3DD2H 4B71A 4QT8C 3VXFH 4JZDH 1V2RT 5I46H 5FPSA 1JBUH 3M3VA 1WU1A 2C4FH 1G37A 3Q00A 1KLTA 1JIMA 1TNGA 2FXRA 4Y11E 4ISOA 1GGDB 1SGRE 4OS5A 2PP6A 3HKIB 1IAUA 5HMAA 1RGQA 3M7UA 1H8DH 2SGPE 3MO6A 3TVJB 4DCDA 2UUJB 4UFEH 1IOEA 4MNYA 2Q6DA 3V0XA 2KCPA 2V3HH 2Y6TA 4HGCA 1O3EA 3SOSA 4E7RG 4K69A 1NFUA 5SGAE 2BB4A 3MHWU 3F2GA 2ZFTA 1ETTH 2M2AA 2OC0A 3GY2A 1AI8H 1P12E 1BMAA 1P2OA 2P94A 3FZDA 1IQFA 2G55A 5F6MA 4K2YA 1P3CA 1KDQA 2IJOB 2BOKA 2QAAA 1V2ST 3TK5A 4WH8A 1WTHD 2ZI2H 3BTFE 2BD4A 1C5NH 2VGCB 2BX4A 1F0SA 2H5CA 2SNWA 2ZFPH 4F55A 1YM0A 2QE7D 4U32A 2LP6A 1BTHH 5BPEA 1O3JA 6LPRA 1C2JA 4DT4A 4AOQA 1ZMNA 3O8DA 1BZXE 5AF9H 2QA9E 1CE5A 1L1JA 1FX0B 1LQDB 3PYHA 1SOZA 3P92A 2KAIB 2F43B 2IPHA 1ETRH 1O2MA 1AKSB 1SQOA 5TCAA 1GI6A 1BRAA 3L6PA 1EQ9A 1O3LA 5CMXH 2XBVA 2HVYB 4ZAEA 1P09A 2YNBA 2P59A 3ZZ6A 1L1NA 2PGBB 2VWOA 4B75A 3U9AH 3PRDA 2QXIA 1UJ1A 1P05A 1OWKA 5HGGA 2BM2A 5GPIB 2A0QB 2ZDMA 3PTNA 2FYQA 4TPYA 3P8FA 2A7CA 1FN6A 3P95A 2ANKH 1DS2E 2I6QA 1AFQC 2WPHS 5L2YH 1V2TT 1K0HA 4K1SA 1B5GH 4ZHAA 1HV7A 2YMSB 5LGOA 5JBCS 2V6NA 2ZTYA 2HLDD 1KXAA 2BDIA 1OWIA 1XUJA 1O0DH 4M9FA 1V6DA 1O2VA 3DSPA 3R3GB 4FU8A 2VWNA 2F9VA 2XC5A 1SVPA 3PV5A 1BOQA 4KGAA 1ANDA 2L6OA 1E79D 1OYTH 2WPJS 1AVWA 1BTYA 2O8TA 1DX5M 1V2VT 4YLQH 1MBQA 2RFKC 3MMGA 3KCGH 2ZIQH 1TX8A 4SGAE 4B73A 8GCHG 1NESE 3GCHC 3A86A 1EZSC 2FLBH 1YYY1 1W12U 2BXUH 3U28C 1DWCH 4ZHMU 1BTUA 1ABJH 4INKA 4OGXA 3U98H 1DITH 1ZPCA 1V2JT 4WWYA 2ZP0H 4RKOB 4Y79A 5JBBS 1HAOH 1Y3YA 2YNAA 4CRAA 4BAOB 1GJ8B 3ZVGA 1ZR0A 5JDUB 4RKJB 2J2UA 2FX4A 4ACBA 3VB4A 2AMQA 1THSH 1O3GA 1HJ8A 2BVXH 3A7XA 3GS9A 3NXPA 7GCHG 1DWBH 1QQUA 5ABWA 1Y3XA 6ESTA 2QY0B 1MTWA 1RD3B 1DXWA 4X6MA 1QJ1B 2THFB 1MZAA 2HVXA 1ZJDA 3BF6H 4ISHH 1TGTA 4CHAB 3QLPH 5JB8S 4FUIA 4TYDA 3SNCA 2P93A 4OS7A 2SGQE 3TNTA 1XMNB 1GHAG 3MYWA 1W2KH 1HJ9A 2A2QH 1A1RA 1RTKA 1WYKA 2H9TH 1UTOA 2JJ2D 3BTTE 3RXHA 4ZKOU 2NU3E 3A88A 1FV9A 1K2I1 9LPRA 2WPIS 3AW0A 1CA0B 4XE4A 4DIIH 1B7XB 1P3EA 3ZZ8A 3HPTB 3A85A 4IC5A 1T4VH 4NA8A 5DP9A 2BTCE 1GJ4H 2XTTB 3O8BA 4FUJA 1ZGIA 5GIBA 4AB9A 4ZMAH 3MTYA 3QTVH 1YC0A 1DOJA 1P02A 2WYGA 2OQ5A 1GG6C 5IK2D 3F0PA 3F9FA 5C5NA 1O5GH 2ZFRH 3MH7A 1O2WA 1SGTA 2GX4A 4MNWA 1BBRH 2AGGX 1C1RA 4XOJA 4D7FA 3KQBA 1GHBG 1UMAH 4IW4E 3BTKE 2JH0D 3SU0A 4AZ2B 1AWFH 1G36A 1H8ED 2C3SA 1CHOG 4I8LA 2ZGJA 2P8OC 2ZU2A 1O2UA 4CRFA 3QN7A 1YF4A 2VWLA 3E91A 2PWXA 1ELFA 1QY6A 1SGFA 1H1BA 1J16A 3VB7A 1H9HE 1K1OA 2BLQA 5L30H 2FI3E 1EZQA 2ZDAH 3GCTG 2C90B 4KKDA 2GT7A 1UK4A 1ESBA 1EP6A 1KYNA 1N8OC 2TGTA 1Y59T 5C67A 1QGFA 1Z6JH 2BHGA 1BJVA 4ESTE 1NRNH 2GDEH 2G00A 1IQIA 1GHXH 1FLEE 2Y7XA 3LJJA 1NZQH 1GMDF 1GJAB 2W26A 2ANYA 1SLXB 1BIOA 1QL9A 1EJNA 1C5OH 1FUJA 2XBWA 1O2ZA 2CJIA 3BV9B 4NIYA 4HG6A 3FO8D 2BY9X 1ORFA 2KZ4A 3LH3A 5LPEA 3VB3A 3FANA 1T7CA 1VJAU 4BTIB 2V7QD 3M36A 1HJAC 1O32A 2QGRA 5DGJA 5FX5A 8ESTE 3F9GA 1NRSH 3T29A 1PPGE 4HTCH 4THNH 2A1DB 3GY5A 5HKKD 2OXSA 4RT0A 4MNVA 5ESBA 4OS4A 1QBNA 3SNEA 2ZPRA 1X7AC 5L2ZH 1A7SA 1WV7H 3UQOA 3MU5A 1LVMA 4TWYA 1U6QA 3GY4A 3GY6A 1EZXC 1CBWC 3E90B 3HATH 1O2QA 3B23B 2CV3A 1O5FH 3EQ0H 1PPHE 1DY8A 2WUBA 3WWBA 2OTVA 5CHAB 2BYAX 2ZECA 4WVPE 1W7GH 2J98A 3MOCA 1FIZA 4H6SB 1SLWB 3BIUH 1F2SE 2ZHEH 2BDHA 1GBDA 3DSOA 3UPEA 4K8BA 3KGPA 1MTNB 2NU1E 2RA3A 4MQAA 2A2XH 2VIPA 5C20A 4ZHLU 1AO5A 3RXTA 1Z6EA 1C4Y2 1KMHB 4WJG2 1J14A 1P06A 4Y71A 1F5KU 1SMFE 3RLWH 2WV5A 3UTUH 3MQKC 1AQ7A 1O2HA 3ZZ7A 1N6YA 2ALPA 2FLRH 4NFFA 4FUBA 2ZCHP 2AEIH 3S7HB 2QF3A 1XKAC 4X8UH 3STJA 3DT0H 1DICA 1IQNA 1S83A 4YXWD 3ZYEA 2PV9B 1BQYA 3GYLB 1P2NA 1KXFA 5HXFA 4WXVA 4BOHA 1ELBA 3N7DA 4CBOA 1C2DA 1S6HA 4XBCA 5DG6A 4O3UA 3T26A 2WV9A 4FUEA 2WINI 2XNIA 4R8TB 1W0ZU 2B8OH 1H9LB 4PROA 4IMZA 1AFEH 2JETC 1EASA 3EYDA 1EZUC 4JK5A 2BMGB 1O2SA 4AYYB 1C2KA 4NSYA 4JZFH 1UVOA 3LGYA 3F2HA 2KR7A 2HLCA 3K6YA 1GI8B 2WPMS 3K6ZA 3SYJA 1XM1A 1MU6B 1AUJA 3OTPA 3SU5A 3TJNA 1C5VA 4AG2A 2DE9A 4CH8B 2V3OH 3UFAA 5CHBA 1XX9A 2G52A 3A7ZA 1ANBA 2Q6GA 3V12A 4AYVB 1DVAH 1HIAB 1T8OA 2UUFB 1G3DA 4Y7AA 2HOBA 4IN2A 8LPRA 1QZ8A 1O30A 4JCNA 3ZIAD 2NU4E 2TGDA 2BD3A 2PKSC 4K1TA 5L6NH 3UY9A 3OY5U 4UFGH 2SGFE 2BVSH 4K5ZA 3UNRA 1QB6A 1EOLA 3ATLA 3P70B 3S9CA 1SC8U 5GJ4B 3VGCC 4K3JA 5EIYA 1RIWB 1JOUB 4ZKRU 2VJ1A 3ENSB 4I8HA 3MNBA 1CT2E 2V0BA 4ISIH 1XUFA 2Y5FA 4U2WA 1C1MA 4ACAA 4M7GA 2Z94A 2BQWB 2O9QA 1NBME 1Y5AT 3SNBA 3S9BA 3FAOA 4AFZA 2Q1JA 1CU1A 1UK2A 1TQ0B 3NRLA 1P01A 1LHEH 2GZ7A 3ZZBA 3IWMA 1VZQH 1LVYA 1TRMA 3DCLA 4GHQA 5FHTA 3GY8A 1DM4B 2CHAC 3KN2A 4O97A 4D9RA 1LPGB 2Y82A 1E1QD 4X6NA 1UVPA 5A0AE 3TIUA 1O2JA 2FMJA 3UWIA 1E34B 5E2OA 2AIQA 2BXTH 3RXKA 3TH4H 3BG4B 1DT2A 2C93B 2Y5HA 1F92A 2FOFA 4U01A 1MKWK 2GP9B 1DSTA 5B6LA 2B7DH 2FIRH 2F9NA 1MKXK 3F1SB 1CT4E 1YLDA 1HAXB 3RMLH 1TGSZ 3DFLA 4WF8A 1SHHB 3KEEA 1SPJA 1Y8TA 3SJKA 1O39A 1TA2A 4I33A 1OX1A 2WUCA 2KCAA 3RDZA 6CHAB 2J34A 1AHTH 3KYGA 3BN9A 1EX3A 1CQQA 3KF2A 4X6PA 2F83A 4TPIZ 4BAQB 2WYJA 1C1OA 3VPKA 4ABAA 2WHXA 3FOAA 4MNXA 5F8ZA 1GMDG 1S85A 3PV4A 5HIZA 2P3TB 3ATWA 4DOQA 1RS0A 3FZZA 2ANMH
chains in the Genus database with same CATH topology
3BTQE 2GD4B 3MFJA 2ZDNA 2P3FH 2FDAA 2ZGCA 5ESTE 5C3NA 2WPKS 4ISLA 1O33A 2XRCA 1IQMA 1HFDA 1O3NA 1UO6A 4DY7B 5GWZA 1YKTA 4NWKA 1GL0E 2TGAA 3E0NB 3RXOA 3IG6B 3PWBA 4X0WU 1GMCG 2PUXB 2A4RA 1AIXH 2ZCKP 1ZGVA 2ULLA 2C8XB 3IITA 1D3DB 1P9UA 1Z8IB 3LU9B 1ABIH 2HGTH 2RCEA 5C5OA 3A89A 1K9OE 3SV7A 1OYQA 1OWEA 1TBQH 3E1XB 1C1PA 2GCTB 1O31A 1ZSJA 1GBJA 5HM2A 2FEQH 2A31A 1OPHB 3Q76A 4YOJA 2A5KA 2NU2E 1YCPH 1O5BB 2W3KA 4FUDA 5J4QA 3FP8E 4CBNA 1P2JA 4WY3A 5IYTA 3BSQA 3GISB 2WPLS 1EPTB 3ZZAA 3MO9A 1EUFA 1P11E 1VCWA 2V35A 5DP8A 4VGCC 5ETXA 2FM2A 1MU8B 1TGBA 1SGNE 1C9PA 1MD8A 1AVXA 2HPPH 1A5GH 1D4PB 3NKKA 2C8YB 4OS6A 4XFQA 3LGIA 2PTNA 1QRXA 4UD9H 1MTUA 1N1LA 2BDYA 1O2LA 3BTDE 1O2TA 1QCPA 4E7NA 3KL6A 2O8WA 3UR9A 4KTCA 2D2DA 2VH6A 2QXJA 1HUTH 3RMNH 3SU4A 5DP3A 1QBVH 5A2MH 2JH5D 3S69A 2VIDA 2A7HA 2EC9H 2I6SA 5IDKA 1BMMH 5AHGH 2D8WA 3EAJA 2ZFQH 1PQ5A 5F8TA 4CHAC 1CO7E 3RMOH 1FMGA 1A5IA 3NZIA 3U8TH 1W7XH 2W5EA 4YTAA 2OBQA 4UE7H 1TNHA 2Z9KA 1L1GA 1Y3WA 3T27A 2KAIA 2GGVB 2H6MA 4UEHH 1G3BA 1CA0C 1GHYH 1GI5A 1AKSA 1SGDE 2GVFA 1C5QA 4GVUA 1O2OA 3MO3A 3D49H 3U1JB 4Y0ZE 3TJVA 4DG4A 1ELGA 2QIQA 4Z6AH 1GBIA 1C5MD 1C4U2 1ZHRA 2ZU1A 2FTLE 1C1WH 5EG4A 1KXEA 2ZWLH 3A7TA 1CHGA 3ZV8A 3RM0H 3P8GA 2QC2A 3C1KA 1GBTA 1HAZB 2LNCA 2IN2A 1UTJA 4U30A 1HYLA 4GPGA 4Y76A 1LHDH 1C1VH 1NO9H 1TMTH 3RXSA 3O8RA 1MCVA 2FZZA 3A81A 1K1LA 1A0JA 1TNLA 2GCHF 4HZHA 3RLYH 5HYOA 5DP7A 1ARCA 3H7OA 3TPIZ 4BANB 1QR3E 1C2IA 1L0ZA 4BAKB 1SB1H 3TK9A 4DVAU 2ZFFH 1TPSA 1MBMA 1WBGB 5EQQA 1HRTH 1A61H 1FPHH 1SGQE 2ZU5A 4ZROA 4LXBH 1AB9C 1NU9A 1HGTH 3ZVFA 1WQVH 1DLEA 1C4V2 1FAXA 2F91A 3ATIA 3BEIB 3I29A 5EW2H 3RXVA 5T3HA 2EI7A 3RXUA 1JRTA 1AE5A 1K22H 3TGIE 1SFQB 3BEUA 1C9TA 2QYIA 1YGCH 3HGNA 3NK8A 2QV1A 4ABGA 4BAMB 2P16A 4YZUA 1HAGE 4JZEH 4I7YH 3PTBA 2XW9A 3TJOA 3ZZ9A 3A83A 2H1UA 1IQLA 1DDJA 1V2LT 2ZGBH 3E3TA 1W14U 5G4BA 3KQEA 4AG1A 2ZTXA 1PQ7A 1HAVB 1OWJA 1KY9A 1QQ4A 2VH0A 1S6FA 1GPZA 2A4GA 3OTJE 1GHWH 4I8KA 2O8UA 1BRCE 3CS0A 1HXFH 1C2EA 1GBBA 2VIWA 4FU9A 2R0LA 4YOIA 2BY7X 2A45B 1NRPH 5CHAC 1BT7A 1BJUA 1DXPA 4DT7B 2ZHFH 1TPOA 1PJPA 3F9EA 1AMHA 1QRZA 3ELAH 4CR5A 1PYTD 4NCYA 3GY3A 4B76A 1KIGH 1WUNH 1MTNC 1QBOA 4NWLA 1CT0E 1P2MA 2VWMA 1IQEA 5T6FA 1UCYK 1O3BA 3ODDA 4I8JA 3SU3A 1BTZA 1ZPZA 4ZH8A 1VCPA 1L2EA 3E8LA 1O3AA 3U69H 2DUCA 1ZMLA 5C1YA 1C1TA 1SGFG 1EB1H 1NC6A 2H2ZA 1DWDH 1ZTKA 1GMHF 1A4WH 1Z1JA 1AZZA 1C2MA 2OC7A 2BX3A 2FOCA 2BD2A 2ZQ2A 3RC6A 1YPHC 1DUEA 3T2NA 1YCPK 2PKAA 3QO6A 4O03A 1O5DH 1GBKA 3T25A 4CR9A 7LPRA 1MCTA 5E0HA 3RU4E 1D3PB 4YO9A 4LZ4B 5DP6A 5EOKA 3SV2H 2STAE 1AVGH 2FPZA 5FX6A 1J15A 3RXRA 3GDSA 3EA8A 5EGMA 1NS3A 2O8LA 5LH8A 4NA9H 3KQCA 1HBTH 1G3CA 3L3TA 3T5FH 2AERH 1YPHE 3DUXH 4UDWH 4E06H 2J4IA 3TK6A 1DPOA 2AGEX 1OP0A 3QZRA 1P04A 3A84A 3ATMA 1EAIA 2ZCLP 3ZV9A 3N7OA 4CRDA 4J2YB 1MH0A 1C5WB 3SJIA 2R3YA 4GAWA 3ZVAA 3A8BA 5DO4H 1VGCC 3SO3A 1ELVA 2HWLB 3URCA 4WH6A 1Y3VA 3V13A 1GHVH 1V2PT 2FO9A 3SI4H 2ZHQH 5DPAA 1GJ9B 1AWHB 1NFYA 3GOVB 4FVBA 1GBCA 2FP7B 1TRNA 3TU7H 3AAUA 1GMCF 1E37B 3D62A 3FP7E 3G01A 1A3EH 5GDSH 1AFQB 2G4UA 1LPZB 2A4OA 1UTPA 1PPEE 1V2OT 3QUMP 3QWCH 3SU1A 4ASHA 1BTWA 1B0EA 1SOTA 4ZKSU 1GWAA 3BIVH 3NCLA 1J8AA 1QJ6B 3QK1A 4NIXA 1G2MA 2A5AA 2ZGXH 4ABEA 1QTFA 4YESB 4AORA 3O8CA 5FPYA 1XXFA 4CREA 2UWLA 3BG8A 1ANEA 2ZDVH 4IGDA 1QHRB 4X1NU 4I31A 4YT7H 3MU8A 3M35A 5PTPA 1D3QB 3TITA 1UHBB 3ODFA 3K2UA 5AFZH 1NT1A 1SGEE 1SBWA 2AGIX 5GCHG 4X2XA 2Z9LA 1GCTC 3D65E 4OS2A 1WCZA 1YPLH 3RXGA 1EATA 1QIXB 2CMYA 3PO1B 3S7KB 1TABE 1O37A 2ODPA 4Q7ZA 2GCHG 4H42U 4Z0KA 5LPRA 1HAPH 1DFPA 2Z9GA 3BTWE 1ZJKA 3AASA 4H4FA 1CSOE 1UVSH 1JRSA 1THRH 2R2MB 1HXEH 2VNTA 1A0HB 1MMJN 2ZO3H 3FFGA 4I32A 1FNIA 2A5IA 1UTKA 2BLWA 1AD8H 4FVDA 1TALA 1SFIA 1ID5H 4AX9H 1MTVA 4ABDA 2R2WU 3AAVA 1W13U 1IHSH 1HIAA 3RXAA 1TE0A 2BDBA 2CGAA 3D23A 2PFEA 1DWEH 3UUZA 1O3KA 1AU8A 1C1UH 2BOHB 4NZLA 1ACBE 3HKJB 3UREA 4BXSA 3SUGA 1TBRH 2W7UA 1P9SA 3JZ2B 2P3UB 2OLGA 1GG6B 2FESH 3K9XB 4Q80A 2NWNA 2B0FA 4INHA 2PGQB 1OOKB 1FY8E 2AMPA 1BMLA 1LQEA 4Q7YA 3U8RH 5FCKA 1J17T 4X2WA 3M7QA 2ZPSA 3P8NA 3V7TA 1P0SH 1WAYB 4JYVH 3RXQA 1ZPBA 1BA8B 1BTPA 1F5LA 1C5XB 2J9NA 4K1EA 3NUMA 3URDA 1M9UA 1FN8A 2BD5A 1O2XA 1SSXA 2OUAA 2GMTC 4TY7A 1LMWB 1MZDA 4AN7A 3SGBE 2W7SA 1SGIB 1F7ZA 1N8OB 4ABHA 2GDDA 1ZLRA 2F3CE 1W10U 3RXIA 1NRRH 1SG8B 1JIRA 1FY1A 1L4ZA 2XC0A 1NM6A 2GV7A 1QRWA 3OU0A 2J95A 1ZYOA 3GY7A 3LH1A 3W95A 1GBFA 3SW2B 2RDLA 1Z8RA 1JXPA 1O2RA 1BTXA 7ESTE 5I25A 2FYRA 1SQTA 1NFWA 4B2BA 1QB1A 2ZTZA 1GI0A 3MH6A 3PLKA 4X1PU 3TH2H 1UK3A 3AVZA 1HJAB 4MG3A 2SNVA 4RN6A 4ABFA 5TCCA 1TGCA 2J94A 1BBRK 4AGJA 2BZAA 1GMHG 2HRVA 1CGJE 1LPKB 4XBBA 1OSSA 3NWUA 2TBSA 1XUGA 4A1TA 1YPGH 1GGDC 2GT8A 4JYUH 2P95A 2QF0A 3TLOA 3UWJH 3HK6B 3ZZDA 1GL1A 2UWOA 3CENA 4LZ1H 1O3MA 1TYNA 1KTSB 3BTEE 2FOMB 5A8XA 3QGJA 5E0JA 4B1TA 1YPEH 3SQEE 2PTCE 4WMEA 3UOPA 4IBLH 3EDXB 1HCGA 3A7VA 1O3CA 3PM3A 3FP6E 1FJSA 2CF9H 1OP8A 2A32A 1UTMA 4CRBA 1TMUH 5DK1A 4HFPB 4X1QU 1KLIH 3FVFB 4UFFH 1GHZA 1SLUB 3TJUA 3DHKH 3ITIA 1DSUA 1KTTB 1G2LA 3EE0B 2VGCC 2XCFA 2R9PA 3SQHE 1TMBH 1HAHH 1OP2A 1O3OA 1GBMA 3EGKH 4Y0YE 3E16B 1GVZA 3AW1A 3ZVCA 4FU7A 4LK4A 3H7TA 3ZZ5A 1PPFE 1HB0B 1RJXB 4ISNA 3RC4A 3A8AA 2H9HA 1JMOH 5C2ZA 1Y5UT 4Q2KA 2QXHA 3VEQB 4AFUA 1GBEA 1Q2WA 2AMDA 3GICB 1O5CB 3SV8A 3F68H 3SBKA 2BQ7B 4YOGA 4FUHA 4E05H 3F6UH 1OWDA 6GCHF 4FUCA 1EPTA 3P17H 3MNCA 3SJOA 3A8CA 5B6OA 1LHCH 3QGNB 1GJBB 2QXGA 4ABIA 4A1VA 3LONA 2G5VA 1T8LA 5H4IB 2JETB 1W8BH 1HLTH 1EXFA 1EKBB 5EQSA 4F49A 4DJZB 2FI5E 1OXGA 4WXIA 3M61U 1Q31A 4MPVA 1TNJA 3Q77A 1NROH 1FZZA 1ZSLA 3Q3KA 2B5TB 2VIVA 3ATKA 3BTGE 4AFSA 1W0YH 1K28D 2BLVA 2TPIZ 1EAUA 1GBAA 4X1RU 3VB6A 1D9IA 4NGAH 2FOHA 2H5DA 4OGYA 2QCYA 4J1YA 1C5ZB 4GSOA 2PKSB 1DE7H 4X6OA 1P57B 2BY8X 5TJXA 1W11U 1E0FD 3SNDA 1FDPA 4DGJA 4F4OC 4MLFB 3LGWA 1BMNH 2BLOA 3VGCB 3R0FA 1C2HA 1T4UH 4UFDH 1O38A 4GCHF 1V2NT 4NZQA 2FS8A 2NU0E 1BRUP 1GVKB 1T32A 3KNXA 4A6LA 4CRGA 4Y10E 1S81A 3B9FH 1ELDE 1QJ7B 3PLPA 1GI9B 4A7IB 1GCDA 3SORA 3U1IB 2VINA 2Z6BD 1LKBA 1TNIA 1A0LA 1UVUH 4A92A 3W94A 1RRKA 1ZSKA 1MD7A 1O2KA 2CHAB 2H9EH 1AN1E 1RXPA 5EW1H 3QTOH 3CP7A 5CE1A 1TGNA 1C5PA 1ZHMA 5J4SA 1NTPA 2OQUA 4KELA 1XVOA 1CA8B 1T31A 4MDSA 1D3TB 1GDQA 3PROA 4JYTA 1P2QA 5JPMH 5GCHF 1RTLA 1SGYE 2ZC9H 3RXCA 3SUEA 4JMYA 2ZPQA 1AZ8A 4Q7XA 1AUTC 3LDXH 1SGPE 2G5NA 4X8TH 3LGTA 1GDNA 8KME2 3SUDA 3E0PB 5T6DA 5DJ7A 2XWAA 2WV4A 3UR6A 1RTFB 3SZNA 1C5YB 2ZQ1A 3RXLA 2ANWA 4NIVA 2ZHWH 1ARBA 1EAXA 1GI3A 3MNXA 3Q3XA 3MWIU 1K1MA 1C2FA 1K1JA 1EJAA 5JYIA 4AGKA 1P10A 1QB9A 3EA7A 1HAVA 2DE8A 2BD9A 2ZNKH 2ZDKA 1G32B 3A8DA 2R3UA 1GJDB 2ZA5A 1TX6A 2M5TA 4BAHB 4BXWA 2BD8A 4GUXA 3PMAB 2W3IA 2GZ8A 3S9AA 1KDQB 1S0QA 3H5CB 1NRQH 3STIA 1Q3XA 3MU0A 5F03A 3UQVA 3ZVBA 1YPKH 2PR3A 3UOUA 1S0RA 1C5TA 1TPAE 3MH5A 1LKAA 4H6TA 2XBXA 2J38A 2TRMA 4RSPA 4UONA 1C1SA 1C5RA 2G51A 2JKHA 1CGIE 1MUEB 2FODA 1HAIH 1GJ5H 1QFKH 2C8ZB 7KMEH 4LOYH 1V2QT 4KTSA 1Y5BT 1VR1H 1A46H 2HNTC 1O36A 1GI4A 2XXLA 2TGPZ 2G4TA 1ZRKA 1S84A 1QA0A 4XSKU 2ZF0H 4VGCB 1DANH 2SGDE 1ZTLA 1C5UA 4X1SU 4B74A 1XKBC 5A0BA 1TX7A 2QN5T 4O3TA 2VU8E 4FXGH 3T28A 2Z3CA 2BDGA 1O34A 1KXDA 3PO1C 2FS9A 3M3SA 4AFQA 2HNTE 2XC4A 2PHBA 4X2YA 2ZGHA 1C5SA 3C27B 5A8ZA 1TBZH 3UNQA 1QURH 3UNSA 1WQSA 2G8TA 4X2VA 1MAYA 3LT3A 1QA7A 5EODA 1G9IE 1YBWA 3M5OA 6GCHG 3RUOA 4O9VA 2OBOA 1UCYE 2F9UA 1YPJH 1LHGH 2BD7A 2CF8H 3TNSA 2D1JA 1VITH 3LIWA 1KXCA 2HALA 4HI3A 1D6WA 5DP4A 3SU2A 1GVLA 4NIWA 2ODQA 4WMFA 4MPWA 5FAHA 9ESTA 3PB1E 3KHVA 1O3IA 2PW8H 3KIDU 2VIQA 3M5NA 5FCRA 1XUIA 1ZOMA 3SV6A 1E35B 4Y8XA 1XUHA 2PUQH 4DURA 1C2GA 1GBLA 1O2GH 1Z7KA 2XBYA 1BUIA 1NPMA 1C2LA 3A7YA 4Y8YA 2STBE 2EI6A 2ESTE 1V2KT 4JZIA 1PQAA 2FI4E 2UUKB 1H4WA 3PLBA 1IQGA 2OP9A 5JBTA 3SHCH 2ASUB 3P6ZB 3SGAE 3SU6A 3RP2A 5E2PA 1MTSA 1VITF 3LC5A 4KTUA 1ELTA 1HNEE 1O2YA 3HK3B 1WTGH 1AGJA 5DP5A 5JBAS 2ALVA 3SJ8A 1EP5A 5FPTA 4SGBE 4JK6A 3BEFB 1MKWH 3LPRA 2JH6D 1J9CH 1FQ3A 1B0FA 2AIPA 4ZXYH 1IHTH 3LGVA