2FI5E

Crystal structure of a bpti variant (cys38->ser) in complex with trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and structural roles of the Cys14-Cys38 disulfide of bovine pancreatic trypsin inhibitor.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 59
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fi5E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fi5E02
2VU8E 1YLCA 1F5KU 2GKVE 1S5SA 1P9UA 1O32A 1ELDE 1GI8B 1DWDH 2OC0A 1AB9C 3GCNA 3GY8A 4Q80A 1J17T 3DFLA 4B73A 1SGIB 4BXSA 1T32A 2OUAA 4JYUH 4WH8A 3RM2H 1NM6A 1P9SA 1YYY1 2FOCA 3M7UA 1YPKH 1FPCH 3SN8A 1RIWB 1D9IA 1Z6JH 1SGDE 2ZHDA 2FWWA 1O31A 1TOCB 5E2OA 1RTLA 1QRZA 5E2PA 1O3DA 1XVOA 2ALVA 2C8WB 5A8YA 1VR1H 3RMLH 1O2PA 4CBOA 3HKIB 4XFQA 5EXMA 3ZZDA 2M5TA 4SGBE 3MO3A 2FOHA 3ZZ3A 1FN8A 3PMAB 5DG6A 1OX1A 1ELFA 2BOHB 4D7GA 3KL6A 3EQ0H 4X2WA 1QJ1B 1G3EA 4Y0YE 1MD8A 5DP9A 2PGQB 1VITH 4F4OC 3RXOA 1V2TT 4FU9A 2H2ZA 1OWHA 3GDUA 3LGVA 2K1QA 4TY6A 2OBOA 4OS2A 4U2WA 2D2DA 4UFFH 2B7DH 2TBSA 1KXDA 3D23A 2ZC9H 2Z9KA 4DCDA 5LPFA 1EQ9A 1MQ6A 3A8AA 4YO9A 1NRSH 3BIUH 1P11E 1V2PT 2R0LA 3LIWA 2AFQB 1BTWA 4H6TA 1SPJA 5T6GA 1TAWA 1YPHC 4YT7H 4IW4E 4LXBH 1GPZA 1GVLA 2A4OA 3IG6B 1F92A 2PTCE 3BTGE 2ESTE 3SI4H 1IQHA 1Y3UA 3GCHC 1CT0E 2VIQA 3QGNB 3O8BA 2FIRH 4DT7B 1OWEA 5HM9A 1EP5A 1UCYK 1P10A 3SV2H 2XTTB 3TJVA 2G5VA 3A7VA 2CF9H 1FY4A 6CHAC 1O0DH 1GBAA 5EQSA 3URDA 1LHGH 1Z8IB 2RG3A 2XC0A 2XBVA 3G01A 1C2IA 4HFPB 1FJSA 3RXMA 3AASA 1FUJA 1DS2E 1UTNA 1GBMA 1DSUA 5DP8A 3RU4E 3SJKA 4KKDA 1ZSJA 1F0TA 4GUXA 1Z7KA 3NWUA 2P93A 1K21H 4CR9A 3MTYA 1O2TA 4AORA 4IN2A 4NZQA 1OWDA 3KGPA 4AGJA 4WVPE 1HPGA 1W7XH 3PO1C 4ISIH 3SUFA 5F03A 3TU7H 2UWOA 1N8OB 3SI3H 2Z3EA 1NFWA 2WYJA 1PYTC 1DLKB 1TRNA 2P3TB 1XX9A 3RC5A 2FX4A 1MCVA 1ZRBA 4JCNA 1FIWA 1SR5C 3U69H 3RXVA 1TNIA 2QIQA 1AVXA 2A1DB 3I78A 4FUJA 2A7HA 1ZPZA 1TALA 2W26A 2CJIA 5JDUB 1SHYA 2STAE 2ZCLP 1S6HA 1BTYA 1Y5BT 1XXDA 1A3BH 2ZQ1A 1HV7A 5EQQA 1UVUH 2VWOA 2Q6FA 1GHXH 1FLEE 3S7KB 3BIVH 2WPMS 1HXFH 3URCA 4BAHB 1AD8H 3A8CA 1OS8A 1YCPK 2J4IA 8ESTE 2ZECA 2O9QA 1ETRH 1Z8GA 1VZQH 1EAIA 2AYWA 3RP2A 3EAJA 5HM2A 1JWTA 1C5VA 2DUCA 1K9OE 4A1XA 1SC8U 4AZ2B 2ZF0H 4K8BA 2G8TA 2CGAA 2FX6A 3VXEH 2GZ7A 1P12E 3HGNA 4WF8A 4FXGH 4UE7H 1NPMA 2JH5D 1TNHA 2VVVA 4MNWA 2Z9JA 1GI9B 2VVUA 2BDCA 1O3PB 1QRWA 1A5IA 2GDEH 1SFQB 4GVUA 1ELCA 2ILNA 2D1JA 3MO6A 1AI8H 2FOEA 1ZMLA 3F9GA 1DUAA 2CHAB 4NIWA 2FXRA 3ZZ9A 2QXGA 1SOTA 1YC0A 1TBRH 1YPEH 2JETC 3A80A 2ZDMA 4I8LA 2FI3E 4B2BA 1RD3B 3UTUH 3RXEA 2Z9GA 1N8OC 2AGIX 2QXJA 2WUCA 5C20A 5K7RA 1SLVB 3SUGA 1IQFA 1GMDF 3RXBA 1O5CB 2Y82A 1MBQA 1QL7A 1DITH 2ULLA 1PPZA 3ATKA 1T4VH 4BAOB 3GY3A 3RC4A 1BRAA 1TA2A 2C93B 2XYAA 2ANKH 1HAGE 8GCHF 1ZHPA 4DY7B 1MTVA 3LH1A 1Z1IA 3N7OA 1BUIA 5ETXA 1GI7B 1GGDC 1O2UA 3M37A 1S0QA 2NU3E 5EODA 3V7TA 2J95A 2XBYA 1NFYA 1UVTH 3PWCA 5A09A 5HYOA 1DVAH 1VJ9U 1P05A 5FPTA 3ZZAA 2XBXA 1KDQB 3E1XB 4GCHG 4Y8ZA 1H1BA 4FU7A 3T62A 1O2MA 1C1UH 3ZZ4A 4FUEA 2BDHA 3RXJA 1WCZA 1QBVH 4INKA 4NA8A 3LOXA 4H6SB 1INCA 3EDXB 1O2YA 1QJ7B 2ZPRA 1BJUA 1C2JA 1UTOA 2BY9X 1HBTH 4NGAH 3GCTG 4Z0KA 2FPZA 2Q6GA 3KQBA 5TJXA 2UUKB 1QIXB 3O8DA 1P01A 3T2NA 3SNDA 1O2RA 4ZHLU 2GT7A 1KXCA 1OP8A 1Q2WA 4D9RA 1C9PA 4DW2U 2W5EA 2H9HA 2FZZA 3KIDU 1QA7A 1DFPA 4UFEH 1EKBB 4HGCA 2P16A 2J94A 2O8LA 1AKSA 1J9CH 2ZGJA 3MMGA 4JZ1A 4FUIA 4VGCB 3RMMH 3MH5A 1TX8A 1O3KA 2B5TB 1PPFE 2QV1A 1QFKH 4YZUA 2P94A 4XBBA 4U01A 2EA3A 4K69A 2FTLE 1SI5H 3W94A 2ANWA 1L4ZA 4O97A 3P6ZB 1D3TB 4WH6A 1HB0B 2BD2A 4Q7ZA 1P02A 1UJ1A 4NCYA 1ZLRA 5FX6A 1FMGA 1MUEB 4ZXXH 3VB4A 4CRCA 3E8LA 3OU0A 3M5NA 2FLBH 2R3YA 4GLYA 4TWWA 1YCPM 3T29A 2BLVA 1VGCC 4TPIZ 1O38A 1ZTLA 3CENA 4BOHA 3UQOA 1O2SA 3F9HA 1G36A 1E34B 1OWIA 4IC6A 2HNTE 3ZV8A 4MNYA 5I46H 4JYTA 2CXVA 3TK9A 3U1IB 4A1VA 4JMYA 2GP9B 3VB6A 5C67A 2Z6BD 1HLTH 1KXAA 5E8EH 2BX3A 2YOLA 1TPAE 3AAUA 2WV5A 3MFJA 1CBWB 1A0JA 1AB9B 1QTFA 2G81E 1C5YB 3U9AH 2H6MA 1ANBA 1XUKA 1O2XA 4FUFA 2FOBA 3GY6A 2O8UA 3L33A 1SG8B 2H9TH 4ZHMU 2PUQH 1HAVB 3UIRA 4ESTE 1K1LA 4Q2KA 2AEIH 4E7RG 1NN6A 3FANA 1QL9A 1ZHMA 1C5WB 3DD2H 1KLIH 1GHBF 2FYQA 1U6QA 4ZKOU 1CVWH 1EUFA 2A32A 1A2CH 1SLWB 1Y3VA 7GCHF 2JH0D 2FOMB 1HIAA 1WAYB 1GI2A 2PGBB 3A7ZA 3U8TH 1C2LA 5E0HA 1AU8A 1ETTH 1AQ7A 4WY3A 2XWBI 3BTKE 1SGPE 1C9TA 1Y3YA 3TVJB 3EGKH 1CA0B 4RKJB 1Z8JB 1O2LA 3BTFE 3VB5A 2XRCA 1WQVH 1O3GA 2R0KA 1ABIH 4CH8B 1PQ8A 1LQEA 2O8TA 2PKSC 1L0ZA 2PR3A 5TCAA 3PLKA 2V3OH 3RDZA 5JPMH 2FI4E 1XUHA 3V0XA 3SNEA 2QN5T 1QRXA 2GGVB 4Q7YA 2FOAA 1GGDB 2FOGA 2ZFSA 3HGPA 1AIXH 2BTCE 4MVNA 2H5DA 4XBCA 1AZZA 3NPSA 5DJ7A 1TNJA 3S9AA 4UD9H 1QHRB 3GY5A 1G3DA 1EOJA 3RXCA 3S9CA 2GCHF 1O2JA 1UTQA 2BD8A 1MTNB 1S6FA 3MNSA 2VINA 1CT2E 2WPIS 1UVOA 3BEUA 1AVWA 3MU5A 4ABBA 3ZZBA 5EGMA 1C5SA 1UK3A 3BTHE 5CHAC 4E06H 4YTAA 2NU0E 3LJOA 1K1OA 3ATLA 1GJ9B 3UQVA 2BQ7B 1ZOMA 1XKAC 3BSQA 3FAOA 2ZHWH 1C2DA 3M3SA 1TX6A 3PTBA 4TYDA 1PJPA 3E16B 1TMTH 1LHEH 1EAUA 1QBOA 2Z3CA 3SU5A 3SUEA 1EASA 1XM1A 3GYMA 3RXRA 3ZVDA 1C2MA 4YOIA 3FVFB 4X1RU 3KQEA 3RC6A 1VCWA 1IHSH 4B1TA 1NY22 4KGAA 2GCHG 2I6QA 4CRGA 2FP7B 3LGYA 5GWZA 1H9LB 1FV9A 2A5IA 1ELGA 1LPKB 1YGCH 1NZQH 3MU1A 2WPKS 2YNAA 1IQEA 1GHWH 3PMBB 1G9IE 1AUTC 2PLXA 2VGCB 3GY7A 3RXQA 3F9EA 1GL0E 2JETB 2UWPA 1THRH 4X8VH 5EXLA 1K1JA 2ALPA 1DANH 1K1MA 5L30H 3VPKA 3LDXH 2OCVB 4TY7A 1OYQA 4ABHA 2Y5HA 1O2NA 2SGPE 4QT8C 3M5OA 1P2QA 3RXSA 5A0BA 3QGJA 3E91A 4BNRA 1O3OA 1EOLA 1FDPA 3PMJA 1E0FD 3TK5A 2AIPA 2PKAB 3OYPA 3TLOA 1YM0A 1DXPA 1K1PA 1ELVA 5EW1H 1SGCA 1ZSKA 2GV6A 3TITA 2QCYA 1EP6A 1F7ZA 2AS9A 2HPQH 2RA3A 4IS5A 1NRRH 1G3CA 2VIOA 3P17H 4AFQA 7GCHG 2Z9IA 5E0GA 2CF8H 1O39A 2C8YB 1EJNA 1WV7H 2QGRA 3Q3XA 3KCGH 2ZTZA 3LC3A 1LVOA 5JBCS 4ZHAA 1MBMA 4INLA 1RRKA 4INHA 7KMEH 4A5TS 5GIBA 2ZCKP 2FTMA 3EA9A 5FCRA 1W12U 1YBWA 1LVMA 4O3TA 2TIOA 3W95A 2ZU5A 3M3VA 1EB2A 3TIUA 1FY1A 1VITF 3ZZ5A 2ZFQH 4Y11E 4MPVA 3TGKE 1V2RT 2ZPSA 4GHTA 2D26C 4BANB 2BLQA 3PLPA 1O3BA 2OC7A 4ISLA 2BY5X 1SB1H 3RXKA 3TH2H 3K9XB 1HJ9A 3ODDA 4K1EA 4R8TB 1P04A 4OS1A 2PWXA 3OTJE 3ZVBA 1KXFA 3SBKA 1OXGA 2Y7ZA 1GHZA 1GCTB 2A4GA 1BCUH 4Y8YA 5GXPA 3Q76A 4JYVH 4LOYH 3RU4D 2BXTH 3ZZ7A 1ID5H 4THNH 1C4U2 1LHFH 2J92A 4LZ1H 1QNJA 3A81A 3UUZA 4A7IB 2Y6TA 3PM3A 5A8ZA 1ZJKA 4ABDA 2AMQA 2ZU4A 4NWLA 1O3LA 1Z8RA 1J14A 1HAPH 3QWCH 3VGCB 1BTZA 2FEQH 1HAHH 1AE8H 1ELBA 1TABE 1GMHF 1CE5A 4XBDA 3HATH 4WXIA 1A61H 1DSTA 4RKOB 1O2OA 1TIOA 2J38A 5JB9S 2PW8H 4MNVA 2DE9A 5GPIB 3UWJH 1TGBA 1C1MA 3A85A 3A84A 5AHGH 3GYLB 3GCHB 4Y6DA 3UNSA 3KNXA 2PSYA 1PQ7A 2ZDVH 4WMEA 4KTSA 1QB6A 5JBBS 4D76A 1GHAF 1ZMJA 4ZKRU 3HKJB 1SQOA 1HUTH 3SGQE 4FVBA 1GVZA 1AVGH 1SGFG 2BDIA 1K22H 1RXPA 3EE0B 1ZMNA 1UCYH 2BD4A 1IQNA 1QY6A 2AERH 1TRMA 5L2YH 1ANEA 3EA8A 3MNCA 1RJXB 2FM2A 1AKSB 4X8TH 4ABFA 1W2KH 2BLWA 1RGQA 3Q77A 2FO9A 1DE7H 4IMQA 3FP6E 1PQAA 1RS0A 5LPEA 1TLDA 1V2LT 2OC8A 3STIA 5A0AE 3RUOA 2WPJS 1ANDA 3AVZA 1RIWC 2OINA 3PO1B 1MTWA 2VVCA 2ZHQH 3MU0A 3VEQB 1LQDB 1V2OT 1BTHH 4GPGA 5DGJA 1NRQH 1A4WH 2ZHEH 1BA8B 1T8LA 1XKBC 3O8RA 1JIMA 1W3CA 1S82A 3LGTA 2UUYA 5DO4H 1FONA 2ANYA 2KAIB 5LPRA 4I8HA 3T26A 1SQTA 2ZPQA 4HZHA 1D3DB 2HOBA 4JZIA 2ZU1A 3LGWA 3M3TA 1DICA 3K6YA 2A31A 1EZXC 2A45B 1VGCB 1B0EA 4H42U 3QDZB 5AFYH 2GVFA 5EQRA 1DXWA 4ISNA 1BOQA 5DP3A 4Y71A 2BY7X 2DE8A 1GHVH 1W14U 4X8SH 3E3TA 4ZKSU 1GBIA 2AGGX 1GVKB 1AFEH 1TFXA 2QYIA 2HWLB 1JXPA 2EI6A 3ODFA 1QR3E 1SMFE 1W10U 5HMAA 1P06A 1DWBH 3BTTE 2FS8A 2STBE 1A46H 1LKBA 5GDSH 2UUFB 5SGAE 1C5QA 1T7CA 1CSOE 1EZQA 4X6OA 5C3NA 1ELAA 2QAAA 3SJ9A 1O3AA 4AB8A 2UUJB 1O36A 5T6DA 3E6PH 1NESE 1BMMH 5GJ4B 1S81A 2ZFTA 1IHTH 1KIGH 1GDNA 1JIRA 3VB3A 2FESH 4KP0A 4LK4A 1OP0A 3BG4B 2VIDA 4BTUB 1P2KA 1ZZZA 1O3EA 5K0HA 3HK6B 2BM2A 4ZUHA 1PPGE 4AGKA 1GI4A 4FUBA 1GI3A 2BQWB 4BXWA 3OY5U 1O5FH 5F8ZA 5BRRE 1K1NA 3F9FA 1DPOA 2SFAA 2Z3DA 1OSSA 2A7JA 5JYIA 3P8NA 6LPRA 1SGEE 1C5OH 3E90B 1MKWH 1SOZA 4U32A 3ZVEA 1C5TA 1DWCH 2VGCC 1KY9A 2GT8A 2B8OH 3TNSA 1HAOH 1ESBA 2G5NA 1V6DA 3MYWA 2XCNA 1DY9A 3SORA 1HRTH 5FCKA 1ZRKA 1O2GH 1DDJA 1E38B 4CREA 1GHYH 2SGEE 2WV4A 1OP2A 4D8NA 1ZTKA 1C1QA 1ZGIA 1AFQC 1SBWA 3RXHA 4CRBA 1H9IE 6GCHG 1NS3A 1GI1A 1XMNB 2THFB 1QBNA 4B75A 2ZU3A 2BOKA 1XUGA 3UNQA 1SGFA 1MKXH 1L1GA 4CH2B 4DOQA 3V3MA 1RTFB 1TGNA 1DX5M 4ABAA 3B9FH 1VCQA 1ESAA 3KF2A 1E36B 2WUBA 1LO6A 4X2YA 4FUGA 4X6MA 4YESB 1SGRE 5IYTA 5EPNA 1RTKA 1Y8TA 3RLYH 3SU2A 1KTTB 1C1WH 4K1SA 2F9OA 2QA9E 4X6PA 3OY6U 1NU7B 1VITG 2C90B 2BB4A 4I31A 3M61U 2FMJA 4Y0ZE 3P70B 4CHAC 2I6SA 3QZRA 1BZXE 1MU6B 1ZR0A 1GMCG 2KAIA 1FAKH 1KYNA 1VCPA 3RXGA 1MZDA 3DHKH 3HK3B 3F6UH 4NA7A 1IQGA 1GDQA 2P3UB 2ZA5A 1TNGA 1BBRK 1NT1A 4X2XA 2VWMA 1DWEH 5A8XA 1A0HB 5J4QA 3QO6A 2EC9H 1ZPCA 2VWNA 4M7GA 5L2ZH 2UWLA 1UVSH 1GJCB 1EATA 1Y3WA 3DUXH 5A2MH 3BG8A 5JBAS 1O2ZA 2ZGHA 3MO9A 4FU8A 3DFJA 5EPYA 3AAVA 1GI6A 2B9LA 3A7TA 2F3CE 1YP9A 3F68H 4ZKNU 1P3CA 1TGTA 1Z71A 3A89A 4WMFA 4KELA 3U8RH 2WINI 4KTCA 5C1UA 3SQEE 3SU6A 4CRFA 1MKXK 4ISHH 1UHBA 3ZZ6A 1YCPH 3KEEA 3SV6A 3PTNA 1C2HA 2ZI2H 1GJ7B 6GCHF 1O35A 2F91A 2VJ1A 2BDAA 2GD4B 2AGEX 1H4WA 2FLRH 3TNTA 2FODA 4XSKU 1PFXC 4WMDA 3SHCH 3R0FA 1C2FA 1O2QA 1CHGA 4ABIA 1C5XB 1TGCA 1A0LA 2C8XB 4ZROA 3A7WA 5F8XA 1QQUA 3BTQE 3RXLA 2ZTXA 2BHGA 2TRMA 3GCTF 2BVRH 2WYGA 3SO3A 1LTOA 1SL3A 1WSSH 1HXEH 1LVYA 4DVAU 3V12A 1CGIE 2J9NA 7ESTE 3KHVA 1O2VA 3TGIE 5ESBA 1F0UA 2ZWLH 2HLCA 4WJG2 3MHWU 1TNLA 4GCHF 2FOFA 2FYRA 5C5NA 3ZV9A 1E37B 1KSNA 2P95A 1TPPA 4I33A 1C5PA 2O8WA 1BHXF 1H9HE 2SGQE 1GBEA 4OS4A 2XW9A 3IWMA 1SLUB 2F9UA 3D49H 1C2KA 1YLDA 1GBBA 3LH3A 1F0RA 3STJA 5C2ZA 4O3UA 1YPHE 3R3GB 4AYYB 2ODYB 8GCHG 2GCTB 4NFEA 2ZFFH 4X1NU 1TQ0B 1ELEE 1KLJH 2ZU2A 1BRBE 1HAYB 1O3NA 2Z94A 2VIWA 4B2CA 1AGJA 1IQJA 3M35A 1H8DH 3SUDA 3A8BA 4R0IA 2OP9A 4ZMAH 2BD3A 5FX5A 5DPAA 2BD7A 3P92A 3P95A 2ZQ2A 2FDAA 3ZZ8A 2ZGXH 4ABGA 2V6NA 2QC2A 4MPWA 2A2QH 2QY0B 2XXLA 2ZDLA 2H1UA 3CS0A 3B23B 3PLBA 1G2MA 1FNIA 2W7UA 4ZH8A 3U98H 1C1RA 1J8AA 2WPHS 4Y7AA 3ZZCA 1MTNC 1WOFA 2D8WA 3TH4H 3SV7A 3GDSA 4IMZA 1NRNH 1ZPBA 4X1SU 1FY5A 1KDQA 5GCHG 3M36A 1YKTA 2FI5E 2F9PA 2ZP0H 5FPSA 4ABJA 1EXFA 8KME2 1TQ7B 1P8VC 4K3JA 1FY8E 1UTKA 2J2UA 4D7FA 3MI4A 1GHAG 1DT2A 1CU1A 1YF4A 4CR5A 1ZJDA 2P59A 1TBZH 1N1LA 2G00A 5A0CA 3RU4T 2LNCA 3RXPA 1SGNE 5CMXH 1LPGB 1BMLA 4CHAB 1THSH 2GMTB 1O3IA 1FN6A 1ELTA 1QA0A 1K2I1 1SGQE 3ESTA 4B74A 4K60A 2TGAA 3QUMP 2IPHA 4JZDH 2W3KA 3M7QA 2SGDE 2OQUA 4BAQB 1BIOA 5T3HA 1V2ST 2SNWA 1X7AC 2ZDKA 1D6RA 1DM4B 1G3BA 1BT7A 1T8MA 1ANCA 2A4RA 4MNXA 1MD7A 1MAYA 2TGPZ 1CHOG 2BMGB 1IAUA 3BV9B 4GHQA 3SNAA 4NIXA 4OS5A 3FFGA 3UR9A 4Z6AH 1BTPA 1MKWK 3PROA 4AFZA 1NROH 5FPYA 1GJBB 1UCYE 1GMHG 3MNXA 1F0SA 4YOGA 1HIAB 3LC5A 4XDEA 2BY8X 2SGAA 1V2WT 1NC6A 4Y79A 2HNTC 1MZAA 2BVXH 5DK1A 1GJDB 1W13U 2PKSB 4YLUA 1G30B 2ANMH 3QK1A 4BAKB 4BAMB 4YLQH 2G52A 5IDKA 2F9BH 3P8OA 2VH0A 2NU1E 1CQQA 3JZ2B 2TGTA 3DT0H 1C5UA 5EW2H 2PFEA 5AF9H 1L1NA 2HALA 1BRCE 3AW0A 5ESTE 1HAXB 1O3FA 1V2QT 4OGXA 4UEHH 1WQSA 2XNIA 3U1JB 2QXHA 1N6YA 4UFGH 3LPRA 1W11U 4UFDH 2WPLS 4TWYA 4HI3A 1JOUB 1P3EA 4BTTB 4NSVA 4OS6A 1GWAA 6CHAB 1WUNH 1HDTH 4K5ZA 1O2IA 1O5GH 4MQAA 4YT6H 2ZHFH 1A3EH 3MH7A 4AG1A 8LPRA 3NKKA 2GDDA 5E0JA 2OXSA 3QLPH 1BBRE 1P09A 3T25A 3RXFA 4CRDA 3RXAA 2F83A 1C2EA 1SSXA 3MWIU 4AYVB 1A5HA 1A5GH 4AG2A 4K2YA 2Y5GA 2G4UA 3WY8A 3SU0A 4IBLH 1O5DH 2TGDA 2ODPA 1C5LH 1OPHB 2CV3A 1WBGB 3UWIA 4I7YH 1CA0C 3ENSB 1GBHA 3ZVGA 1C1PA 3I29A 5HXFA 3UREA 4XE4A 7LPRA 1G2LA 1HYLA 1WTHD 1BDAA 1QCPA 4X8UH 1P03A 1TGSZ 1SGTA 2PSXA 3TPIZ 1AZ8A 1D4PB 1UVPA 1T4UH 1BJVA 1CT4E 2G55A 2BDBA 5GCHF 2W3IA 1GJ5H 2EI7A 1FXYA 3LONA 1S84A 1AFQB 1LMWB 2NU2E 2AMPA 4A1TA 1YPJH 3S0NA 1E35B 5EXNA 9LPRA 2XWAA 2AMDA 3BN9A 1Z1JA 3UY9A 2ZGBH 3ZVFA 4PROA 3SJIA 1EPTA 2ZKSA 4F49A 4DIIH 3D62A 4JZFH 4JK5A 2EEKA 4HTCH 5CHAB 2R9PA 2YNBA 2BD9A 1ZHRA 1EJAA 1T31A 2BVSH 3FP8E 1DY8A 4RN6A 3LKWA 1UK4A 4OS7A 1MQ5A 5CE1A 1MAXA 1F2SE 4U30A 4CBNA 1TWXB 1EPTB 1N6XA 3KQCA 1GG6B 3BTEE 5B6OA 1GBCA 1UTMA 3AW1A 1P57B 2CMYA 1J15A 3PMHB 3FZZA 3GOVB 1Y5AT 1OYTH 1B5GH 1HJ8A 3ZYEA 3ELAH 1D6WA 2ZCHP 3ATWA 1OWJA 2JH6D 2ASUB 3NUMA 1O2WA 1PPHE 2H5CA 2R2MB 4X1QU 3SU4A 1FZZA 1C1OA 2XC4A 2XCFA 1YPLH 3A7YA 2A5KA 2Q6DA 1TMUH 1AWFH 1ZYOA 3A8DA 5FBIA 1NRPH 2OBQA 1MTUA 1UHBB 1GI5A 4NSYA 1GMCF 1CGJE 1M9UA 1O30A 3EYDA 3MU8A 3E0PB 1QL8A 1LKAA 2R3UA 1NO9H 4MPXA 4ZAEA 2Y81A 5EG4A 1GCTC 4DIHH 1HCGA 4O03A 5FXLA 1EX3A 1QB9A 1B0FA 3BF6H 3GCOA 3PV4A 3MH6A 1EB1H 1P2NA 1C1NA 2RA0A 3SJ8A 1C4Y2 4MLFB 1FAXA 3C27B 5AVDA 1SGYE 1SLXB 2PUXB 4MDSA 1KLTA 1F5RA 4H4FA 1DOJA 4E05H 3GY2A 4WXVA 1ABJH 1L4DA 1CBWC 1TX7A 3A82A 3GY4A 5C5OA 2P8OC 2VNTA 3BEIB 3DA9B 6ESTA 1IQMA 1W0ZU 2ZFPH 2RCEA 3TGJE 4DJZB 1K1IA 5AFZH 4I8KA 1BBRH 3QZQA 1O3CA 2OTVA 1FI8A 1C1TA 1FY3A 2W7SA 1WTGH 1GHBG 4I8GA 2SNVA 3P8GA 2LPRA 3T5FH 3SW2B 1GJ4H 2HGTH 1CO7E 3S69A 2NU4E 2V3HH 1LCYA 2C3SA 3OX7U 3BEFB 3GICB 4ISOA 4Y10E 1GBTA 3UOPA 1XUFA 2GCTC 1TA6A 3LGIA 3TH3H 2PV9B 2A7CA 1QGFA 2VWLA 1NFXA 5H4IB 2A4QA 1P2IA 3A86A 1GI0A 1BQYA 2OC1A 4JK6A 4D9QA 2JKHA 1BTXA 1C1VH 1TPSA 2GZ9A 3NXPA 5L6NH 3BTDE 2F9VA 4K8YA 3U8OH 4MTBA 2BY6X 4NIVA 1EAWA 1SFIA 3D65E 4XOJA 1GCDA 2GZ8A 4DGJA 1GJAB 1UTPA 4OGYA 3QN7A 3SQHE 3M5MA 1EAXA 3QTVH 1TMBH 1WYKA 1AHTH 2XC5A 1UTJA 1QURH 3HPTB 5FBEA 1C1SA 3VFEA 3SV8A 4NG9H 1WU1A 4AX9H 1Y59T 3S7HB 1D3PB 1V2KT 5DP6A 1PQ5A 1PYTD 4LZ4B 1TNKA 3FZDA 3H7TA 5BPEA 1W8BH 1HAVA 1LPZB 1RFNA 4FUDA 4NA9H 1CA8B 4AOQA 1AMHA 1DUEA 3K6ZA 2HPPH 4Y8XA 2ZZUH 4MPUA 4ZXYH 2BDGA 5EOKA 4GAWA 3SNCA 1A1RA 4DURA 4UONA 1V2NT 1XVMA 1A7SA 4E7NA 3UOUA 4ASHA 1DLEA 3M5LA 5F8TA 1B7XB 1P0SH 3BTME 1V2VT 5DP4A 2GMTC 3TJUA 1C5MD 2P8OB 3RXIA 1NFUA 2R2WU 1NTPA 3A88A 5DP5A 4NZLA 1AO5A 1ORFA 3PWBA 2ZIQH 1MMJN 3A7XA 3E0NB 1T8NA 2ZFRH 4NFFA 2AH4X 3RMNH 1GJ6A 3OSYA 2CHAC 5ABWA 1SQAA 1L2EA 1PPBH 2NWNA 3RXDA 1Y3XA 2IJOB 1ZSLA 2ZGCA 4AB9A 2A2XH 1Q3XA 1HJAB 1O3HA 1W0YH 2EI8A 2ZDNA 1D3QB 1BRUP 2ZEBA 1KXEA 1H8IH 2IOTA 4K1TA 4B76A 4TPYA 1IQIA 1O34A 1UK2A 1O5AB 3CP7A 2A5AA 1FPHH 2AIQA 4GSOA 5J4SA 3PB1E 2QF3A 5DKMA 2GTBA 3Q3YA 3UFAA 1VJAU 1IOEA 1T8OA 3UNRA 1O33A 2BX4A 1BITA 1TBQH 1XUIA 3Q00A 4IN1A 3TK6A 2HRVA 2VIPA 3IITA 4Y76A 1THPB 1QB1A 2HVXA 2P3FH 2Z9LA 5G4BA 1C4V2 1LHCH 2ODQA 3F1SB 2PHBA 1TONA 2PKAA 1XXFA 1YPMH 2PTNA 1O2HA 1S85A 1UO6A 3KN2A 3TJOA 3M7TA 3SU1A 1GBDA 3PYHA 3ATMA 1BB0B 1JRTA 3RXUA 3MOCA 4I8JA 2TPIZ 4J1YA 1K28D 1ESTA 2Y5FA 1P2MA 2ZNKH 1GDUA 5TCCA 1Q31A 3P8FA 3T27A 1HAIH 2ZTYA 4Y7BA 3GDVA 1LDTT 3T28A 3BG4C 1AUJA 3SHAH 1C5RA 1V2JT 3LU9B 4DG4A 1P2JA 3Q3KA 3SV9A 1G37A 2Z7FE 1TB6H 4NIYA 2Q1JA 5FHTA 2ZO3H 3NZIA 1EPTC 1TYNA 2ZDAH 1GG6C 1AY6H 4B2AA 1MU8B 5LH8A 1GBKA 3V13A 1V2MT 3SOSA 5C1XA 3O8CA 4AFSA 2VIVA 1GBLA 3L6PA 1OKXA 1EJMA 4CRAA 1CGHA 2XBWA 1V3XA 3FP7E 1HFDA 1AWHB 2BD5A 5JB8S 5I25A 3RM0H 1LVBA 3SNBA 5PTPA 4WWYA 4BTIB 1SHHB 1EZUC 1J16A 4Q7XA 2Y7XA 1O5EH 4B71A 3QX5H 1LHDH 2OD3B 2ZG0H 4IGDA 1CHOF 3EA7A 1HNEE 1UMAH 3K65B 1ZTJA 2GV7A 1JMOH 1ETSH 5JBTA 1C5NH 3LJJA 3RMOH 1O5BB 1O2KA 1O37A 1Z6EA 1ZGVA 2GX4A 3MNBA 2HNTF 4KTUA 5T6FA 1GMDG 1PPEE 5C1YA 3MH4A 3UPEA 4X1PU 1P2OA 1BTUA 4YOJA 1F5LA 1BMNH 1O3JA 2BZAA 2H9EH 3A87A 1BMAA 3VGCC 1TE0A 1QJ6B 2VB0A 1GBFA 1UTLM 4ABEA 3ZVCA 1ACBE 1NU9A 1OWKA 2VH6A 1JRSA 1C2GA 1MTSA 1Y5UT 1TOMH 4X2VA 3SU3A 4A92A 3ZVAA 1HGTH 5FAHA 1KTSB 2BYAX 2QF0A 4O9VA 2BQ6B 2V0BA 1GBJA 3RXTA 3QTOH 4AN7A 1QQ4A 4UDWH 2OQ5A 4A6LA 1BHXB 4RSPA 1HJAC 2Y80A 2OLGA 3K2UA 3BTWE 3I77A 3SJOA 4MG3A 4AFUA 2BDYA 1KXBA 2SGFE 5F6MA 1SVPA 3JZ1B 4FUCA 1HAZB 2BXUH 2BZ6H 2FS9A 1OOKB 1GJ8B 3GISB 3B8JA 1GL1A 4I32A 5LGOA 1FIZA 1PPCE 2QXIA 3A83A 3LT3A 3MU4A 3VB7A 5HGGA 2V35A 2O8MA 3H5CB 1EZSC 4VGCC 9ESTA 2F9NA 4NWKA 2B0FA 1MCTA 2J34A 2G4TA 3ATIA 1AN1E 5DP7A 4FVDA 3CS7A 3RLWH 3NCLA 3S9BA 4X6NA 1V2UT 3H7OA 2C8ZB 3KQDA 3SGAE 4YM9A 1G32B 3ZYDA 1JBUH 3LGUA 1MH0A 3C1KA 1S83A 1XUJA 3UR6A 1IQKA 3NK8A 3VXFH 2CN0H 1AE5A 1YPGH 1L1JA 4SGAE 1C5ZB 1W7GH 1FQ3A 3SGBE 1TRYA 2RDLA 2BLOA 1ARCA 3L3TA 4IC5A 2G51A 4X0WU 4J2YB 3ITIA 4JZEH 2A0QB 1S0RA 3SZNA 1IQLA 2C4FH 1TPOA 5EU8A 3TJNA 1O3MA 1ARBA 4FUHA 2IN2A
chains in the Genus database with same CATH superfamily
3OFND 2VU8E 1YLCA 1F5KU 2GKVE 1S5SA 1P9UA 1O32A 1ELDE 1GI8B 1DWDH 2OC0A 1AB9C 3GCNA 3GY8A 4Q80A 4M9FA 1J17T 3DSGA 3DFLA 4B73A 1SGIB 4BXSA 1T32A 2OUAA 4JYUH 4WH8A 3RM2H 1NM6A 1P9SA 1YYY1 2FOCA 3M7UA 1YPKH 1FPCH 3SN8A 1RIWB 1D9IA 1YLNA 1Z6JH 2JJ1D 3N7EA 1SGDE 2ZHDA 2FWWA 1O31A 1TOCB 5E2OA 1RTLA 1QRZA 5E2PA 1O3DA 1XVOA 2ALVA 2C8WB 5A8YA 1VR1H 3RMLH 1O2PA 4CBOA 3HKIB 4XFQA 5EXMA 3ZZDA 2M5TA 4SGBE 3MO3A 2FOHA 3ZZ3A 1FN8A 2L6OA 3PMAB 5DG6A 1OX1A 1ELFA 2BOHB 4D7GA 3KL6A 3EQ0H 4X2WA 1QJ1B 1G3EA 4Y0YE 1MD8A 5DP9A 2PGQB 1VITH 4F4OC 3RXOA 1V2TT 4FU9A 2H2ZA 1OWHA 3GDUA 2IJD1 3LGVA 2K1QA 4TY6A 2OBOA 4OS2A 4U2WA 2D2DA 4UFFH 2B7DH 2TBSA 1KXDA 3D23A 2ZC9H 2Z9KA 4DCDA 5LPFA 1EQ9A 1MQ6A 3A8AA 4YO9A 1NRSH 3BIUH 1P11E 1V2PT 2R0LA 3LIWA 4TSFD 2AFQB 3N7DA 1BTWA 2KM0A 1SPJA 4H6TA 5T6GA 1TAWA 1YPHC 4YT7H 3CNRA 4IW4E 4LXBH 1GPZA 1GVLA 2A4OA 3IG6B 1F92A 2PTCE 3BTGE 2ESTE 3SI4H 1IQHA 1Y3UA 3GCHC 1CT0E 2VIQA 3QGNB 3O8BA 2FIRH 4DT7B 1OWEA 5HM9A 1EP5A 1UCYK 1P10A 3SV2H 2XTTB 3TJVA 2G5VA 3A7VA 2CF9H 1FY4A 6CHAC 1O0DH 2KR7A 1GBAA 5EQSA 3URDA 1LHGH 1Z8IB 2RG3A 2XC0A 2XBVA 3G01A 1C2IA 4HFPB 1FJSA 3RXMA 3AASA 1FUJA 2W6ID 1DS2E 1UTNA 1GBMA 1DSUA 5DP8A 3RU4E 3SJKA 4KKDA 1E1RD 1F0TA 1ZSJA 3DSPA 4GUXA 1Z7KA 3NWUA 2P93A 1K21H 4CR9A 3MTYA 1O2TA 4AORA 4IN2A 4NZQA 1OWDA 3KGPA 4AGJA 4WVPE 1HPGA 1W7XH 3PO1C 4ISIH 3SUFA 5F03A 3TU7H 2UWOA 1N8OB 2J98B 3SI3H 2Z3EA 1NFWA 2WYJA 1FX0B 1PYTC 1DLKB 1TRNA 2P3TB 2LP6A 1XX9A 3RC5A 2FX4A 1MCVA 1ZRBA 4JCNA 1FIWA 1SR5C 3F2HA 3U69H 3RXVA 1TNIA 2QIQA 1AVXA 3WWBA 2A1DB 3I78A 4FUJA 2A7HA 1ZPZA 1TALA 2W26A 2CJIA 5JDUB 1SHYA 2STAE 5T1VA 2ZCLP 1S6HA 1BTYA 1Y5BT 1XXDA 1A3BH 2ZQ1A 2QE7D 1HV7A 5EQQA 1UVUH 2VWOA 2Q6FA 1GHXH 1QZ8A 1FLEE 3S7KB 3BIVH 2WPMS 1HXFH 4YXWD 3URCA 4BAHB 1AD8H 3A8CA 1OS8A 1YCPK 2WV9A 3F3BA 2J4IA 8ESTE 2ZECA 2O9QA 1ETRH 1Z8GA 1VZQH 1EAIA 2AYWA 3RP2A 3EAJA 5HM2A 1JWTA 1C5VA 2DUCA 1K9OE 4A1XA 1SC8U 4AZ2B 2ZF0H 4K8BA 2G8TA 2CGAA 2FX6A 3VXEH 2GZ7A 1P12E 3HGNA 4WF8A 4FXGH 4UE7H 1NPMA 2JH5D 1TNHA 2VVVA 4MNWA 2Z9JA 1GI9B 3FO8D 2VVUA 2BDCA 1O3PB 1QRWA 2RDEA 5GNDA 1A5IA 2GDEH 1SFQB 2YMSB 4GVUA 1ELCA 2ILNA 2D1JA 3MO6A 1AI8H 2FOEA 1ZMLA 3F9GA 1DUAA 2CHAB 4NIWA 2FXRA 3ZZ9A 2QXGA 1SOTA 3OTPA 1YC0A 1TBRH 1YPEH 2JETC 3A80A 2ZDMA 4I8LA 2FI3E 4B2BA 1RD3B 3UTUH 3RXEA 2Z9GA 1N8OC 2AGIX 2QXJA 2WUCA 5C20A 5K7RA 1SLVB 3SUGA 1IQFA 1GMDF 3RXBA 1O5CB 2Y82A 1MBQA 1OHHD 1QL7A 1DITH 2ULLA 1PPZA 3ATKA 1T4VH 4BAOB 3GY3A 3RC4A 1BRAA 1TA2A 2C93B 2XYAA 2ANKH 1HAGE 8GCHF 1ZHPA 4DY7B 1MTVA 3LH1A 1Z1IA 3N7OA 1BUIA 5ETXA 1GI7B 1GGDC 1O2UA 3M37A 1S0QA 4I86A 2NU3E 5EJLA 5EODA 3V7TA 2J95A 2XBYA 1NFYA 1UVTH 3PWCA 5A09A 5HYOA 1DVAH 1VJ9U 1P05A 5FPTA 3ZZAA 2XBXA 1KDQB 3E1XB 4GCHG 4Y8ZA 1H1BA 4FU7A 3T62A 1O2MA 1C1UH 3ZZ4A 4FUEA 2BDHA 3RXJA 1WCZA 1QBVH 4INKA 4NA8A 3LOXA 4H6SB 1INCA 3EDXB 1O2YA 1QJ7B 2ZPRA 1BJUA 1C2JA 1UTOA 2BY9X 1HBTH 3VG8A 4NGAH 3GCTG 4Z0KA 2FPZA 2Q6GA 2HVYB 3KQBA 5TJXA 2UUKB 1QIXB 4Z1MD 3O8DA 1P01A 3T2NA 3SNDA 1O2RA 4ZHLU 2GT7A 1KXCA 1OP8A 1Q2WA 4D9RA 1C9PA 4DW2U 2W5EA 2H9HA 2FZZA 3KIDU 1QA7A 1DFPA 4UFEH 1EKBB 4HGCA 5EJZA 2P16A 2J94A 2O8LA 1AKSA 1J9CH 2ZGJA 3MMGA 4JZ1A 4FUIA 4VGCB 3RMMH 3MH5A 1TX8A 1O3KA 4TT3D 2B5TB 1PPFE 2QV1A 1QFKH 4YZUA 2P94A 4XBBA 4U01A 4B6EA 2EA3A 4K69A 2FTLE 1SI5H 3W94A 2ANWA 1L4ZA 4O97A 3P6ZB 1D3TB 4WH6A 1HB0B 2BD2A 4Q7ZA 5DSFA 1P02A 1UJ1A 4NCYA 1ZLRA 2F4LA 5FX6A 1FMGA 1MUEB 4ZXXH 3VB4A 4CRCA 3E8LA 3OU0A 3M5NA 2FLBH 2R3YA 4GLYA 4TWWA 1YCPM 3T29A 2BLVA 1VGCC 4TPIZ 1O38A 1ZTLA 3CENA 4BOHA 3UQOA 1O2SA 3F9HA 1G36A 1E34B 1OWIA 4IC6A 2HNTE 3ZV8A 4MNYA 5I46H 4JYTA 2CXVA 3TK9A 3U1IB 4A1VA 4JMYA 2GP9B 3VB6A 5C67A 2Z6BD 1HLTH 1KXAA 5E8EH 2BX3A 2YOLA 1TPAE 3AAUA 2WV5A 2J5UA 3MFJA 1CBWB 1A0JA 5HKKD 1AB9B 1QTFA 2G81E 1C5YB 3U9AH 2H6MA 1ANBA 1XUKA 1O2XA 4FUFA 2FOBA 3GY6A 2O8UA 3L33A 1SG8B 2H9TH 4ZHMU 2PUQH 1HAVB 3UIRA 4ESTE 1K1LA 4Q2KA 2AEIH 4E7RG 1NN6A 3FANA 1QL9A 1ZHMA 1C5WB 3DD2H 1KLIH 1GHBF 2FYQA 1U6QA 4ZKOU 1CVWH 1EUFA 4RI0A 2A32A 1A2CH 1SLWB 1Y3VA 7GCHF 2JH0D 5CDFE 2FOMB 1HIAA 1WAYB 1GI2A 2PGBB 3A7ZA 3U8TH 1C2LA 3KYFA 5E0HA 1AU8A 1ETTH 1AQ7A 4WY3A 2XWBI 3BTKE 1SGPE 1C9TA 1Y3YA 3TVJB 3EGKH 1E1QD 1CA0B 4RKJB 1Z8JB 1O2LA 3BTFE 3VB5A 2XRCA 1WQVH 1O3GA 2R0KA 1ABIH 4CH8B 1PQ8A 1LQEA 2O8TA 2PKSC 1L0ZA 2PR3A 5TCAA 3PLKA 2V3OH 3RDZA 5JPMH 2FI4E 1XUHA 3V0XA 3SNEA 2QN5T 1QRXA 2GGVB 4Q7YA 2FOAA 1GGDB 2FOGA 2ZFSA 3HGPA 1AIXH 2BTCE 4MVNA 2H5DA 4XBCA 1AZZA 3NPSA 5DJ7A 1TNJA 3S9AA 4ACBA 4UD9H 1QHRB 3GY5A 1G3DA 1EOJA 3RXCA 3S9CA 2GCHF 1O2JA 1UTQA 2BD8A 1MTNB 1S6FA 5DN6D 3MNSA 2VINA 1CT2E 5C0UA 2WPIS 1UVOA 3BEUA 4ZCNA 1AVWA 3MU5A 4ABBA 3ZZBA 5EGMA 1C5SA 1UK3A 3BTHE 5CHAC 4E06H 4YTAA 2NU0E 5IK2D 3LJOA 1K1OA 3ATLA 1GJ9B 3UQVA 2BQ7B 1ZOMA 1XKAC 3BSQA 3NRLA 3FAOA 2ZHWH 1C2DA 3M3SA 1TX6A 3PTBA 4TYDA 1PJPA 3E16B 2W6JD 1TMTH 2RFKC 1LHEH 1EAUA 1QBOA 2Z3CA 3SU5A 3SUEA 1EASA 1XM1A 3GYMA 3RXRA 3ZVDA 1C2MA 4YOIA 3FVFB 4X1RU 3KQEA 3RC6A 1VCWA 1IHSH 2KCPA 1NY22 4B1TA 2KCAA 4KGAA 2GCHG 2I6QA 5KECA 4CRGA 2FP7B 3LGYA 5GWZA 1H9LB 1FV9A 2A5IA 2YMSD 1ELGA 1LPKB 1YGCH 1NZQH 3MU1A 2WPKS 2YNAA 1IQEA 1GHWH 3PMBB 1G9IE 1AUTC 2PLXA 2VGCB 3GY7A 2CK3D 3RXQA 3F9EA 1GL0E 2JETB 2V3MA 2UWPA 1THRH 4X8VH 5EXLA 1K1JA 2ALPA 1DANH 1K1MA 5L30H 1WXRA 3VPKA 3LDXH 4FETA 2OCVB 4TY7A 1OYQA 4ABHA 2Y5HA 1O2NA 2SGPE 4QT8C 3OAAD 3M5OA 1P2QA 3RXSA 5A0BA 2F43B 3PRBA 3QGJA 3E91A 4BNRA 1O3OA 1EOLA 1YWUA 1FDPA 3PMJA 1E0FD 3TK5A 2AIPA 2PKAB 3OYPA 5EIYA 3TLOA 1YM0A 1DXPA 1K1PA 1ELVA 5EW1H 5EJ1A 1SGCA 1ZSKA 2GV6A 3TITA 2QCYA 1EP6A 1F7ZA 2AS9A 2HPQH 2RA3A 4IS5A 1NRRH 1G3CA 2VIOA 3P17H 4AFQA 7GCHG 2Z9IA 5E0GA 2CF8H 2M2AA 1O39A 2C8YB 1EJNA 1WV7H 2QGRA 3Q3XA 3KCGH 2ZTZA 3LC3A 1LVOA 5JBCS 4ZHAA 1MBMA 4INLA 1RRKA 4INHA 7KMEH 4A5TS 5GIBA 2ZCKP 2FTMA 3EA9A 5FCRA 1W12U 1YBWA 1LVMA 4FOUC 4O3TA 2TIOA 3W95A 2ZU5A 3M3VA 1EB2A 3TIUA 1FY1A 1VITF 3ZZ5A 2ZFQH 4Y11E 4MPVA 3TGKE 1V2RT 2ZPSA 4GHTA 2D26C 4BANB 2BLQA 3PLPA 1O3BA 2OC7A 4ISLA 2BY5X 1SB1H 3RXKA 3TH2H 3K9XB 1HJ9A 3ODDA 4K1EA 4R8TB 1P04A 4OS1A 2PWXA 3MQKC 3OTJE 3ZVBA 1KXFA 3SBKA 1OXGA 3DCLA 2Y7ZA 1GHZA 1GCTB 2A4GA 1BCUH 4Y8YA 5GXPA 3Q76A 4JYVH 4LOYH 3RU4D 2BXTH 3ZZ7A 1ID5H 4THNH 1C4U2 1LHFH 2J92A 4LZ1H 1QNJA 3A81A 3UUZA 4A7IB 2Y6TA 3PM3A 5A8ZA 1ZJKA 4ABDA 2AMQA 2ZU4A 4NWLA 1O3LA 1Z8RA 1J14A 1HAPH 3QWCH 3VGCB 1BTZA 2FEQH 1HAHH 1AE8H 1ELBA 1TABE 1GMHF 1CE5A 2GJGA 4XBDA 3HATH 4WXIA 1A61H 1DSTA 4RKOB 1O2OA 1TIOA 1COWD 2J38A 5JB9S 2PW8H 4MNVA 2DE9A 5GPIB 3UWJH 1TGBA 1C1MA 3A85A 3A84A 5AHGH 3GYLB 3GCHB 4Y6DA 3UNSA 3KNXA 2PSYA 1PQ7A 2ZDVH 4WMEA 4KTSA 1QB6A 3PRDA 5JBBS 4D76A 1GHAF 1ZMJA 4ZKRU 3HKJB 1SQOA 1HUTH 3SGQE 4FVBA 1GVZA 1AVGH 1SGFG 2BDIA 1K22H 1RXPA 3EE0B 1ZMNA 1UCYH 2BD4A 1IQNA 1QY6A 2AERH 1TRMA 5L2YH 1ANEA 3EA8A 3MNCA 1RJXB 2FM2A 1AKSB 4X8TH 4ABFA 1W2KH 2BLWA 1RGQA 3Q77A 2FO9A 1WDIA 1DE7H 4IMQA 3FP6E 1PQAA 1RS0A 5LPEA 2KX4A 1TLDA 1V2LT 2OC8A 3STIA 5A0AE 3RUOA 2WPJS 1ANDA 3AVZA 1RIWC 2OINA 3PO1B 1MTWA 2VVCA 2ZHQH 3MU0A 3VEQB 1LQDB 1V2OT 1BTHH 4GPGA 5DGJA 1NRQH 2KCYA 1A4WH 2ZHEH 1BA8B 1T8LA 1W0JD 1XKBC 1JIMA 3O8RA 1W3CA 1S82A 3LGTA 2UUYA 5DO4H 1FONA 2ANYA 2KAIB 5LPRA 1E79D 4I8HA 3T26A 1SQTA 2ZPQA 4HZHA 1D3DB 2HOBA 4JZIA 2ZU1A 3LGWA 3F2FA 3M3TA 1DICA 3K6YA 2A31A 1EZXC 2A45B 1VGCB 1B0EA 4H42U 3QDZB 4XRNA 5AFYH 2GVFA 5EQRA 1DXWA 4ISNA 1BOQA 5DP3A 4Y71A 2BY7X 2DE8A 1GHVH 1W14U 3H09A 4X8SH 3E3TA 4ZKSU 1GBIA 2AGGX 1GVKB 1AFEH 1UW7A 1TFXA 2QYIA 2HWLB 1JXPA 2EI6A 3ODFA 1QR3E 1SMFE 1W10U 5HMAA 1P06A 1DWBH 3BTTE 2FS8A 2STBE 1A46H 1LKBA 4RT0A 5GDSH 2EQNA 2UUFB 5SGAE 1C5QA 1T7CA 1CSOE 1EZQA 3OEHD 4X6OA 5C3NA 1ELAA 2QAAA 3SJ9A 1O3AA 4AB8A 2XOKD 2UUJB 1O36A 5T6DA 3E6PH 1NESE 1BMMH 5GJ4B 1S81A 2ZFTA 1IHTH 5B6LA 1KIGH 1GDNA 1JIRA 3VB3A 2FESH 5C17A 4KP0A 4LK4A 1OP0A 3BG4B 2VIDA 4BTUB 1P2KA 1ZZZA 1O3EA 5K0HA 3HK6B 2BM2A 4ZUHA 1PPGE 4AGKA 1GI4A 4FUBA 1GI3A 2BQWB 4BXWA 3OY5U 1O5FH 5F8ZA 5BRRE 5HIYA 1K1NA 3F9FA 1DPOA 2SFAA 2Z3DA 1OSSA 2A7JA 5JYIA 3P8NA 4XD7D 6LPRA 1SGEE 1C5OH 3E90B 1MKWH 1SOZA 4U32A 3ZVEA 1C5TA 1DWCH 2VGCC 1KY9A 2GT8A 2B8OH 3TNSA 1HAOH 1ESBA 1KMHB 1V6DA 2G5NA 3MYWA 2XCNA 1DY9A 3SORA 1HRTH 1H8ED 5FCKA 1ZRKA 1O2GH 1DDJA 1E38B 4CREA 1GHYH 2SGEE 2WV4A 1OP2A 4D8NA 1ZTKA 1C1QA 1ZGIA 1AFQC 1SBWA 3RXHA 4CRBA 1H9IE 3W1EA 6GCHG 1NS3A 1GI1A 1XMNB 2THFB 1QBNA 4B75A 2ZU3A 2BOKA 1XUGA 3UNQA 1SGFA 1MKXH 1L1GA 4CH2B 4DOQA 3V3MA 1RTFB 1TGNA 1DX5M 4ABAA 3B9FH 1VCQA 1ESAA 3KF2A 1E36B 3SZEA 2WUBA 1LO6A 4X2YA 4P02A 4FUGA 4X6MA 4YESB 1SGRE 5IYTA 2K0QA 2LELA 5EPNA 1RTKA 1Y8TA 3RLYH 3SU2A 1KTTB 1C1WH 4K1SA 1SKYE 2VBCA 2F9OA 2J97A 2QA9E 3OY6U 4X6PA 1NU7B 1VITG 2C90B 2BB4A 4I31A 3M61U 2FMJA 4Y0ZE 3P70B 4CHAC 2I6SA 3QZRA 1BZXE 1MU6B 1ZR0A 1GMCG 2KAIA 1FAKH 1KYNA 1VCPA 3ZIAD 3RXGA 1MZDA 3DHKH 3HK3B 3F6UH 4NA7A 1IQGA 1GDQA 2P3UB 2ZA5A 1TNGA 1BBRK 1NT1A 4X2XA 2VWMA 1DWEH 5A8XA 1A0HB 5J4QA 3QO6A 2EC9H 1ZPCA 2VWNA 4M7GA 5L2ZH 2UWLA 1UVSH 1GJCB 1EATA 1Y3WA 3DUXH 5A2MH 3BG8A 5JBAS 1O2ZA 3OE7D 2ZGHA 2K8IA 3MO9A 3DFJA 4FU8A 3AAVA 1GI6A 5EPYA 2B9LA 3DSOA 3A7TA 2F3CE 1YP9A 3F68H 4ZKNU 1P3CA 1TGTA 1Z71A 3A89A 4WMFA 4KELA 3U8RH 2WINI 4KTCA 5C1UA 3SQEE 3SU6A 4CRFA 1MKXK 4ISHH 1UHBA 3ZZ6A 1YCPH 3KEEA 3SV6A 3PTNA 1C2HA 2ZI2H 1GJ7B 6GCHF 1O35A 2F91A 2VJ1A 2BDAA 2GD4B 2AGEX 1H4WA 2FLRH 2JDID 3OEED 3TNTA 2FODA 4XSKU 1PFXC 3N99A 4WMDA 3SHCH 3R0FA 1C2FA 1O2QA 1CHGA 4ABIA 4OM9A 1C5XB 1TGCA 1A0LA 2C8XB 4ZROA 3A7WA 5F8XA 1QQUA 3BTQE 3RXLA 2ZTXA 2BHGA 2TRMA 3GCTF 2BVRH 2WYGA 3SO3A 1LTOA 1SL3A 1WSSH 1HXEH 1LVYA 4DVAU 3V12A 1CGIE 2J9NA 7ESTE 3KHVA 1O2VA 5CHBA 3TGIE 5ESBA 1F0UA 2ZWLH 2HLCA 4WJG2 3MHWU 1TNLA 4GCHF 2FOFA 2FYRA 5C5NA 3ZV9A 1NBMD 1E37B 1KSNA 2P95A 1TPPA 4I33A 3PV2A 1C5PA 2O8WA 1BHXF 1H9HE 2SGQE 1GBEA 4OS4A 2XW9A 3IWMA 1SLUB 2F9UA 3D49H 1C2KA 1YLDA 1GBBA 3LH3A 1F0RA 3STJA 5C2ZA 4O3UA 1YPHE 3R3GB 4AYYB 2ODYB 8GCHG 2GCTB 4NFEA 2ZFFH 4X1NU 1TQ0B 1ELEE 1KLJH 2ZU2A 1BRBE 1W0KD 1HAYB 1O3NA 2Z94A 2VIWA 4B2CA 1AGJA 1IQJA 2HLDD 1H8DH 3M35A 3KQ5A 3SUDA 3A8BA 4R0IA 2OP9A 4ZMAH 2BD3A 5FX5A 5DPAA 2BD7A 3P92A 3P95A 2ZQ2A 2FDAA 3ZZ8A 2ZGXH 2QF5A 4ABGA 2V6NA 2QC2A 4MPWA 2A2QH 2QY0B 2XXLA 4Q63A 2ZDLA 2H1UA 3CS0A 3B23B 3PLBA 1G2MA 1FNIA 2W7UA 4ZH8A 3U98H 1C1RA 1J8AA 2WPHS 4Y7AA 3ZZCA 5C0TA 1MTNC 1WOFA 2D8WA 3TH4H 3SV7A 3GDSA 4IMZA 1NRNH 1ZPBA 4X1SU 1FY5A 1KDQA 5GCHG 3M36A 1YKTA 2FI5E 2F9PA 2ZP0H 5FPSA 4ABJA 1EXFA 8KME2 1TQ7B 1P8VC 4K3JA 1FY8E 1UTKA 2J2UA 2XNDD 4D7FA 3MI4A 1GHAG 1DT2A 1CU1A 1YF4A 4CR5A 1ZJDA 2P59A 1TBZH 1N1LA 2G00A 5A0CA 3RU4T 2LNCA 3RXPA 1SGNE 5CMXH 1LPGB 1BMLA 4CHAB 1THSH 2GMTB 1O3IA 1FN6A 1ELTA 1QA0A 5C94A 1K2I1 1SGQE 3ESTA 4B74A 4K60A 2TGAA 3QUMP 2IPHA 4JZDH 2W3KA 3M7QA 2SGDE 2OQUA 4BAQB 1BIOA 5T3HA 1V2ST 2SNWA 1X7AC 2ZDKA 1D6RA 1DM4B 1G3BA 1BT7A 1T8MA 1ANCA 2A4RA 4MNXA 1MD7A 1MAYA 2TGPZ 1CHOG 2BMGB 1IAUA 3BV9B 4GHQA 3SNAA 4NIXA 4OS5A 3FFGA 3UR9A 4Z6AH 1BTPA 1MKWK 3PROA 4AFZA 1NROH 5FPYA 1GJBB 1UCYE 1GMHG 3MNXA 1F0SA 4YOGA 1HIAB 3LC5A 4XDEA 2BY8X 2SGAA 1V2WT 1NC6A 4Y79A 3WW7A 2HNTC 1MZAA 2BVXH 5DK1A 1GJDB 1W13U 2PKSB 4YLUA 1G30B 2ANMH 3QK1A 4BAKB 4BAMB 4YLQH 2G52A 5IDKA 2F9BH 3P8OA 2VH0A 2NU1E 1CQQA 3JZ2B 2TGTA 3DT0H 1C5UA 3WWFA 2KZ4A 5EW2H 2PFEA 5AF9H 3F0OA 1L1NA 2HALA 1BRCE 3AW0A 5ESTE 1HAXB 1O3FA 1V2QT 4OGXA 4UEHH 1WQSA 2XNIA 3U1JB 2QXHA 1N6YA 4UFGH 3LPRA 1W11U 4UFDH 2WPLS 4TWYA 4HI3A 1JOUB 1P3EA 4BTTB 4NSVA 2KFWA 4OS6A 1GWAA 6CHAB 1WUNH 1HDTH 4K5ZA 1O2IA 1O5GH 4MQAA 4YT6H 2ZHFH 1A3EH 3MH7A 4AG1A 8LPRA 3NKKA 2GDDA 5E0JA 2OXSA 3QLPH 4DT4A 2WZQA 4F48B 1BBRE 1P09A 3T25A 3RXFA 4CRDA 3RXAA 2F83A 1C2EA 1SSXA 3MWIU 4AYVB 1A5HA 1A5GH 4AG2A 2KCOA 2Y5GA 2G4UA 4K2YA 3SU0A 3WY8A 4IBLH 1O5DH 2TGDA 2ODPA 1C5LH 1OPHB 2CV3A 1WBGB 3UWIA 4I7YH 1CA0C 3ENSB 1GBHA 3ZVGA 1C1PA 3I29A 5HXFA 3UREA 4XE4A 7LPRA 1G2LA 1HYLA 1WTHD 1BDAA 1QCPA 4X8UH 1P03A 1TGSZ 1SGTA 2PSXA 3TPIZ 1AZ8A 1D4PB 1UVPA 1T4UH 1BJVA 1CT4E 2G55A 2BDBA 5GCHF 2W3IA 1GJ5H 2EI7A 3AK5A 1FXYA 3LONA 1S84A 1AFQB 1LMWB 2NU2E 2AMPA 3GS9A 4A1TA 1YPJH 3S0NA 1E35B 5EXNA 9LPRA 2XWAA 2AMDA 3BN9A 1Z1JA 3UY9A 2ZGBH 3ZVFA 4PROA 3SJIA 1EPTA 2ZKSA 4F49A 4DIIH 3D62A 4JZFH 2WPDD 4JK5A 2EEKA 4HTCH 5CHAB 2R9PA 2YNBA 2BD9A 1ZHRA 1EJAA 1T31A 2JJ2D 2BVSH 3FP8E 1DY8A 4RN6A 3LKWA 1UK4A 5KEDA 4OS7A 1MQ5A 5CE1A 1MAXA 1F2SE 4U30A 4CBNA 1TWXB 1EPTB 1N6XA 3KQCA 1GG6B 2IPQX 3BTEE 5B6OA 1GBCA 1UTMA 3AW1A 1P57B 4Q4LA 2CMYA 1J15A 3PMHB 3FZZA 3GOVB 1Y5AT 1OYTH 1B5GH 1HJ8A 3ZYEA 3ELAH 1D6WA 2ZCHP 3ATWA 1OWJA 3U28C 2JH6D 2ASUB 3NUMA 1O2WA 2R2MB 1PPHE 2H5CA 4X1QU 3SU4A 2JIZD 1FZZA 1C1OA 2XC4A 2XCFA 1YPLH 3A7YA 2A5KA 2Q6DA 1TMUH 1AWFH 1ZYOA 3A8DA 5FBIA 1NRPH 2OBQA 4P00A 1MTUA 1UHBB 1GI5A 4NSYA 1GMCF 1CGJE 1M9UA 1O30A 3EYDA 3MU8A 3E0PB 1QL8A 1LKAA 2R3UA 4F55A 1NO9H 4MPXA 4ZAEA 2Y81A 5EG4A 1GCTC 4B6FA 4DIHH 1HCGA 4O03A 1H8HD 5FXLA 1EX3A 1QB9A 1B0FA 3BF6H 3GCOA 3PV4A 3MH6A 1EB1H 1P2NA 1C1NA 2RA0A 3SJ8A 1C4Y2 4MLFB 1FAXA 3C27B 5AVDA 1SGYE 1SLXB 2PUXB 3UAIC 4MDSA 1KLTA 1F5RA 4H4FA 1DOJA 4E05H 3GY2A 4WXVA 1ABJH 1L4DA 1CBWC 1SQRA 1TX7A 3A82A 3GY4A 5C5OA 2P8OC 2VNTA 3BEIB 3DA9B 6ESTA 1IQMA 1W0ZU 2ZFPH 2RCEA 3TGJE 1EFRD 4DJZB 1K1IA 5AFZH 4I8KA 1BBRH 3QZQA 1O3CA 2OTVA 1FI8A 1C1TA 1FY3A 2W7SA 1WTGH 1GHBG 4I8GA 2SNVA 3P8GA 2LPRA 3T5FH 3SW2B 1YY3A 1GJ4H 2HGTH 1CO7E 3S69A 2NU4E 2V3HH 2WHXA 1LCYA 2C3SA 3OX7U 3BEFB 3GICB 4ISOA 4Y10E 1GBTA 3UOPA 1XUFA 2GCTC 1TA6A 3LGIA 3TH3H 2PV9B 2A7CA 1QGFA 2VWLA 1NFXA 5H4IB 2A4QA 1P2IA 3A86A 1GI0A 1BQYA 2OC1A 4JK6A 4D9QA 2JKHA 1BTXA 1C1VH 1TPSA 2GZ9A 3NXPA 5L6NH 3BTDE 2F9VA 4K8YA 3U8OH 4ASUD 4MTBA 2BY6X 4NIVA 1EAWA 1SFIA 3D65E 4XOJA 1GCDA 2GZ8A 3EE7A 4DGJA 1GJAB 1UTPA 4OGYA 3QN7A 3SQHE 3M5MA 1EAXA 3QTVH 1TMBH 1WYKA 1AHTH 2XC5A 3KYGA 1UTJA 1QURH 2PP6A 3HPTB 5FBEA 1C1SA 3VFEA 3SV8A 4NG9H 1WU1A 4AX9H 1Y59T 3S7HB 1D3PB 1V2KT 5DP6A 1PQ5A 3UB0A 1PYTD 4LZ4B 1TNKA 3FZDA 3H7TA 5BPEA 1W8BH 1HAVA 1LPZB 1RFNA 4FUDA 4NA9H 1CA8B 4AOQA 5FL7D 1AMHA 1DUEA 3K6ZA 2HPPH 4Y8XA 2ZZUH 4MPUA 4ZXYH 2BDGA 5EOKA 4GAWA 3SNCA 1A1RA 4DURA 4UONA 1V2NT 1XVMA 1A7SA 4E7NA 3UOUA 4ASHA 1DLEA 3M5LA 5F8TA 1B7XB 1P0SH 3BTME 1V2VT 5DP4A 2GMTC 3TJUA 1C5MD 2P8OB 3RXIA 1NFUA 2R2WU 1NTPA 3A88A 5DP5A 4NZLA 1AO5A 1ORFA 3PWBA 2ZIQH 1MMJN 3A7XA 2L74A 1T8NA 2ZFRH 3E0NB 2AH4X 4NFFA 1GJ6A 3OSYA 3RMNH 2CHAC 2OK5A 4HG6A 5ABWA 1SQAA 1L2EA 1PPBH 2NWNA 3RXDA 1Y3XA 2IJOB 1ZSLA 2ZGCA 4AB9A 2A2XH 1Q3XA 1HJAB 1O3HA 1W0YH 2EI8A 2ZDNA 1D3QB 1BRUP 2ZEBA 1KXEA 1H8IH 2IOTA 3SYJA 4K1TA 4B76A 4TPYA 1IQIA 1O34A 1UK2A 1O5AB 2AHME 3CP7A 2A5AA 1FPHH 2AIQA 4GSOA 5KGOA 5J4SA 3PB1E 2QF3A 3F0PA 3FOAA 5DKMA 2GTBA 3Q3YA 3UFAA 1VJAU 1IOEA 1T8OA 3UNRA 1O33A 2BX4A 1BITA 1TBQH 1XUIA 3Q00A 4IN1A 1NBME 3TK6A 2HRVA 2VIPA 3IITA 4Y76A 1THPB 1QB1A 2HVXA 2P3FH 2Z9LA 5G4BA 1C4V2 1LHCH 2ODQA 3F1SB 2PHBA 1TONA 2PKAA 1XXFA 1YPMH 2PTNA 1O2HA 1S85A 1UO6A 3KN2A 3TJOA 3M7TA 3SU1A 1GBDA 3PYHA 3ATMA 1BB0B 1JRTA 3RXUA 3MOCA 4I8JA 2TPIZ 4J1YA 1K28D 1ESTA 2Y5FA 1P2MA 2ZNKH 1GDUA 5TCCA 1Q31A 3P8FA 3T27A 1HAIH 2ZTYA 4Y7BA 3GDVA 1LDTT 2V7QD 3T28A 3BG4C 1AUJA 3SHAH 1C5RA 1V2JT 3LU9B 4DG4A 1P2JA 3Q3KA 3SV9A 1G37A 2Z7FE 1TB6H 4NIYA 2Q1JA 5FHTA 2ZO3H 3NZIA 1EPTC 1TYNA 2ZDAH 1GG6C 1AY6H 4B2AA 1MU8B 5LH8A 1GBKA 3V13A 1V2MT 2EY4C 3SOSA 5C1XA 3O8CA 4AFSA 2VIVA 1GBLA 3L6PA 1OKXA 1EJMA 4CRAA 1CGHA 2XBWA 1V3XA 3FP7E 1HFDA 1AWHB 2BD5A 5JB8S 5I25A 3RM0H 1LVBA 3SNBA 5PTPA 4WWYA 4BTIB 1SHHB 1VKYA 1EZUC 1J16A 4Q7XA 2Y7XA 1O5EH 4B71A 3QX5H 1LHDH 2OD3B 2ZG0H 4IGDA 1CHOF 3EA7A 1HNEE 1UMAH 3K65B 1ZTJA 2GV7A 1JMOH 1ETSH 5JBTA 1C5NH 3LJJA 3RMOH 1O5BB 1O2KA 1O37A 1Z6EA 1ZGVA 2GX4A 3MNBA 2HNTF 4KTUA 5T6FA 5HIZA 1GMDG 1PPEE 5C1YA 3MH4A 3UPEA 4X1PU 1P2OA 1BTUA 4YOJA 1F5LA 3PV5A 1BMNH 1O3JA 4RT1A 2BZAA 2H9EH 3A87A 1BMAA 3VGCC 1TE0A 1QJ6B 2VB0A 1GBFA 1UTLM 4ABEA 3ZVCA 1ACBE 1NU9A 1OWKA 2VH6A 1JRSA 1C2GA 1MTSA 1Y5UT 1TOMH 4X2VA 3SU3A 3F2GA 4A92A 3ZVAA 1HGTH 5FAHA 1KTSB 2BYAX 2QF0A 4O9VA 2BQ6B 2V0BA 1GBJA 3RXTA 3QTOH 4AN7A 1QQ4A 4UDWH 2J98A 2OQ5A 4A6LA 1BHXB 4RSPA 1HJAC 2Y80A 2OLGA 3K2UA 3BTWE 3I77A 3SJOA 2YMSC 3FKSD 4MG3A 4AFUA 2BDYA 1KXBA 2SGFE 5F6MA 1SVPA 3JZ1B 1MABB 4FUCA 1HAZB 2BXUH 2BZ6H 2FS9A 1OOKB 1GJ8B 3FN8A 1K0HA 3GISB 3B8JA 1GL1A 4I32A 5LGOA 1FIZA 1PPCE 2QF4A 2QXIA 2WSSD 3A83A 3LT3A 3MU4A 3VB7A 5HGGA 2V35A 2O8MA 3H5CB 4ACAA 1EZSC 4VGCC 9ESTA 2F9NA 4NWKA 2B0FA 1MCTA 1BMFD 2J34A 5F53A 2G4TA 3ATIA 1AN1E 5DP7A 4AC9A 4FVDA 3CS7A 3RLWH 3NCLA 3S9BA 4X6NA 1V2UT 3H7OA 2C8ZB 3KQDA 3SGAE 4YM9A 1G32B 3ZYDA 1JBUH 3LGUA 1MH0A 3C1KA 1S83A 1XUJA 3UR6A 1IQKA 3NK8A 3VXFH 2CN0H 1AE5A 1YPGH 1L1JA 4SGAE 1C5ZB 1W7GH 1FQ3A 3SGBE 1TRYA 2RDLA 2BLOA 1ARCA 3L3TA 4IC5A 2G51A 4X0WU 4J2YB 3ITIA 4JZEH 2A0QB 1S0RA 3SZNA 1IQLA 2C4FH 1TPOA 5EU8A 3TJNA 1O3MA 1S6LA 1ARBA 4FUHA 2IN2A
chains in the Genus database with same CATH topology
2VU8E 1YLCA 1F5KU 2GKVE 1S5SA 1P9UA 1O32A 1ELDE 1GI8B 1DWDH 2OC0A 1AB9C 3GCNA 3GY8A 4Q80A 1J17T 3DFLA 4B73A 1SGIB 4BXSA 1T32A 2OUAA 4JYUH 4WH8A 3RM2H 1NM6A 1P9SA 1YYY1 2FOCA 3M7UA 1YPKH 1FPCH 3SN8A 1RIWB 1D9IA 1Z6JH 1SGDE 2ZHDA 2FWWA 1O31A 1TOCB 5E2OA 1RTLA 1QRZA 5E2PA 1O3DA 1XVOA 2ALVA 2C8WB 5A8YA 1VR1H 3RMLH 1O2PA 4CBOA 3HKIB 4XFQA 5EXMA 3ZZDA 2M5TA 4SGBE 3MO3A 2FOHA 3ZZ3A 1FN8A 3PMAB 5DG6A 1OX1A 1ELFA 2BOHB 4D7GA 3KL6A 3EQ0H 4X2WA 1QJ1B 1G3EA 4Y0YE 1MD8A 5DP9A 2PGQB 1VITH 4F4OC 3RXOA 1V2TT 4FU9A 2H2ZA 1OWHA 3GDUA 3LGVA 2K1QA 4TY6A 2OBOA 4OS2A 4U2WA 2D2DA 4UFFH 2B7DH 2TBSA 1KXDA 3D23A 2ZC9H 2Z9KA 4DCDA 5LPFA 1EQ9A 1MQ6A 3A8AA 4YO9A 1NRSH 3BIUH 1P11E 1V2PT 2R0LA 3LIWA 2AFQB 1BTWA 4H6TA 1SPJA 5T6GA 1TAWA 1YPHC 4YT7H 4IW4E 4LXBH 1GPZA 1GVLA 2A4OA 3IG6B 1F92A 2PTCE 3BTGE 2ESTE 3SI4H 1IQHA 1Y3UA 3GCHC 1CT0E 2VIQA 3QGNB 3O8BA 2FIRH 4DT7B 1OWEA 5HM9A 1EP5A 1UCYK 1P10A 3SV2H 2XTTB 3TJVA 2G5VA 3A7VA 2CF9H 1FY4A 6CHAC 1O0DH 1GBAA 5EQSA 3URDA 1LHGH 1Z8IB 2RG3A 2XC0A 2XBVA 3G01A 1C2IA 4HFPB 1FJSA 3RXMA 3AASA 1FUJA 1DS2E 1UTNA 1GBMA 1DSUA 5DP8A 3RU4E 3SJKA 4KKDA 1ZSJA 1F0TA 4GUXA 1Z7KA 3NWUA 2P93A 1K21H 4CR9A 3MTYA 1O2TA 4AORA 4IN2A 4NZQA 1OWDA 3KGPA 4AGJA 4WVPE 1HPGA 1W7XH 3PO1C 4ISIH 3SUFA 5F03A 3TU7H 2UWOA 1N8OB 3SI3H 2Z3EA 1NFWA 2WYJA 1PYTC 1DLKB 1TRNA 2P3TB 1XX9A 3RC5A 2FX4A 1MCVA 1ZRBA 4JCNA 1FIWA 1SR5C 3U69H 3RXVA 1TNIA 2QIQA 1AVXA 2A1DB 3I78A 4FUJA 2A7HA 1ZPZA 1TALA 2W26A 2CJIA 5JDUB 1SHYA 2STAE 2ZCLP 1S6HA 1BTYA 1Y5BT 1XXDA 1A3BH 2ZQ1A 1HV7A 5EQQA 1UVUH 2VWOA 2Q6FA 1GHXH 1FLEE 3S7KB 3BIVH 2WPMS 1HXFH 3URCA 4BAHB 1AD8H 3A8CA 1OS8A 1YCPK 2J4IA 8ESTE 2ZECA 2O9QA 1ETRH 1Z8GA 1VZQH 1EAIA 2AYWA 3RP2A 3EAJA 5HM2A 1JWTA 1C5VA 2DUCA 1K9OE 4A1XA 1SC8U 4AZ2B 2ZF0H 4K8BA 2G8TA 2CGAA 2FX6A 3VXEH 2GZ7A 1P12E 3HGNA 4WF8A 4FXGH 4UE7H 1NPMA 2JH5D 1TNHA 2VVVA 4MNWA 2Z9JA 1GI9B 2VVUA 2BDCA 1O3PB 1QRWA 1A5IA 2GDEH 1SFQB 4GVUA 1ELCA 2ILNA 2D1JA 3MO6A 1AI8H 2FOEA 1ZMLA 3F9GA 1DUAA 2CHAB 4NIWA 2FXRA 3ZZ9A 2QXGA 1SOTA 1YC0A 1TBRH 1YPEH 2JETC 3A80A 2ZDMA 4I8LA 2FI3E 4B2BA 1RD3B 3UTUH 3RXEA 2Z9GA 1N8OC 2AGIX 2QXJA 2WUCA 5C20A 5K7RA 1SLVB 3SUGA 1IQFA 1GMDF 3RXBA 1O5CB 2Y82A 1MBQA 1QL7A 1DITH 2ULLA 1PPZA 3ATKA 1T4VH 4BAOB 3GY3A 3RC4A 1BRAA 1TA2A 2C93B 2XYAA 2ANKH 1HAGE 8GCHF 1ZHPA 4DY7B 1MTVA 3LH1A 1Z1IA 3N7OA 1BUIA 5ETXA 1GI7B 1GGDC 1O2UA 3M37A 1S0QA 2NU3E 5EODA 3V7TA 2J95A 2XBYA 1NFYA 1UVTH 3PWCA 5A09A 5HYOA 1DVAH 1VJ9U 1P05A 5FPTA 3ZZAA 2XBXA 1KDQB 3E1XB 4GCHG 4Y8ZA 1H1BA 4FU7A 3T62A 1O2MA 1C1UH 3ZZ4A 4FUEA 2BDHA 3RXJA 1WCZA 1QBVH 4INKA 4NA8A 3LOXA 4H6SB 1INCA 3EDXB 1O2YA 1QJ7B 2ZPRA 1BJUA 1C2JA 1UTOA 2BY9X 1HBTH 4NGAH 3GCTG 4Z0KA 2FPZA 2Q6GA 3KQBA 5TJXA 2UUKB 1QIXB 3O8DA 1P01A 3T2NA 3SNDA 1O2RA 4ZHLU 2GT7A 1KXCA 1OP8A 1Q2WA 4D9RA 1C9PA 4DW2U 2W5EA 2H9HA 2FZZA 3KIDU 1QA7A 1DFPA 4UFEH 1EKBB 4HGCA 2P16A 2J94A 2O8LA 1AKSA 1J9CH 2ZGJA 3MMGA 4JZ1A 4FUIA 4VGCB 3RMMH 3MH5A 1TX8A 1O3KA 2B5TB 1PPFE 2QV1A 1QFKH 4YZUA 2P94A 4XBBA 4U01A 2EA3A 4K69A 2FTLE 1SI5H 3W94A 2ANWA 1L4ZA 4O97A 3P6ZB 1D3TB 4WH6A 1HB0B 2BD2A 4Q7ZA 1P02A 1UJ1A 4NCYA 1ZLRA 5FX6A 1FMGA 1MUEB 4ZXXH 3VB4A 4CRCA 3E8LA 3OU0A 3M5NA 2FLBH 2R3YA 4GLYA 4TWWA 1YCPM 3T29A 2BLVA 1VGCC 4TPIZ 1O38A 1ZTLA 3CENA 4BOHA 3UQOA 1O2SA 3F9HA 1G36A 1E34B 1OWIA 4IC6A 2HNTE 3ZV8A 4MNYA 5I46H 4JYTA 2CXVA 3TK9A 3U1IB 4A1VA 4JMYA 2GP9B 3VB6A 5C67A 2Z6BD 1HLTH 1KXAA 5E8EH 2BX3A 2YOLA 1TPAE 3AAUA 2WV5A 3MFJA 1CBWB 1A0JA 1AB9B 1QTFA 2G81E 1C5YB 3U9AH 2H6MA 1ANBA 1XUKA 1O2XA 4FUFA 2FOBA 3GY6A 2O8UA 3L33A 1SG8B 2H9TH 4ZHMU 2PUQH 1HAVB 3UIRA 4ESTE 1K1LA 4Q2KA 2AEIH 4E7RG 1NN6A 3FANA 1QL9A 1ZHMA 1C5WB 3DD2H 1KLIH 1GHBF 2FYQA 1U6QA 4ZKOU 1CVWH 1EUFA 2A32A 1A2CH 1SLWB 1Y3VA 7GCHF 2JH0D 2FOMB 1HIAA 1WAYB 1GI2A 2PGBB 3A7ZA 3U8TH 1C2LA 5E0HA 1AU8A 1ETTH 1AQ7A 4WY3A 2XWBI 3BTKE 1SGPE 1C9TA 1Y3YA 3TVJB 3EGKH 1CA0B 4RKJB 1Z8JB 1O2LA 3BTFE 3VB5A 2XRCA 1WQVH 1O3GA 2R0KA 1ABIH 4CH8B 1PQ8A 1LQEA 2O8TA 2PKSC 1L0ZA 2PR3A 5TCAA 3PLKA 2V3OH 3RDZA 5JPMH 2FI4E 1XUHA 3V0XA 3SNEA 2QN5T 1QRXA 2GGVB 4Q7YA 2FOAA 1GGDB 2FOGA 2ZFSA 3HGPA 1AIXH 2BTCE 4MVNA 2H5DA 4XBCA 1AZZA 3NPSA 5DJ7A 1TNJA 3S9AA 4UD9H 1QHRB 3GY5A 1G3DA 1EOJA 3RXCA 3S9CA 2GCHF 1O2JA 1UTQA 2BD8A 1MTNB 1S6FA 3MNSA 2VINA 1CT2E 2WPIS 1UVOA 3BEUA 1AVWA 3MU5A 4ABBA 3ZZBA 5EGMA 1C5SA 1UK3A 3BTHE 5CHAC 4E06H 4YTAA 2NU0E 3LJOA 1K1OA 3ATLA 1GJ9B 3UQVA 2BQ7B 1ZOMA 1XKAC 3BSQA 3FAOA 2ZHWH 1C2DA 3M3SA 1TX6A 3PTBA 4TYDA 1PJPA 3E16B 1TMTH 1LHEH 1EAUA 1QBOA 2Z3CA 3SU5A 3SUEA 1EASA 1XM1A 3GYMA 3RXRA 3ZVDA 1C2MA 4YOIA 3FVFB 4X1RU 3KQEA 3RC6A 1VCWA 1IHSH 4B1TA 1NY22 4KGAA 2GCHG 2I6QA 4CRGA 2FP7B 3LGYA 5GWZA 1H9LB 1FV9A 2A5IA 1ELGA 1LPKB 1YGCH 1NZQH 3MU1A 2WPKS 2YNAA 1IQEA 1GHWH 3PMBB 1G9IE 1AUTC 2PLXA 2VGCB 3GY7A 3RXQA 3F9EA 1GL0E 2JETB 2UWPA 1THRH 4X8VH 5EXLA 1K1JA 2ALPA 1DANH 1K1MA 5L30H 3VPKA 3LDXH 2OCVB 4TY7A 1OYQA 4ABHA 2Y5HA 1O2NA 2SGPE 4QT8C 3M5OA 1P2QA 3RXSA 5A0BA 3QGJA 3E91A 4BNRA 1O3OA 1EOLA 1FDPA 3PMJA 1E0FD 3TK5A 2AIPA 2PKAB 3OYPA 3TLOA 1YM0A 1DXPA 1K1PA 1ELVA 5EW1H 1SGCA 1ZSKA 2GV6A 3TITA 2QCYA 1EP6A 1F7ZA 2AS9A 2HPQH 2RA3A 4IS5A 1NRRH 1G3CA 2VIOA 3P17H 4AFQA 7GCHG 2Z9IA 5E0GA 2CF8H 1O39A 2C8YB 1EJNA 1WV7H 2QGRA 3Q3XA 3KCGH 2ZTZA 3LC3A 1LVOA 5JBCS 4ZHAA 1MBMA 4INLA 1RRKA 4INHA 7KMEH 4A5TS 5GIBA 2ZCKP 2FTMA 3EA9A 5FCRA 1W12U 1YBWA 1LVMA 4O3TA 2TIOA 3W95A 2ZU5A 3M3VA 1EB2A 3TIUA 1FY1A 1VITF 3ZZ5A 2ZFQH 4Y11E 4MPVA 3TGKE 1V2RT 2ZPSA 4GHTA 2D26C 4BANB 2BLQA 3PLPA 1O3BA 2OC7A 4ISLA 2BY5X 1SB1H 3RXKA 3TH2H 3K9XB 1HJ9A 3ODDA 4K1EA 4R8TB 1P04A 4OS1A 2PWXA 3OTJE 3ZVBA 1KXFA 3SBKA 1OXGA 2Y7ZA 1GHZA 1GCTB 2A4GA 1BCUH 4Y8YA 5GXPA 3Q76A 4JYVH 4LOYH 3RU4D 2BXTH 3ZZ7A 1ID5H 4THNH 1C4U2 1LHFH 2J92A 4LZ1H 1QNJA 3A81A 3UUZA 4A7IB 2Y6TA 3PM3A 5A8ZA 1ZJKA 4ABDA 2AMQA 2ZU4A 4NWLA 1O3LA 1Z8RA 1J14A 1HAPH 3QWCH 3VGCB 1BTZA 2FEQH 1HAHH 1AE8H 1ELBA 1TABE 1GMHF 1CE5A 4XBDA 3HATH 4WXIA 1A61H 1DSTA 4RKOB 1O2OA 1TIOA 2J38A 5JB9S 2PW8H 4MNVA 2DE9A 5GPIB 3UWJH 1TGBA 1C1MA 3A85A 3A84A 5AHGH 3GYLB 3GCHB 4Y6DA 3UNSA 3KNXA 2PSYA 1PQ7A 2ZDVH 4WMEA 4KTSA 1QB6A 5JBBS 4D76A 1GHAF 1ZMJA 4ZKRU 3HKJB 1SQOA 1HUTH 3SGQE 4FVBA 1GVZA 1AVGH 1SGFG 2BDIA 1K22H 1RXPA 3EE0B 1ZMNA 1UCYH 2BD4A 1IQNA 1QY6A 2AERH 1TRMA 5L2YH 1ANEA 3EA8A 3MNCA 1RJXB 2FM2A 1AKSB 4X8TH 4ABFA 1W2KH 2BLWA 1RGQA 3Q77A 2FO9A 1DE7H 4IMQA 3FP6E 1PQAA 1RS0A 5LPEA 1TLDA 1V2LT 2OC8A 3STIA 5A0AE 3RUOA 2WPJS 1ANDA 3AVZA 1RIWC 2OINA 3PO1B 1MTWA 2VVCA 2ZHQH 3MU0A 3VEQB 1LQDB 1V2OT 1BTHH 4GPGA 5DGJA 1NRQH 1A4WH 2ZHEH 1BA8B 1T8LA 1XKBC 3O8RA 1JIMA 1W3CA 1S82A 3LGTA 2UUYA 5DO4H 1FONA 2ANYA 2KAIB 5LPRA 4I8HA 3T26A 1SQTA 2ZPQA 4HZHA 1D3DB 2HOBA 4JZIA 2ZU1A 3LGWA 3M3TA 1DICA 3K6YA 2A31A 1EZXC 2A45B 1VGCB 1B0EA 4H42U 3QDZB 5AFYH 2GVFA 5EQRA 1DXWA 4ISNA 1BOQA 5DP3A 4Y71A 2BY7X 2DE8A 1GHVH 1W14U 4X8SH 3E3TA 4ZKSU 1GBIA 2AGGX 1GVKB 1AFEH 1TFXA 2QYIA 2HWLB 1JXPA 2EI6A 3ODFA 1QR3E 1SMFE 1W10U 5HMAA 1P06A 1DWBH 3BTTE 2FS8A 2STBE 1A46H 1LKBA 5GDSH 2UUFB 5SGAE 1C5QA 1T7CA 1CSOE 1EZQA 4X6OA 5C3NA 1ELAA 2QAAA 3SJ9A 1O3AA 4AB8A 2UUJB 1O36A 5T6DA 3E6PH 1NESE 1BMMH 5GJ4B 1S81A 2ZFTA 1IHTH 1KIGH 1GDNA 1JIRA 3VB3A 2FESH 4KP0A 4LK4A 1OP0A 3BG4B 2VIDA 4BTUB 1P2KA 1ZZZA 1O3EA 5K0HA 3HK6B 2BM2A 4ZUHA 1PPGE 4AGKA 1GI4A 4FUBA 1GI3A 2BQWB 4BXWA 3OY5U 1O5FH 5F8ZA 5BRRE 1K1NA 3F9FA 1DPOA 2SFAA 2Z3DA 1OSSA 2A7JA 5JYIA 3P8NA 6LPRA 1SGEE 1C5OH 3E90B 1MKWH 1SOZA 4U32A 3ZVEA 1C5TA 1DWCH 2VGCC 1KY9A 2GT8A 2B8OH 3TNSA 1HAOH 1ESBA 2G5NA 1V6DA 3MYWA 2XCNA 1DY9A 3SORA 1HRTH 5FCKA 1ZRKA 1O2GH 1DDJA 1E38B 4CREA 1GHYH 2SGEE 2WV4A 1OP2A 4D8NA 1ZTKA 1C1QA 1ZGIA 1AFQC 1SBWA 3RXHA 4CRBA 1H9IE 6GCHG 1NS3A 1GI1A 1XMNB 2THFB 1QBNA 4B75A 2ZU3A 2BOKA 1XUGA 3UNQA 1SGFA 1MKXH 1L1GA 4CH2B 4DOQA 3V3MA 1RTFB 1TGNA 1DX5M 4ABAA 3B9FH 1VCQA 1ESAA 3KF2A 1E36B 2WUBA 1LO6A 4X2YA 4FUGA 4X6MA 4YESB 1SGRE 5IYTA 5EPNA 1RTKA 1Y8TA 3RLYH 3SU2A 1KTTB 1C1WH 4K1SA 2F9OA 2QA9E