2FI5E

Crystal structure of a bpti variant (cys38->ser) in complex with trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Functional and structural roles of the Cys14-Cys38 disulfide of bovine pancreatic trypsin inhibitor.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fi5E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fi5E02
1O2UA 2ODYB 4GUXA 1O2GH 3I77A 4IC5A 1MKXH 2YNBA 2GZ8A 2Z3CA 5GCHF 2FMJA 2GGVB 3SUEA 4XDEA 3UR6A 2P8OC 1C4U2 1P12E 1ZHRA 1Z6JH 2Z94A 2B9LA 1AVXA 1TGBA 1SGRE 2VIQA 3H5CB 5T6GA 3S9AA 1GGDB 1NZQH 1XVMA 3SQEE 3BTEE 3MH6A 4ZAEA 1RJXB 2BX4A 1SR5C 1KXCA 5HYOA 1F5RA 2AGIX 1K9OE 2FPZA 1MTWA 2THFB 2UWLA 4DJZB 3B9FH 1G36A 1A3EH 2C3SA 2GV6A 2PGBB 2ZFSA 1HNEE 3H7TA 1YPEH 3MU8A 1AQ7A 5EOKA 5ETXA 1IQGA 2PSYA 1RTFB 2BHGA 4DURA 1BMMH 1A5HA 3MTYA 4M7GA 2QGRA 1ESTA 4O97A 4ABFA 1LVBA 5C20A 1NFUA 4A1VA 2FS9A 2LPRA 2W3KA 4YESB 1RRKA 1MKWK 3P8FA 3RM2H 1Z8GA 1T8NA 1E34B 2VVCA 4A1XA 1ZRKA 1ANEA 1ANBA 3T29A 3TVJB 2FLRH 2ZU4A 5E2PA 4IN2A 1EOJA 1P05A 2BD2A 5C3NA 3HKIB 1VITH 4Q7ZA 3VEQB 2ASUB 4XOJA 4LZ4B 2A7JA 5AF9H 1YKTA 5AFYH 1VGCC 3A7XA 1NRRH 3PM3A 3UFAA 2ZDVH 1O30A 1O3GA 3RU4D 3GDVA 1UCYK 2A2QH 1SGFA 1O36A 1FUJA 2ZHDA 1EP6A 2EA3A 2HNTF 3TH2H 4DOQA 1QIXB 3BG4C 4OS2A 1E38B 1ZHPA 1AU8A 2B0FA 4ESTE 2VIOA 1HCGA 2JH6D 6LPRA 1C9TA 1TYNA 1DUAA 2UWPA 3GY3A 2ZGXH 1HJAC 3P92A 2V3HH 1CA0B 1OPHB 5GDSH 2A7HA 3F9HA 3ZVDA 5BRRE 2FIRH 1GJBB 1ELVA 3EE0B 1C1TA 1WU1A 1DVAH 1SMFE 3DA9B 1FY3A 5ESTE 3Q76A 5C1UA 1TNJA 3A7TA 1TNLA 3MO9A 4X2YA 1KTTB 5F8TA 1SLUB 3ZVBA 1SGTA 3SGAE 4CR9A 1P2MA 1ANDA 4J1YA 1HAVB 7GCHG 1XUFA 3TJUA 4ABJA 2SGFE 1GHAG 2O8UA 2VWOA 1UJ1A 1WUNH 2D26C 3TGIE 4Q2KA 2D1JA 1L4DA 1W11U 2OQUA 3ZZ4A 3ENSB 4HGCA 1LKBA 4X6NA 2OQ5A 3BF6H 2OC8A 5A0AE 3A84A 1NTPA 2ZF0H 1S6HA 8GCHF 1ZOMA 4NIXA 1P02A 1S0RA 4MNYA 1NC6A 2G52A 1P57B 2BDIA 1QBNA 2IJOB 1P01A 3TGKE 1QFKH 1GHBF 1K22H 1S85A 2PLXA 1KLJH 1GDUA 2DE9A 2TPIZ 1HAYB 3L3TA 1EAIA 3F6UH 1LHEH 3T28A 1F92A 1N6YA 1MTVA 1VCPA 1GMHF 4YT7H 4X2XA 2XC5A 1SGQE 3ZVCA 1BCUH 1BQYA 1MUEB 2ANKH 3CP7A 4MNVA 1NU7B 1FAXA 1DE7H 2VGCC 2GX4A 1O2WA 2FI4E 1O2JA 4CBOA 1V2LT 1O2MA 4BTTB 2WPLS 2XRCA 4B1TA 3L33A 1OX1A 1UTNA 1J15A 3ITIA 1DLEA 2J4IA 1MZDA 3KL6A 5C67A 4IBLH 3RXHA 3A80A 3M7TA 2ZKSA 1DWEH 2QXHA 3KQDA 3RXQA 5A2MH 4CH8B 3VXEH 2F83A 3URDA 3W94A 4KTSA 1DSUA 2VH0A 3BTWE 1UHBB 3UNSA 2WUCA 1O2YA 2SGPE 1C1RA 1C5MD 2ZGBH 3TLOA 1NRNH 4DY7B 1NROH 3HPTB 4ZUHA 1Z1JA 3AASA 2ZDMA 1WTGH 1RFNA 4BAOB 3TK5A 1T8OA 1PPBH 1BHXF 1TMUH 4AOQA 4A6LA 4CRGA 1O5BB 2PGQB 4AORA 3TJVA 1O33A 5JPMH 4AZ2B 4NGAH 4KKDA 4TPIZ 2VWLA 3GCHC 1BTPA 1NM6A 1O5FH 1V2WT 1AKSB 2GT7A 1A5IA 1V2VT 1IQMA 1TGSZ 2UUFB 2ZCHP 4H4FA 4J2YB 2ZPSA 1N1LA 1NN6A 1S84A 2FX6A 1LCYA 2QV1A 5E2OA 2FOCA 2ZA5A 2PTCE 3BTFE 1LVYA 1NPMA 2ZDNA 3D62A 1C5VA 2FWWA 2QXIA 4FUCA 1YPHC 4BOHA 2PSXA 2A4GA 4AFUA 3PLKA 1GBCA 2UUYA 1RTLA 2QA9E 1KYNA 2Y7XA 3BIUH 3V12A 1M9UA 3MHWU 1GI6A 4E7RG 1LHFH 2NU2E 4BAKB 1ORFA 5K0HA 3S7HB 1MTUA 2GTBA 5DK1A 2XBYA 1DUEA 1HXFH 1TQ7B 4MQAA 1GJ8B 1ELTA 2EI6A 5F03A 3E6PH 1NT1A 3ZZCA 1ARCA 3MMGA 1P3CA 7LPRA 1BDAA 1QR3E 1DANH 2TBSA 4CRAA 2Z9LA 1NESE 4ZKRU 1GMCF 1GI7B 1C5NH 1EZQA 3GY5A 3E1XB 1BRBE 3L6PA 1YF4A 1IAUA 4H6SB 5EXLA 4D8NA 5CE1A 2STBE 3PMHB 1DXWA 1FMGA 5FXLA 2P16A 1FXYA 5E0HA 3SNCA 2BTCE 1W13U 2VWNA 1CT4E 2BQ6B 2A4OA 3UY9A 1L2EA 8LPRA 3SU3A 1LPGB 4FU8A 3IITA 2XTTB 3EAJA 3CENA 1E36B 1O3IA 3QWCH 1LHGH 1O2RA 3VB5A 2JKHA 1MU6B 4JK5A 4CHAB 1IQLA 1J17T 1O2IA 1UTJA 1ELDE 2XWBI 1VITF 2VB0A 4XBDA 3S7KB 2OBOA 1W7GH 4TPYA 1OWHA 1HAZB 3SV6A 2GDDA 3O8DA 3MNBA 1V3XA 1UTMA 1H9LB 2QCYA 1FDPA 1WOFA 1Y3UA 1O39A 1YCPK 3SJOA 1O5GH 1ZJDA 1K2I1 2TRMA 1MTSA 1RD3B 3BTTE 1BJVA 2VIPA 2GVFA 4YOJA 1TX6A 4KGAA 4ISLA 4Z0KA 1CBWC 2XBWA 2GD4B 1A2CH 3FAOA 1B7XB 1BRCE 1CHGA 1S6FA 2Q6FA 4UEHH 4ZHLU 4UONA 1ZPZA 3HK6B 1ZZZA 3SBKA 3SV9A 1PPGE 1GL0E 4IC6A 1GI2A 2ZTYA 4CBNA 1BRUP 1GI9B 9LPRA 1HYLA 1FPHH 2ZZUH 3A8AA 1A4WH 1EAXA 1K21H 3RXGA 2PR3A 1W2KH 6GCHG 1MQ6A 2A5IA 4YT6H 3MU4A 3U69H 1XUJA 3SN8A 1EUFA 1A61H 3I78A 1AWHB 1SGYE 2BLWA 2TGTA 1GBAA 4PROA 1ETSH 3PB1E 1C4Y2 2C4FH 1NRSH 1C2KA 2BOHB 2GP9B 1F0SA 5C2ZA 1VCWA 3F9EA 1A46H 2HNTC 5CMXH 3V0XA 4Q7YA 1QCPA 4U30A 3SNBA 1CE5A 1HGTH 1KLTA 3BEIB 4UE7H 1H1BA 5C1XA 4AFZA 3R3GB 1NY22 2W7SA 5DPAA 1TNGA 3P8NA 1ID5H 5CHAB 1DS2E 5A8XA 1HAVA 1WTHD 3OSYA 4NA9H 3UNRA 3VGCC 1O3BA 3Q3YA 3UIRA 2AERH 2DUCA 3P8OA 2GMTC 3S69A 2JH5D 1HV7A 1QQUA 1IHTH 3FANA 3FFGA 5DKMA 5EXNA 4OGYA 3RXAA 3MU1A 3LOXA 2Y80A 3TNSA 1JRSA 4LXBH 5HMAA 3LT3A 1AVWA 2GZ7A 5AVDA 3RU4T 1TPOA 2AS9A 3V13A 1PYTD 1SLVB 1D3QB 4FUIA 2G8TA 3F9FA 2Z9IA 3M5MA 2A45B 2BVRH 1FAKH 2WYGA 5L2YH 2ZQ2A 2LNCA 2PKSC 3T5FH 1HJ8A 1Y5BT 2TGPZ 3FZZA 3PYHA 2GZ9A 4B74A 4GAWA 1BBRH 1C1VH 2NU3E 1T4VH 1AO5A 3ZZBA 2Z9GA 4JK6A 4FUBA 2J2UA 1ZHMA 1NRQH 1QQ4A 4FUEA 1X7AC 1TNIA 4K60A 1DWCH 4OS6A 3K65B 2BX3A 5LGOA 1GI8B 2VU8E 8KME2 3ZZ3A 4MNWA 3E0PB 1ZYOA 2A0QB 4OGXA 1HBTH 4AN7A 1J9CH 1LQDB 3BIVH 2C90B 2R2MB 3QUMP 4FUDA 4X6MA 4ZXYH 3NUMA 2F3CE 1GJDB 2CHAB 1DT2A 3FP6E 2H2ZA 1LHCH 1YPMH 3LH1A 7ESTE 5FHTA 3M5NA 1XX9A 1GG6C 1O3EA 1SI5H 1C1QA 3TGJE 3A8CA 5GIBA 3M3VA 4U01A 3M3TA 3F9GA 1UHBA 5EXMA 1V2NT 3RLYH 4OS4A 2HRVA 4JZ1A 2BDYA 1XKAC 2AYWA 3KEEA 3KN2A 3S9CA 1A0LA 5SGAE 5FAHA 3RXPA 2A1DB 2FO9A 1THSH 4TWWA 5GCHG 1C9PA 5LH8A 1XM1A 3RMLH 2BOKA 1C5PA 1EP5A 1GHYH 4IGDA 1KIGH 1F0UA 2BYAX 2JETC 2ZIQH 5HM2A 1C1WH 2TIOA 2P8OB 3OY6U 3SV2H 2A5KA 3LGYA 1O3PB 1P10A 2OCVB 2F9UA 3SI4H 5J4SA 3SQHE 1VCQA 3PLBA 1A3BH 4WXVA 3F1SB 2YNAA 1O3OA 1AKSA 1O5EH 5FBIA 2STAE 1TFXA 1FN6A 1CQQA 2WPJS 3SOSA 2H9EH 4BAQB 1GI3A 4IMQA 4NZQA 1GBEA 2FX4A 1SGFG 2ZU5A 3ELAH 5ESBA 1DOJA 1T31A 2ZHFH 3Q3XA 3PWCA 4ASHA 4X1SU 5FX6A 2Z6BD 2GDEH 4JZEH 3A8DA 3NKKA 1QURH 2R0LA 1EASA 4HZHA 3O8RA 2O8WA 3P95A 1FY5A 1QBOA 1MTNC 2BY7X 2BD5A 1BMAA 1TRYA 5JBCS 4NWKA 2M5TA 1OWKA 4DVAU 3KCGH 3WY8A 1GJ7B 2CJIA 4IW4E 1SL3A 4DIHH 1C2FA 2ZDLA 4B2BA 3DFJA 5L2ZH 3KGPA 4LZ1H 2OC1A 2FYQA 3QTOH 1EJMA 2QF3A 3SV8A 1MMJN 3RXFA 1PPFE 1XUKA 2C8WB 2BD8A 1LO6A 3FP8E 2C8XB 2QAAA 1WCZA 1VGCB 4FVDA 1TABE 3M7QA 1PQAA 2BDAA 1HLTH 2BY6X 2ZO3H 1QHRB 1YP9A 1CU1A 2WPIS 4INLA 4WWYA 3ZYEA 1TONA 2BLQA 4ZMAH 3MH7A 5DP5A 3UWJH 1BJUA 1O3FA 4FU9A 4MPWA 3RXMA 3BG4B 1UCYH 2BDBA 1Z8IB 1NFXA 3MU5A 2H6MA 4MNXA 4MPXA 3FP7E 2IN2A 3RC4A 6CHAC 2P3TB 5JYIA 1FY8E 2PV9B 1V2RT 1HJAB 1P03A 2FI3E 4ABIA 1Z1IA 1TRNA 4NA8A 1DX5M 2R3YA 1MCTA 3LGIA 3VFEA 3EYDA 5JBTA 3DHKH 4HI3A 4JYVH 1F2SE 1IQKA 1ZGVA 3AAUA 3ZVFA 4I8JA 3TJNA 3RXCA 2XBVA 1UVSH 4X1PU 3LH3A 4E06H 3RLWH 1UTPA 3OX7U 4OS1A 4OS5A 4K8BA 2O8LA 2Z9KA 2PUXB 2ZFPH 1O37A 3HGNA 1O3LA 4UFEH 2VH6A 3LGVA 3UNQA 2HGTH 4NIVA 1G37A 1QY6A 1UCYE 5LPEA 1GBHA 1PJPA 4WMDA 3RU4E 1AD8H 2F9PA 1N8OC 1S81A 8GCHG 1O2TA 3P8GA 4THNH 4X2VA 2ZECA 1GHXH 2J95A 3QX5H 5L30H 1BMNH 1P2KA 1GHBG 3MFJA 1BTHH 3HKJB 1SC8U 3MYWA 4HTCH 3ZZAA 1G2LA 1S0QA 1YPKH 4A5TS 1G32B 3RMOH 5A0CA 1EAWA 3E91A 1EPTC 3TK6A 1L4ZA 5GWZA 1MAYA 1K1MA 1XVOA 2FOGA 3SU0A 1GBJA 3EA9A 3SUFA 1GMHG 1TWXB 3MNSA 1QJ7B 1JOUB 2G81E 3UR9A 2CGAA 2ZHEH 1GI4A 4WH8A 4B75A 1G30B 2P93A 3VXFH 3V7TA 3PTNA 1F5LA 3TK9A 1LPKB 2PTNA 2Q6DA 2WPHS 2WYJA 2P3UB 1WQVH 2VGCB 4INKA 1LQEA 2W5EA 3TIUA 3RC5A 1OP2A 1CT2E 3MU0A 1K1NA 1GJ6A 3NXPA 1HXEH 1BTWA 2DE8A 2ZHQH 1KTSB 3SGQE 3U8TH 1ABJH 2J92A 4FXGH 1K1IA 3A87A 3RXUA 3RXBA 1ETRH 3U9AH 5GXPA 2BQWB 3DT0H 1C5XB 1C1UH 1GJCB 1Q2WA 1ZTKA 3M35A 4ZHAA 5AHGH 4AB9A 3HGPA 1ZMJA 4I32A 2CXVA 4I7YH 4ISHH 1KXEA 1W0YH 2ILNA 2FOEA 1H9HE 3TU7H 3MNCA 2FOHA 2F9BH 3V3MA 1ZLRA 2B8OH 1SHHB 4FVBA 3EA7A 1O2NA 4ISIH 4Y8YA 1MCVA 1L1NA 3GCHB 4ABDA 1ESAA 4FUFA 1AI8H 2ZFFH 4BAMB 1PPEE 1SBWA 1IQEA 1Z6EA 3Q00A 4CRBA 2XC0A 1HAIH 1DY8A 1KDQB 4TY7A 1SQOA 3AW0A 2FTMA 1FY1A 1A1RA 1DFPA 2SGEE 2G51A 4A7IB 2ZDKA 1YPGH 3M61U 1DWBH 1V2KT 1B0FA 4MLFB 3OU0A 2QN5T 1C5RA 3A82A 4B2CA 5DP7A 3UTUH 3T62A 5EPYA 1GBMA 2V3OH 4KELA 1AGJA 1PQ7A 2Z3EA 1ETTH 1J8AA 2R2WU 1Q3XA 3T2NA 2WV5A 1GJ9B 4E7NA 3PO1C 2HOBA 3BTQE 4FU7A 1LMWB 4SGBE 1YPHE 1P2IA 1O5AB 4YLQH 5JDUB 4K8YA 5FCKA 1QA0A 1YGCH 3E8LA 2SNVA 2BM2A 4YOIA 3QTVH 1ZTLA 1EOLA 1GMCG 2Y81A 3QO6A 1G3DA 3SJ9A 2FODA 1C5UA 2ZFRH 3ZV9A 4DG4A 5A09A 1EAUA 1O2XA 1YLCA 5EQQA 1C2JA 2W3IA 4B71A 1B5GH 1HAGE 3JZ2B 3RUOA 1Y3XA 2C8YB 1ZSLA 1C5TA 4IMZA 1P2QA 1WBGB 1G3CA 2VVUA 2XXLA 3T26A 2ULLA 1WQSA 5EGMA 1YCPM 1GBBA 1KXFA 3RXOA 1SSXA 4O3UA 4B73A 1O2LA 3QZRA 4RKJB 1CO7E 3QLPH 1Y5AT 1TMTH 3EDXB 1T7CA 2ZQ1A 1V2ST 2XWAA 5C5NA 1RIWC 1F0RA 1HJ9A 1RXPA 2AIQA 3O8CA 2Z9JA 2G55A 3MH4A 1GI5A 3U8RH 1O35A 3QDZB 3PMJA 3Q3KA 4WF8A 1ZPCA 1ZMNA 1TBQH 5FPSA 3MO3A 3K6ZA 4JZDH 1YPLH 5A8ZA 1HB0B 4GCHG 4WMFA 1QB1A 2ZGHA 2J94A 3GICB 3ATKA 4MPUA 2D2DA 3CS0A 1FJSA 2A2XH 1O3NA 4AX9H 2C8ZB 1CBWB 5A8YA 1GBKA 1YCPH 4VGCB 2H5CA 2FP7B 4GLYA 3UUZA 4H42U 2ZC9H 3M7UA 1SOTA 1OP8A 2NU1E 1SGDE 5JB9S 3T27A 4BANB 1EJNA 2RA3A 1FV9A 1TGCA 1VZQH 1Y8TA 3M5LA 1CHOF 1GMDF 5BPEA 1LTOA 4A1TA 1K1LA 3PTBA 3S9BA 2BD4A 1MD8A 3CS7A 1PQ5A 3LJOA 1EJAA 1T32A 5F8XA 1C1SA 1T8MA 1C5LH 5DJ7A 1GBDA 2J38A 3UPEA 2SGDE 1OYQA 3K2UA 2QY0B 2P3FH 3I29A 2FI5E 1L1GA 2CV3A 1H9IE 1D3TB 3SW2B 1V2QT 3LIWA 2RA0A 4BNRA 4IS5A 1TGNA 2AIPA 1FZZA 1MZAA 3A7ZA 1O2KA 3TITA 4IN1A 1O3HA 1UK4A 2GCHF 1YPJH 4XBCA 1FLEE 2PHBA 4ZHMU 1BOQA 2Z7FE 2ZEBA 3HK3B 4Y11E 3BN9A 3LGTA 1ZJKA 3PMAB 4CRCA 2FEQH 1H4WA 5ABWA 4UFGH 3SZNA 5FPTA 5DGJA 1EZXC 3UWIA 1BMLA 1D6WA 1O34A 1ZSJA 3LONA 1BTUA 2FXRA 1C2MA 2ZCLP 2FZZA 2ODQA 3VGCB 1O3AA 1GI0A 1D6RA 2GMTB 3A88A 2HNTE 3PROA 2G5VA 2QXGA 1H8DH 3SU4A 3O8BA 3MWIU 1NO9H 1EB2A 2FOAA 3KNXA 4YLUA 4I31A 2BD7A 2VIWA 5DP4A 1O38A 1AWFH 3LPRA 1PPCE 1HAXB 4ABGA 1ARBA 3NK8A 1WSSH 3SO3A 3BEFB 1T4UH 5DP6A 3VB4A 1IQHA 4DT7B 9ESTA 5J4QA 1O3DA 2PKSB 8ESTE 2BZ6H 4B76A 3UREA 3RXVA 4B2AA 1GHVH 2BDCA 2SNWA 1KSNA 1W8BH 1JMOH 1LKAA 1CGHA 1QB6A 1SFQB 4Y0ZE 1QNJA 1VJAU 1FPCH 4D9RA 1BA8B 1AB9C 4NFFA 1QRZA 1O5DH 1BTXA 2IPHA 1TPPA 2BDHA 1MQ5A 2P94A 2FOBA 4BTUB 5JBBS 1GDQA 3STIA 2ALPA 2FLBH 1LDTT 3QZQA 1O2HA 3D23A 1K1PA 1P2OA 4ABBA 2BY8X 1O2SA 3RMNH 1EZSC 1PYTC 3JZ1B 3SHAH 1GG6B 4FUGA 2ODPA 3GY7A 1V6DA 2H1UA 3GCTF 1BBRK 1B0EA 4Y10E 3OTJE 5EW2H 1BRAA 1DXPA 1C1NA 1SOZA 3LJJA 1HPGA 1AZ8A 3GYLB 4XBBA 3Q77A 1C5QA 2FESH 2Y82A 1Z8JB 4ZKSU 3SHCH 3U1IB 3ZYDA 2XCNA 1O3KA 5HGGA 1O2ZA 2Y5HA 4QT8C 2ZP0H 1AE5A 1AFQC 3TPIZ 2JETB 3K6YA 3SORA 2OC7A 1ZR0A 3QGNB 4I8KA 1GDNA 1TLDA 3A86A 1HAHH 4AB8A 1AE8H 5LPFA 1V2TT 4AG1A 3E0NB 1AHTH 1IQNA 4AFSA 3A7YA 2C93B 1JWTA 3M37A 2FYRA 1F5KU 2V6NA 1UVTH 2AMDA 2NU4E 1GCTC 1KDQA 1FI8A 1BB0B 4INHA 4DCDA 1BHXB 3MO6A 2ZTXA 1UK2A 2GCTC 2ALVA 2HWLB 2BMGB 1C5OH 4ABAA 2ZDAH 1QJ1B 1EB1H 2FDAA 2O8MA 4XE4A 1UTQA 1ZPBA 5EW1H 2F9OA 1A0JA 1H8IH 1AN1E 2A5AA 2WV4A 2ZHWH 1MTNB 4Y76A 5TJXA 1IHSH 2BDGA 2O8TA 1C5WB 1MKXK 1DY9A 1T8LA 1SGPE 5FPYA 5DG6A 2ANYA 2BZAA 3SGBE 1DSTA 4K1SA 1DDJA 3SNEA 3ZZ9A 4NZLA 2P59A 4FUJA 3SUGA 1TX7A 4Y6DA 1HDTH 4A92A 2HALA 3GDUA 3RXSA 3A7VA 2CF9H 4WH6A 3KF2A 1Z8RA 4UDWH 1PPZA 1Y5UT 4X1QU 3FVFB 3P70B 4D7FA 1A7SA 1GGDC 5E8EH 1W10U 2XBXA 3D49H 1O5CB 1GJ4H 3U98H 1AY6H 2FS8A 1O3CA 1MKWH 1OWDA 2R9PA 4NWLA 1DWDH 1CA8B 1TOCB 1ELFA 3FZDA 2K1QA 5T6DA 2PUQH 1W7XH 4Y79A 1ELBA 3SV7A 3ZZDA 3RXRA 3ATLA 3C1KA 1O3MA 2Y5GA 1C1MA 2YOLA 1O32A 2P95A 2R3UA 1RS0A 3GY6A 1QL7A 5IDKA 4H6TA 2EC9H 2TGDA 3UOUA 2F9NA 2WPKS 2ANWA 5E0GA 6CHAB 1BZXE 1UO6A 1C2IA 2ZU3A 1CSOE 2W7UA 3ZZ8A 2IOTA 1GJAB 4TWYA 4JZIA 1TNHA 5PTPA 1OWIA 4NG9H 1E0FD 2BB4A 1A5GH 1U6QA 2UWOA 3VPKA 1OWEA 1FONA 4K1TA 1OXGA 3NWUA 1XMNB 2XC4A 1AIXH 1NFWA 4KTCA 3SJ8A 1HAOH 3RDZA 5JBAS 4NCYA 2RG3A 3B8JA 2CN0H 2ZGJA 1K1JA 1LPZB 1QA7A 2VVVA 4Y0YE 2HVXA 3R0FA 3PMBB 4AYYB 1O3JA 1V2UT 1EZUC 3DUXH 2ZU1A 2W26A 5LPRA 1N8OB 4WVPE 2WUBA 3RP2A 2WINI 1ESBA 2QF0A 1Y3YA 4BTIB 3D65E 3SU6A 1S83A 4X6PA 2H9HA 2ZFQH 4AFQA 1NFYA 2QYIA 2VWMA 3AVZA 3LC5A 4XFQA 1E37B 3QGJA 4I8GA 1K28D 1JRTA 1MU8B 1ELAA 3VB6A 3QK1A 3TNTA 1GVZA 2BLOA 3AAVA 1EATA 5EG4A 2KAIB 1EPTB 1GCDA 3K9XB 1P0SH 1CA0C 4BXSA 4F49A 3MNXA 3GISB 1CGJE 4X6OA 1TMBH 1EXFA 3EQ0H 2OP9A 4JYUH 3PWBA 1TIOA 4GVUA 2ZG0H 4ZXXH 1OYTH 2Q1JA 1S82A 1IOEA 1WYKA 4U32A 5B6OA 1XXDA 3U8OH 2A7CA 1HIAB 1UTKA 4O3TA 1ELCA 4TYDA 1DLKB 2EI7A 4ZKOU 2ZCKP 1FQ3A 2OD3B 1O2OA 7GCHF 3UQVA 2VNTA 2PKAB 3NCLA 4NIYA 3LKWA 2GKVE 1GHAF 3URCA 1YC0A 1C2DA 3GOVB 3GY4A 5I25A 1V2OT 2BD3A 3RMMH 4K69A 3KQCA 4K5ZA 4RKOB 1D4PB 1TX8A 2H9TH 1XUIA 3UQOA 3U1JB 1CVWH 3SNAA 4O9VA 3P17H 3GYMA 1ACBE 1N6XA 3RXDA 1EX3A 1OS8A 4MTBA 1INCA 1GBLA 3S0NA 3RXLA 4WJG2 3NZIA 1SVPA 3BTKE 1ZRBA 1C2LA 3EA8A 1P11E 4YM9A 1Y3VA 2B5TB 5EQRA 5FCRA 1QRWA 4D76A 2BXTH 4WXIA 4CR5A 2BQ7B 3TJOA 4DW2U 1V2MT 1FN8A 1GBIA 3GCOA 2G4TA 2ESTE 3BTDE 5TCAA 1NS3A 1TA2A 2OINA 1W0ZU 3MI4A 1SG8B 1FIWA 1D3DB 1TRMA 2EI8A 4YTAA 5K7RA 1XKBC 2B7DH 2WPMS 2I6QA 1QJ6B 4X8VH 1K1OA 5EQSA 2BXUH 4XSKU 1G2MA 5DO4H 5EU8A 2CMYA 1BUIA 3RC6A 3E3TA 2XYAA 1MD7A 3GCNA 1BITA 2BVSH 2CF8H 2ZWLH 3M36A 3P6ZB 1GHZA 4ABEA 1MH0A 3QN7A 1GJ5H 1E35B 4D9QA 4MDSA 1THPB 3SJIA 1HAPH 1SLWB 4X8UH 3PO1B 1MBMA 4YZUA 3SUDA 2BD9A 2FTLE 2HPPH 2BY5X 3SI3H 1DM4B 1NRPH 2AFQB 3KQBA 5G4BA 1JIMA 1TBZH 3KIDU 4X2WA 2D8WA 2F91A 2Y7ZA 1XUGA 4X8SH 1QTFA 2SGQE 4UD9H 4CREA 4NIWA 4AYVB 4UFFH 1GVKB 2PW8H 1PFXC 3F68H 4SGAE 2ZTZA 5L6NH 2AMPA 3GY8A 1O31A 1EQ9A 3IG6B 3A89A 3BV9B 2BY9X 3BSQA 1SFIA 1L0ZA 3TH4H 2EEKA 2QC2A 3T25A 3W95A 1VR1H 1W12U 1C5ZB 2HLCA 2OUAA 3ZZ5A 1GBTA 1SGCA 1UTLM 4K3JA 1TB6H 1WV7H 2PWXA 3M3SA 5F6MA 1YLDA 1OSSA 1TA6A 1A0HB 4BXWA 1QB9A 3BTGE 1SGEE 1UK3A 3ZV8A 3PV4A 1W14U 1UTOA 1G9IE 1RIWB 2FOFA 4E05H 4Y7AA 2G00A 3SU1A 3M5OA 2F9VA 3A83A 3G01A 1IQIA 4KTUA 5C1YA 1C1PA 3VB7A 1GI1A 1Y59T 2A4QA 2ANMH 1AVGH 1VITG 4ZH8A 1DITH 2G5NA 2UUKB 3E90B 5E0JA 3RXEA 3DD2H 2AGGX 2V0BA 4HFPB 3A85A 5DP9A 1C2HA 2OC0A 1OWJA 1LVMA 1HFDA 1Z7KA 2AH4X 3RXKA 1THRH 4AG2A 4Y7BA 4OS7A 5GPIB 4NSYA 2Z3DA 4GPGA 4R8TB 1D3PB 1BTYA 1VJ9U 1PQ8A 2ZI2H 3LDXH 4CH2B 6ESTA 3ATWA 1UVUH 1CHOG 1GMDG 1TPSA 1OP0A 4K1EA 7KMEH 3SU5A 5HM9A 3E16B 2ZNKH 2PFEA 4MG3A 1AZZA 1FIZA 1C5SA 3B23B 1DPOA 1NU9A 2A32A 4MVNA 1XXFA 4BAHB 4GHQA 4NSVA 3STJA 1Z71A 2G4UA 1P9SA 4JZFH 1TPAE 4CHAC 1D9IA 1ELEE 1UMAH 4AGJA 1O2VA 2OXSA 2GCHG 3ODDA 4CRFA 5FBEA 1JIRA 1ZSKA 1SQAA 1TAWA 4O03A 5T3HA 4GSOA 3RXJA 1SHYA 5A0BA 4I8LA 1P06A 4I33A 5H4IB 4GCHF 1HRTH 1AUTC 4VGCC 2J34A 2BLVA 5JB8S 3LC3A 1GPZA 1YYY1 1KXBA 1BTZA 1TE0A 4X1RU 2OTVA 1EKBB 4D7GA 4CRDA 3TH3H 3NPSA 4TY6A 1V2JT 1C4V2 3GDSA 1CGIE 3PLPA 5GJ4B 5IYTA 2AMQA 3ZVGA 3VB3A 1GHWH 1GBFA 4Z6AH 3BTHE 1QL9A 1RGQA 3ZVEA 3EGKH 4K2YA 1Q31A 1P9UA 2J9NA 1TQ0B 3A7WA 1CT0E 2UUJB 1ZMLA 3C27B 4JYTA 4UFDH 4X1NU 4Y8XA 1G3EA 1TBRH 2RDLA 2VJ1A 3BTME 3IWMA 3LGWA 3ODFA 1O2PA 4F4OC 3OY5U 3LU9B 5TCCA 3BG8A 3ATIA 1IQFA 2H5DA 1OKXA 1QRXA 2AEIH 1LVOA 2SGAA 1S5SA 3OYPA 2XCFA 4YOGA 2KAIA 5DP8A 1EPTA 1KY9A 1P2NA 6GCHF 1KXDA 4DGJA 1C2GA 1G3BA 1TALA 2OLGA 3ATMA 4RN6A 2FM2A 1GVLA 3RM0H 2NU0E 4ABHA 4JMYA 5EODA 1UVPA 2Q6GA 1J14A 1FNIA 1P04A 1GWAA 3AW1A 4ZKNU 4LOYH 2ZPQA 4I8HA 1AB9B 2ZU2A 2Y6TA 1KXAA 3DFLA 4X0WU 1IQJA 1TOMH 1HIAA 5CHAC 3ZZ7A 3ESTA 1PPHE 1P8VC 2GT8A 3A81A 3HATH 4FUHA 2QIQA 4GHTA 1XUHA 3RXTA 2VIDA 3GCTG 4LK4A 5EPNA 3BEUA 3SJKA 4JCNA 4Q80A 2XW9A 2ZPRA 2PKAA 1SQTA 3H7OA 3SNDA 2R0KA 2FOMB 1QGFA 4WMEA 1C5YB 3MH5A 1ZTJA 4ISNA 2I6SA 3KQEA 1AUJA 3N7OA 4Y71A 1O2QA 1YM0A 1SLXB 2O9QA 1TNKA 1C2EA 1BIOA 2Y5FA 2A4RA 1ELGA 1L1JA 1OOKB 3GY2A 1KLIH 3UOPA 5HXFA 5FX5A 3ZVAA 3MOCA 5C5OA 4WY3A 4X8TH 3SU2A 1SPJA 1SGIB 1AFQB 4RSPA 1HUTH 1DICA 3LGUA 2V35A 4R0IA 2SFAA 4AGKA 1JBUH 5F8ZA 1LHDH 1FY4A 2JH0D 1P09A 4KP0A 4DIIH 1F0TA 1QL8A 2A31A 4MPVA 1ZGIA 4ISOA 5I46H 2OBQA 2ZGCA 2XNIA 4Y8ZA 1UVOA 1MBQA 1RTKA 1GCTB 4Q7XA 2TGAA 1AMHA 1J16A 1SGNE 1MAXA 3A8BA 1P2JA 2BVXH 1P3EA 4NA7A 2GCTB 4U2WA 5DP3A 1Y3WA 2CHAC 4ZROA 1BBRE 1W3CA 1ANCA 3KHVA 1BT7A 1SB1H 2ZFTA 3RXIA 4NFEA 5T6FA 4YO9A 1F7ZA 2RCEA 2NWNA 2QXJA 2VINA 1TGTA 1YBWA 1JXPA 2VIVA 1ABIH 2HPQH 1AFEH 1QBVH 1WAYB 1GL1A 2GV7A 3ZZ6A 1C1OA 2AGEX 1V2PT 1O0DH 5AFZH
chains in the Genus database with same CATH superfamily
1O2UA 2ODYB 4GUXA 1O2GH 3I77A 3N7DA 4IC5A 1MKXH 2YNBA 2GZ8A 2Z3CA 5GCHF 2FMJA 2GGVB 3SUEA 4XDEA 3UR6A 2P8OC 1C4U2 1P12E 1ZHRA 1Z6JH 2Z94A 2B9LA 1AVXA 1TGBA 1SGRE 2VIQA 3H5CB 5T6GA 3S9AA 1GGDB 1NZQH 1XVMA 3SQEE 3BTEE 3MH6A 4ZAEA 1RJXB 2BX4A 1SR5C 1KXCA 5HYOA 1F5RA 2AGIX 1K9OE 2FPZA 1MTWA 2THFB 2UWLA 4DJZB 3B9FH 1G36A 1A3EH 2C3SA 2GV6A 2PGBB 2ZFSA 1HNEE 3H7TA 1YPEH 3MU8A 1AQ7A 3OFND 5EOKA 5ETXA 1IQGA 2YMSD 2PSYA 1RTFB 2BHGA 4DURA 1BMMH 4M9FA 1A5HA 3MTYA 4M7GA 2QGRA 1ESTA 4O97A 3F0PA 1LVBA 4ABFA 5C20A 1NFUA 4A1VA 2FS9A 2LPRA 2W3KA 4YESB 1RRKA 5IK2D 1MKWK 3FOAA 3P8FA 3RM2H 1Z8GA 1T8NA 1E34B 2VVCA 4A1XA 1ZRKA 5DSFA 1ANEA 1ANBA 3T29A 3TVJB 2FLRH 2ZU4A 5E2PA 4IN2A 1EOJA 1P05A 2BD2A 5C3NA 3HKIB 1VITH 4Q7ZA 3VEQB 2ASUB 4XOJA 4LZ4B 2A7JA 5AF9H 1YKTA 5AFYH 1VGCC 3A7XA 1NRRH 3PM3A 3UFAA 2ZDVH 1O30A 1O3GA 3RU4D 3GDVA 1UCYK 2A2QH 3DSPA 1SGFA 1O36A 1FUJA 2ZHDA 1EP6A 2EA3A 2HNTF 3TH2H 4DOQA 1QIXB 3BG4C 4OS2A 1E38B 1ZHPA 1AU8A 2B0FA 5B6LA 5KECA 4ESTE 2VIOA 1HCGA 2JH6D 6LPRA 1C9TA 1TYNA 1DUAA 2UWPA 3GY3A 2ZGXH 1HJAC 2WV9A 3P92A 2V3HH 1CA0B 1OPHB 5GDSH 2A7HA 3F9HA 3ZVDA 5BRRE 2FIRH 2QE7D 4AC9A 1NBME 1GJBB 1ELVA 3EE0B 3OE7D 1C1TA 1WU1A 1DVAH 1SMFE 3DA9B 3FKSD 1FY3A 5ESTE 3Q76A 5C1UA 4Z1MD 1TNJA 3A7TA 1TNLA 3MO9A 4X2YA 1KTTB 2KCOA 5F8TA 1SLUB 3ZVBA 1SGTA 3SGAE 4CR9A 1P2MA 1ANDA 4J1YA 1HAVB 7GCHG 1XUFA 3TJUA 4ABJA 2SGFE 1GHAG 2O8UA 2VWOA 1UJ1A 1WUNH 2D26C 2RDEA 3TGIE 4Q2KA 2D1JA 1L4DA 1W11U 2OQUA 3ZZ4A 3ENSB 4HGCA 1LKBA 4X6NA 2OQ5A 3BF6H 2OC8A 5A0AE 3A84A 1NTPA 2ZF0H 3SYJA 1S6HA 3PV2A 8GCHF 1ZOMA 4NIXA 1P02A 1S0RA 4MNYA 1NC6A 2G52A 1P57B 2BDIA 1QBNA 2IJOB 1P01A 3TGKE 1QFKH 1GHBF 1K22H 1S85A 2PLXA 1KLJH 1GDUA 2DE9A 2TPIZ 1HAYB 3L3TA 1EAIA 3F6UH 1LHEH 3T28A 1F92A 1N6YA 1MTVA 1VCPA 4FETA 1GMHF 4YT7H 4X2XA 2XC5A 1SGQE 3ZVCA 1BCUH 1BQYA 1MUEB 1KMHB 2ANKH 3CP7A 2JIZD 1NU7B 4MNVA 1FAXA 1DE7H 2VGCC 2GX4A 1O2WA 2FI4E 1O2JA 4CBOA 1V2LT 1O2MA 4BTTB 2WPLS 2XRCA 4B1TA 3L33A 1OX1A 1UTNA 1J15A 3ITIA 1DLEA 2J4IA 1MZDA 3KL6A 5C67A 4IBLH 3RXHA 3A80A 3M7TA 2ZKSA 1DWEH 2QXHA 3KQDA 3RXQA 5A2MH 4CH8B 4XD7D 3VXEH 2F83A 2JDID 1QZ8A 3URDA 3W94A 4KTSA 1DSUA 2VH0A 2V7QD 3BTWE 1UHBB 3UNSA 2WUCA 1O2YA 2SGPE 3W1EA 1C1RA 1C5MD 2ZGBH 3TLOA 1NRNH 4DY7B 1NROH 3HPTB 4ZUHA 1Z1JA 3AASA 2ZDMA 1WTGH 1RFNA 4P02A 4BAOB 3TK5A 1T8OA 1PPBH 1BHXF 1TMUH 4AOQA 4A6LA 4CRGA 1O5BB 2PGQB 4AORA 3TJVA 1O33A 5JPMH 4AZ2B 4NGAH 4KKDA 4TPIZ 2VWLA 3GCHC 1BTPA 1NM6A 5CDFE 1O5FH 1V2WT 1AKSB 2GT7A 1A5IA 1V2VT 1IQMA 1TGSZ 2UUFB 2ZCHP 4H4FA 4J2YB 2ZPSA 1N1LA 1NN6A 1S84A 2FX6A 1LCYA 2QV1A 2W6JD 5E2OA 2FOCA 2ZA5A 2PTCE 5HKKD 3BTFE 1LVYA 1NPMA 2ZDNA 3D62A 1C5VA 2FWWA 2QXIA 4FUCA 1YPHC 4BOHA 2PSXA 2A4GA 4AFUA 3PLKA 1GBCA 2UUYA 1RTLA 2QA9E 1KYNA 2Y7XA 3BIUH 2GJGA 3V12A 1M9UA 3MHWU 1GI6A 4E7RG 1LHFH 2NU2E 4BAKB 1ORFA 5K0HA 3S7HB 1MTUA 2GTBA 5DK1A 2XBYA 1DUEA 1SQRA 1HXFH 1TQ7B 4MQAA 1GJ8B 4ZCNA 1ELTA 2EI6A 5F03A 3DSGA 3E6PH 1NT1A 2KM0A 3ZZCA 1ARCA 3MMGA 1P3CA 7LPRA 1BDAA 1QR3E 1DANH 5HIZA 2TBSA 4CRAA 2Z9LA 1NESE 4ZKRU 1GMCF 1GI7B 1C5NH 1EZQA 3GY5A 3E1XB 1BRBE 3L6PA 1YF4A 1IAUA 4H6SB 5EXLA 4D8NA 5CE1A 2STBE 3PMHB 1DXWA 1FMGA 2KFWA 5FXLA 2P16A 1FXYA 5E0HA 3SNCA 2BTCE 1W13U 2VWNA 3F2FA 1CT4E 2BQ6B 2A4OA 3UY9A 1L2EA 8LPRA 3SU3A 1LPGB 4FU8A 3IITA 2XTTB 3EAJA 3CENA 1E36B 1O3IA 3QWCH 1LHGH 1O2RA 3VB5A 2JKHA 1MU6B 4JK5A 4CHAB 1IQLA 1J17T 1O2IA 1UTJA 1ELDE 2XWBI 1VITF 2VB0A 4XBDA 3S7KB 3WW7A 2OBOA 1W7GH 4TPYA 1OWHA 1HAZB 3SV6A 2VBCA 2GDDA 3O8DA 3MNBA 1V3XA 1UTMA 1H9LB 2QCYA 1FDPA 1WOFA 1Y3UA 1O39A 1YCPK 3SJOA 1O5GH 1ZJDA 1K2I1 2TRMA 1MTSA 1RD3B 3BTTE 1BJVA 2M2AA 2VIPA 2GVFA 4YOJA 1TX6A 4KGAA 4ISLA 4Z0KA 1CBWC 2XBWA 2JJ2D 2GD4B 1A2CH 3FAOA 1B7XB 1BRCE 1CHGA 1S6FA 2Q6FA 4UEHH 4ZHLU 4UONA 1ZPZA 3HK6B 1ZZZA 3SBKA 3SV9A 3N99A 1PPGE 1GL0E 4IC6A 1GI2A 2ZTYA 4CBNA 1BRUP 1GI9B 9LPRA 1HYLA 1FPHH 2ZZUH 2WHXA 3A8AA 1A4WH 1EAXA 1K21H 2QF5A 3RXGA 2PR3A 1W2KH 6GCHG 1MQ6A 2A5IA 4YT6H 3MU4A 3U69H 1XUJA 3SN8A 1EUFA 1A61H 3I78A 1AWHB 1SGYE 2BLWA 2TGTA 1GBAA 4PROA 1ETSH 3PB1E 1C4Y2 2C4FH 1NRSH 1C2KA 2BOHB 2GP9B 1F0SA 5C2ZA 1VCWA 3F9EA 1A46H 2HNTC 5CMXH 3V0XA 4Q7YA 1QCPA 4U30A 3SNBA 1CE5A 1HGTH 4I86A 4Q4LA 1KLTA 3BEIB 4UE7H 1H1BA 5C1XA 4AFZA 3FO8D 3R3GB 1NY22 2W7SA 2HVYB 5DPAA 1TNGA 3P8NA 1ID5H 5CHAB 1DS2E 5A8XA 1HAVA 1WTHD 3OSYA 4NA9H 3UNRA 3VGCC 1O3BA 3Q3YA 3UIRA 2AERH 2DUCA 3P8OA 2GMTC 3S69A 4RT1A 2JH5D 1HV7A 1QQUA 1IHTH 3FANA 3NRLA 3FFGA 5DKMA 5EXNA 4OGYA 3RXAA 4TSFD 3MU1A 3LOXA 2Y80A 3TNSA 1JRSA 4LXBH 5HMAA 3LT3A 1AVWA 2GZ7A 5AVDA 4B6FA 3RU4T 1TPOA 2AS9A 3V13A 1PYTD 1SLVB 1D3QB 4FUIA 2G8TA 3F9FA 2Z9IA 3M5MA 2A45B 1OHHD 2BVRH 2F4LA 1FAKH 2WYGA 5L2YH 1H8ED 2ZQ2A 2LNCA 2PKSC 3T5FH 1HJ8A 1Y5BT 2TGPZ 3FZZA 3PYHA 5EJZA 2GZ9A 4B74A 4GAWA 1BBRH 1C1VH 2NU3E 1T4VH 1AO5A 4TT3D 3ZZBA 2Z9GA 4JK6A 4FUBA 2J2UA 1ZHMA 1NRQH 1QQ4A 4FUEA 1X7AC 1TNIA 4K60A 1DWCH 4OS6A 3K65B 2BX3A 5LGOA 1GI8B 2VU8E 8KME2 3ZZ3A 4MNWA 3E0PB 1ZYOA 2A0QB 4OGXA 1HBTH 4AN7A 1J9CH 1LQDB 3BIVH 2C90B 2R2MB 3QUMP 4FUDA 4X6MA 4ZXYH 3NUMA 2F3CE 1GJDB 2CHAB 1DT2A 3FP6E 2H2ZA 1LHCH 1YPMH 3LH1A 7ESTE 5FHTA 3M5NA 1XX9A 1GG6C 1O3EA 1SI5H 1C1QA 3TGJE 3A8CA 5GIBA 3M3VA 4U01A 3M3TA 3F9GA 1UHBA 5EXMA 1V2NT 3RLYH 4OS4A 3UAIC 2HRVA 4JZ1A 2BDYA 1XKAC 2AYWA 3KEEA 3KN2A 3S9CA 1A0LA 5SGAE 5FAHA 3RXPA 2A1DB 2FO9A 1THSH 4TWWA 5GCHG 1C9PA 5LH8A 1XM1A 3RMLH 2BOKA 1C5PA 1EP5A 1GHYH 4IGDA 1KIGH 1F0UA 2BYAX 2JETC 5C0UA 2ZIQH 5HM2A 1C1WH 2TIOA 2P8OB 3OY6U 3SV2H 2A5KA 3KYGA 3LGYA 1O3PB 1P10A 2OCVB 2F9UA 3SI4H 5J4SA 3SQHE 1VCQA 3PLBA 1A3BH 4WXVA 3F1SB 2YNAA 1O3OA 1AKSA 1O5EH 5FBIA 2STAE 1TFXA 1FN6A 3UB0A 1CQQA 2WPJS 3SOSA 2H9EH 4BAQB 1GI3A 4IMQA 4NZQA 5T1VA 4ACAA 1GBEA 2FX4A 1SGFG 2ZU5A 3ELAH 5ESBA 1DOJA 2L6OA 1T31A 2ZHFH 2KCPA 2J98B 3Q3XA 3PWCA 4ASHA 4X1SU 5FX6A 2Z6BD 2GDEH 4JZEH 3A8DA 3NKKA 1QURH 2R0LA 1EASA 4HZHA 3O8RA 2O8WA 3P95A 1FY5A 1QBOA 1MTNC 2BY7X 2BD5A 1BMAA 1TRYA 5JBCS 4NWKA 2M5TA 1OWKA 4DVAU 3KCGH 3WY8A 1VKYA 1GJ7B 2CJIA 4IW4E 1SL3A 4Q63A 4DIHH 1C2FA 2ZDLA 4B2BA 3DFJA 3ZIAD 5L2ZH 3KGPA 4LZ1H 2OC1A 2FYQA 5KGOA 3QTOH 1EJMA 2QF3A 3SV8A 1MMJN 2KX4A 3RXFA 5EIYA 1PPFE 1XUKA 2C8WB 2BD8A 1LO6A 3FP8E 2C8XB 2QAAA 1WCZA 1VGCB 4FVDA 1TABE 3M7QA 1PQAA 2BDAA 1HLTH 2BY6X 2ZO3H 1QHRB 2V3MA 2YMSC 1YP9A 1CU1A 2WPIS 4INLA 4WWYA 3ZYEA 1TONA 2BLQA 4ZMAH 3MH7A 5DP5A 3UWJH 1BJUA 1O3FA 4FU9A 4MPWA 3RXMA 3BG4B 1UCYH 2BDBA 1Z8IB 1E1QD 1NFXA 3MU5A 2H6MA 4MNXA 4MPXA 3FP7E 2IN2A 3RC4A 6CHAC 2P3TB 5JYIA 1FY8E 2PV9B 1V2RT 1HJAB 1P03A 2FI3E 4ABIA 1Z1IA 1TRNA 4NA8A 1DX5M 2R3YA 1MCTA 3LGIA 3VFEA 3EYDA 5JBTA 3DHKH 4HI3A 4JYVH 1F2SE 1IQKA 1ZGVA 3AAUA 3ZVFA 4I8JA 1COWD 3TJNA 3RXCA 2XBVA 1UVSH 4X1PU 3LH3A 4E06H 3RLWH 1UTPA 3AK5A 3OX7U 4OS1A 4OS5A 3FN8A 4K8BA 2O8LA 2Z9KA 2PUXB 2ZFPH 1O37A 3HGNA 1O3LA 4UFEH 2VH6A 3LGVA 3UNQA 2HGTH 3GS9A 4NIVA 1G37A 1QY6A 1UCYE 5LPEA 1GBHA 1PJPA 4WMDA 3RU4E 1AD8H 4ACBA 2F9PA 1N8OC 1S81A 1S6LA 8GCHG 1O2TA 3P8GA 4THNH 4X2VA 2ZECA 3F2GA 1GHXH 2J95A 2K0QA 3QX5H 5L30H 1BMNH 1P2KA 1GHBG 3MFJA 1BTHH 3HKJB 1SC8U 3MYWA 4HTCH 3ZZAA 1G2LA 1S0QA 1YPKH 4A5TS 1G32B 3RMOH 5A0CA 1EAWA 3E91A 1EPTC 3TK6A 1L4ZA 5GWZA 1MAYA 1K1MA 4ASUD 1XVOA 2FOGA 3SU0A 1GBJA 3EA9A 3SUFA 1GMHG 1TWXB 3MNSA 1QJ7B 1JOUB 2G81E 3UR9A 2CGAA 2ZHEH 1GI4A 1UW7A 4WH8A 4B75A 1G30B 2P93A 3VXFH 3V7TA 3PTNA 1F5LA 3TK9A 1LPKB 2PTNA 2Q6DA 2WPHS 2WYJA 2P3UB 1WQVH 2VGCB 4INKA 1LQEA 2W5EA 3TIUA 2EY4C 3RC5A 1OP2A 1CT2E 3MU0A 1K1NA 1GJ6A 3NXPA 1HXEH 1BTWA 2DE8A 2ZHQH 1KTSB 3SGQE 3U8TH 1W0KD 1ABJH 2J92A 4B6EA 4FXGH 1K1IA 3A87A 3RXUA 3RXBA 1ETRH 3U9AH 5GXPA 2BQWB 3DT0H 1C5XB 4YXWD 1C1UH 3OEED 1GJCB 1Q2WA 1ZTKA 3M35A 4ZHAA 5AHGH 4AB9A 3HGPA 1ZMJA 4I32A 2CXVA 4I7YH 4ISHH 1KXEA 1W0YH 2ILNA 2FOEA 1H9HE 3TU7H 3MNCA 2FOHA 2F9BH 3V3MA 1ZLRA 2B8OH 1SHHB 4FVBA 3EA7A 5KEDA 1O2NA 4ISIH 4Y8YA 1MCVA 1L1NA 3GCHB 4ABDA 1ESAA 4FUFA 1AI8H 2ZFFH 4BAMB 1PPEE 1SBWA 1IQEA 1Z6EA 3Q00A 4CRBA 2XC0A 1HAIH 1DY8A 1KDQB 4TY7A 1SQOA 3AW0A 2FTMA 1FY1A 1A1RA 1DFPA 2SGEE 2G51A 4A7IB 2ZDKA 1YPGH 3M61U 1DWBH 1V2KT 1B0FA 4MLFB 3OU0A 2QN5T 1C5RA 2KR7A 3A82A 4B2CA 5DP7A 3UTUH 3T62A 5EPYA 1GBMA 2QF4A 2V3OH 4KELA 1AGJA 1PQ7A 2Z3EA 2WSSD 1ETTH 1J8AA 2R2WU 1Q3XA 3T2NA 2WV5A 1GJ9B 4E7NA 3PO1C 2HOBA 3BTQE 4FU7A 1LMWB 4SGBE 1YPHE 1P2IA 1O5AB 4YLQH 5JDUB 4K8YA 5FCKA 1QA0A 1YGCH 3E8LA 2SNVA 2BM2A 4YOIA 3QTVH 1ZTLA 1EOLA 1GMCG 2Y81A 3QO6A 1G3DA 3SJ9A 2FODA 1C5UA 2ZFRH 3ZV9A 3WWBA 4DG4A 5A09A 1EAUA 1O2XA 1YLCA 5EQQA 3SZEA 1C2JA 2W3IA 4B71A 1B5GH 1HAGE 3JZ2B 3RUOA 1Y3XA 2C8YB 1ZSLA 1C5TA 4IMZA 1P2QA 3N7EA 1WBGB 1G3CA 2VVUA 2XXLA 3T26A 2ULLA 1WQSA 5EGMA 1YCPM 1GBBA 1KXFA 3RXOA 1SSXA 4O3UA 4B73A 1O2LA 3QZRA 4RKJB 1CO7E 3QLPH 1Y5AT 1TMTH 3EDXB 3OAAD 1T7CA 2ZQ1A 1V2ST 2XWAA 5C5NA 1RIWC 2J98A 1F0RA 1HJ9A 1RXPA 2AIQA 3O8CA 2Z9JA 2G55A 3MH4A 1YLNA 1GI5A 3U8RH 2XOKD 1O35A 3QDZB 3PMJA 3Q3KA 4WF8A 1ZPCA 1ZMNA 1TBQH 5FPSA 1H8HD 3MO3A 3K6ZA 4JZDH 1YPLH 5A8ZA 1HB0B 4GCHG 4WMFA 1QB1A 1E1RD 2ZGHA 2J94A 3GICB 3ATKA 4MPUA 2D2DA 3CS0A 1FJSA 2A2XH 1O3NA 4AX9H 2C8ZB 1CBWB 5A8YA 1GBKA 1YCPH 4VGCB 2H5CA 2FP7B 4GLYA 3UUZA 4H42U 2ZC9H 3M7UA 1SOTA 1OP8A 2NU1E 1SGDE 5JB9S 3T27A 4BANB 1EJNA 2RA3A 1FV9A 1TGCA 1VZQH 1Y8TA 3M5LA 1CHOF 1GMDF 5BPEA 1LTOA 4A1TA 1K1LA 3PTBA 3S9BA 2BD4A 1MD8A 3CS7A 1PQ5A 3LJOA 5C94A 1EJAA 1T32A 5F8XA 1C1SA 1T8MA 1C5LH 5DJ7A 1GBDA 2J38A 3UPEA 2SGDE 1OYQA 3K2UA 2QY0B 2P3FH 3I29A 2FI5E 1L1GA 2CV3A 1H9IE 1D3TB 3SW2B 1V2QT 3LIWA 2RA0A 3DCLA 4BNRA 4IS5A 1TGNA 2AIPA 1FZZA 1MZAA 3A7ZA 1O2KA 1WXRA 3TITA 4IN1A 1O3HA 1UK4A 2GCHF 1YPJH 4XBCA 1FLEE 2PHBA 4ZHMU 1BMFD 1BOQA 2Z7FE 2ZEBA 3HK3B 2L74A 4Y11E 3BN9A 3LGTA 1ZJKA 3PMAB 4CRCA 2FEQH 1H4WA 5ABWA 4UFGH 3SZNA 1SKYE 5FPTA 2J5UA 5DGJA 1EZXC 3UWIA 1BMLA 1D6WA 1O34A 1ZSJA 3LONA 1BTUA 2FXRA 1C2MA 2ZCLP 2FZZA 2ODQA 3VGCB 1O3AA 1GI0A 1D6RA 2GMTB 2K8IA 3A88A 2HNTE 3PROA 2G5VA 2QXGA 1H8DH 3SU4A 3O8BA 3MWIU 1NO9H 1EB2A 2FOAA 3KNXA 4YLUA 4I31A 2BD7A 2VIWA 5DP4A 1O38A 1AWFH 3LPRA 1PPCE 1HAXB 4ABGA 1ARBA 3NK8A 1WSSH 3SO3A 3BEFB 1T4UH 5DP6A 3VB4A 1IQHA 4DT7B 9ESTA 5J4QA 1O3DA 2PKSB 8ESTE 2BZ6H 4B76A 3UREA 3RXVA 4B2AA 1GHVH 2BDCA 2SNWA 1KSNA 1W8BH 1JMOH 1LKAA 1CGHA 1QB6A 1SFQB 4Y0ZE 1QNJA 1VJAU 1FPCH 4D9RA 3PRBA 1BA8B 1AB9C 4NFFA 1QRZA 1O5DH 1BTXA 2IPHA 1TPPA 2BDHA 1MQ5A 2P94A 2FOBA 4BTUB 5JBBS 1GDQA 3STIA 2ALPA 2FLBH 1LDTT 3QZQA 1O2HA 3D23A 1K1PA 1P2OA 4ABBA 2BY8X 1O2SA 3RMNH 2KCYA 1EZSC 1PYTC 3JZ1B 2JJ1D 3SHAH 1GG6B 4FUGA 2ODPA 3GY7A 1V6DA 2H1UA 3GCTF 1BBRK 1B0EA 4Y10E 3OTJE 5EW2H 1BRAA 1DXPA 1C1NA 1SOZA 3LJJA 1HPGA 1AZ8A 3GYLB 4XBBA 3Q77A 1C5QA 2FESH 2Y82A 3EE7A 1Z8JB 4ZKSU 3SHCH 3U1IB 3ZYDA 2XCNA 1O3KA 5HGGA 1O2ZA 2Y5HA 4QT8C 2ZP0H 1AE5A 1AFQC 3TPIZ 2JETB 3K6YA 3SORA 2OC7A 1ZR0A 3QGNB 4I8KA 1GDNA 1TLDA 3A86A 1HAHH 4AB8A 1AE8H 5LPFA 1V2TT 4AG1A 3E0NB 1AHTH 1IQNA 4AFSA 3A7YA 2C93B 1JWTA 3M37A 2KZ4A 2FYRA 1F5KU 2V6NA 1UVTH 2AMDA 2NU4E 1GCTC 1KDQA 1FI8A 1BB0B 4INHA 4DCDA 1BHXB 3MO6A 2ZTXA 1UK2A 2GCTC 2ALVA 2HWLB 5C17A 5F53A 4F48B 2BMGB 1C5OH 4ABAA 2ZDAH 1QJ1B 4RT0A 1EB1H 2FDAA 2O8MA 4XE4A 1UTQA 1ZPBA 5EW1H 2F9OA 1A0JA 1H8IH 1AN1E 2A5AA 2WV4A 2ZHWH 5GNDA 1MTNB 4Y76A 5TJXA 1E79D 1IHSH 4F55A 2BDGA 2O8TA 1C5WB 1MKXK 1DY9A 1T8LA 1SGPE 5FPYA 5DG6A 2ANYA 2BZAA 3SGBE 1DSTA 4K1SA 1DDJA 3VG8A 3SNEA 3ZZ9A 4NZLA 2P59A 4FUJA 3SUGA 1TX7A 3KQ5A 4Y6DA 1HDTH 4A92A 2HALA 3GDUA 3RXSA 3A7VA 2CF9H 4WH6A 3WWFA 3KF2A 1Z8RA 4UDWH 1PPZA 1Y5UT 4X1QU 3FVFB 3P70B 4D7FA 1A7SA 4P00A 1GGDC 5E8EH 1W10U 2XBXA 3D49H 1O5CB 1GJ4H 3U98H 1AY6H 2FS8A 1O3CA 1MKWH 1OWDA 2R9PA 4NWLA 1DWDH 1CA8B 1TOCB 1ELFA 3FZDA 2K1QA 5T6DA 2PUQH 2YMSB 1W7XH 4Y79A 1ELBA 3SV7A 3ZZDA 3RXRA 3ATLA 3C1KA 1O3MA 2KCAA 2Y5GA 1C1MA 2YOLA 1O32A 2P95A 2R3UA 1RS0A 3GY6A 1QL7A 5IDKA 4H6TA 2EC9H 2TGDA 3UOUA 2F9NA 2WPKS 2ANWA 5E0GA 6CHAB 1BZXE 1UO6A 1C2IA 2ZU3A 1CSOE 2W7UA 3ZZ8A 2IOTA 1GJAB 4TWYA 4JZIA 1TNHA 2EQNA 5PTPA 1OWIA 4NG9H 1E0FD 2BB4A 1A5GH 1U6QA 2UWOA 3VPKA 1OWEA 1NBMD 1FONA 4K1TA 1OXGA 3NWUA 1XMNB 2XC4A 1AIXH 1NFWA 4KTCA 3SJ8A 1HAOH 3RDZA 5JBAS 4NCYA 2PP6A 2RG3A 3B8JA 2CN0H 2ZGJA 1EFRD 1K1JA 1LPZB 1QA7A 2VVVA 4Y0YE 2HVXA 3R0FA 3PMBB 4AYYB 1O3JA 1V2UT 1EZUC 3DUXH 2ZU1A 2W26A 5LPRA 1N8OB 4WVPE 2WPDD 2WUBA 1W0JD 3RP2A 2WINI 1ESBA 2QF0A 1Y3YA 4BTIB 3D65E 3SU6A 1S83A 4X6PA 2H9HA 2ZFQH 4AFQA 1NFYA 2QYIA 2VWMA 3AVZA 2IPQX 3LC5A 1E37B 4XFQA 3QGJA 4I8GA 1K28D 1JRTA 1MU8B 1ELAA 3VB6A 3QK1A 3TNTA 1GVZA 2BLOA 3AAVA 1EATA 5EG4A 2KAIB 1EPTB 1GCDA 3K9XB 1P0SH 1CA0C 4BXSA 4F49A 3MNXA 3GISB 2LP6A 1CGJE 4X6OA 1TMBH 1EXFA 3EQ0H 2OP9A 4JYUH 3PWBA 1TIOA 4GVUA 2ZG0H 5CHBA 4ZXXH 1OYTH 2Q1JA 1S82A 1IOEA 1WYKA 4U32A 5B6OA 1XXDA 3U8OH 2A7CA 1HIAB 1UTKA 4O3TA 1ELCA 4TYDA 1DLKB 2EI7A 4ZKOU 2ZCKP 1FQ3A 2OD3B 1O2OA 7GCHF 3UQVA 2VNTA 2PKAB 1WDIA 3NCLA 4NIYA 1YY3A 2GKVE 3LKWA 1GHAF 3URCA 1YC0A 1C2DA 3GOVB 3GY4A 2AHME 5I25A 1V2OT 5EJLA 2BD3A 3RMMH 4K69A 3KQCA 4K5ZA 4RKOB 1D4PB 1TX8A 2H9TH 1K0HA 1XUIA 3UQOA 3U1JB 1CVWH 3SNAA 4O9VA 3P17H 3GYMA 1ACBE 1N6XA 3RXDA 1EX3A 1OS8A 3PV5A 4MTBA 1INCA 1GBLA 3S0NA 3RXLA 4WJG2 3NZIA 1SVPA 3BTKE 1ZRBA 1C2LA 3EA8A 1P11E 4YM9A 1Y3VA 2B5TB 2W6ID 5EQRA 5FCRA 1QRWA 4D76A 2BXTH 4WXIA 4CR5A 2BQ7B 3TJOA 4DW2U 4RI0A 1V2MT 1FN8A 1GBIA 3GCOA 2G4TA 2ESTE 3BTDE 5TCAA 2XNDD 1NS3A 1TA2A 2OINA 1W0ZU 3MI4A 1SG8B 1FIWA 1D3DB 1TRMA 2EI8A 4YTAA 5K7RA 1XKBC 2B7DH 2WPMS 2I6QA 1QJ6B 4X8VH 1K1OA 5EQSA 2BXUH 4XSKU 1G2MA 5DO4H 5DN6D 5EU8A 2CMYA 1BUIA 3RC6A 3E3TA 2XYAA 1MD7A 3GCNA 1BITA 2BVSH 2CF8H 2ZWLH 3M36A 3P6ZB 1GHZA 4ABEA 1MH0A 3QN7A 1GJ5H 1E35B 4D9QA 4MDSA 1THPB 3SJIA 1HAPH 1SLWB 4X8UH 3PO1B 1MBMA 4YZUA 3SUDA 2BD9A 2FTLE 3U28C 2HPPH 2BY5X 3SI3H 1DM4B 1NRPH 2AFQB 3KQBA 5G4BA 1JIMA 1TBZH 3KIDU 4X2WA 2D8WA 2F91A 2Y7ZA 1XUGA 4X8SH 1QTFA 2SGQE 4UD9H 4CREA 4NIWA 4AYVB 4UFFH 1GVKB 2PW8H 1PFXC 3F68H 4SGAE 2ZTZA 5L6NH 2AMPA 3GY8A 1O31A 1EQ9A 4XRNA 3IG6B 2F43B 3A89A 3BV9B 2BY9X 3BSQA 1SFIA 1L0ZA 3TH4H 2EEKA 2QC2A 3T25A 3W95A 1VR1H 1W12U 1C5ZB 2HLCA 2OUAA 3ZZ5A 2IJD1 1GBTA 1SGCA 1UTLM 4K3JA 1TB6H 1WV7H 2PWXA 3M3SA 5F6MA 1FX0B 1OSSA 1TA6A 1YLDA 1A0HB 4BXWA 1QB9A 3BTGE 1SGEE 1UK3A 3ZV8A 3PV4A 1W14U 1UTOA 5HIYA 1G9IE 1RIWB 2FOFA 4E05H 4Y7AA 2G00A 3SU1A 3M5OA 2F9VA 3A83A 3G01A 1IQIA 4KTUA 5C1YA 1C1PA 3VB7A 1GI1A 1Y59T 2A4QA 2ANMH 1AVGH 1VITG 4ZH8A 1DITH 2G5NA 2UUKB 3E90B 5E0JA 3RXEA 3DD2H 2AGGX 2V0BA 4HFPB 3A85A 5DP9A 2RFKC 1C2HA 2OC0A 1OWJA 1LVMA 1HFDA 1Z7KA 2AH4X 3H09A 3RXKA 1THRH 4AG2A 4Y7BA 4OS7A 5GPIB 4NSYA 2Z3DA 4GPGA 4R8TB 1D3PB 1BTYA 1VJ9U 1PQ8A 2ZI2H 3LDXH 4CH2B 3OTPA 6ESTA 3ATWA 1UVUH 1CHOG 1GMDG 1TPSA 1YWUA 1OP0A 3DSOA 4K1EA 7KMEH 3SU5A 5HM9A 3E16B 2ZNKH 2PFEA 4MG3A 1AZZA 1FIZA 3PRDA 1C5SA 3B23B 1DPOA 4FOUC 1NU9A 2A32A 4MVNA 1XXFA 4BAHB 4GHQA 4NSVA 3STJA 1Z71A 2G4UA 1P9SA 4JZFH 1TPAE 4CHAC 1D9IA 1ELEE 1UMAH 4AGJA 1O2VA 2OXSA 2GCHG 3OEHD 3ODDA 4CRFA 5FBEA 1JIRA 1ZSKA 1SQAA 1TAWA 4O03A 5T3HA 4GSOA 3RXJA 1SHYA 5A0BA 4I8LA 1P06A 3F3BA 4I33A 5H4IB 4GCHF 1HRTH 1AUTC 4VGCC 2J34A 2BLVA 5JB8S 3LC3A 1GPZA 1YYY1 1KXBA 4HG6A 1BTZA 2LELA 1TE0A 4X1RU 2OTVA 1EKBB 4D7GA 4CRDA 3TH3H 3NPSA 4TY6A 1V2JT 1C4V2 3GDSA 1CGIE 3PLPA 5GJ4B 5IYTA 2AMQA 3ZVGA 3VB3A 1GHWH 1GBFA 4Z6AH 3BTHE 1QL9A 1RGQA 3ZVEA 3EGKH 4K2YA 1Q31A 1P9UA 2J9NA 1TQ0B 3A7WA 1CT0E 2UUJB 1ZMLA 3C27B 4JYTA 4UFDH 4X1NU 4Y8XA 1G3EA 1TBRH 2RDLA 2VJ1A 3BTME 3IWMA 3LGWA 3ODFA 1O2PA 4F4OC 2WZQA 3OY5U 3LU9B 5TCCA 3BG8A 3ATIA 1IQFA 2H5DA 1OKXA 1QRXA 2AEIH 1LVOA 2SGAA 1S5SA 3MQKC 3OYPA 2XCFA 4YOGA 2KAIA 5DP8A 1EPTA 1KY9A 1P2NA 6GCHF 1KXDA 4DGJA 1C2GA 1G3BA 1TALA 2OLGA 3ATMA 4RN6A 2FM2A 1GVLA 3RM0H 2NU0E 4ABHA 4JMYA 5EODA 1UVPA 2Q6GA 1J14A 1FNIA 1P04A 1GWAA 5FL7D 3AW1A 4ZKNU 4LOYH 2ZPQA 4I8HA 2HLDD 1AB9B 2ZU2A 2Y6TA 1KXAA 3DFLA 4X0WU 1IQJA 1TOMH 1HIAA 5CHAC 3ZZ7A 3ESTA 1PPHE 1P8VC 2GT8A 3A81A 3HATH 4FUHA 2QIQA 4GHTA 1XUHA 3RXTA 2VIDA 3GCTG 4LK4A 5EPNA 3BEUA 3SJKA 4JCNA 4Q80A 2XW9A 2ZPRA 2PKAA 1SQTA 3H7OA 3SNDA 2R0KA 2FOMB 1QGFA 4WMEA 1C5YB 3MH5A 1ZTJA 4ISNA 2I6SA 3KQEA 1AUJA 3N7OA 2J97A 4DT4A 4Y71A 1O2QA 1YM0A 2OK5A 1SLXB 2O9QA 1TNKA 1C2EA 1BIOA 2Y5FA 3F0OA 2A4RA 3KYFA 1ELGA 1L1JA 1OOKB 3GY2A 1KLIH 3UOPA 5HXFA 5FX5A 3ZVAA 3MOCA 5C5OA 4WY3A 4X8TH 3SU2A 1SPJA 1SGIB 1AFQB 4RSPA 1HUTH 1DICA 3LGUA 2V35A 2CK3D 2SFAA 4R0IA 1JBUH 5F8ZA 4AGKA 1LHDH 1FY4A 2JH0D 1P09A 1MABB 4KP0A 4DIIH 1F0TA 3CNRA 1QL8A 2A31A 4OM9A 4MPVA 1ZGIA 4ISOA 5I46H 5C0TA 2OBQA 2ZGCA 2XNIA 5EJ1A 4Y8ZA 1UVOA 1MBQA 1RTKA 1GCTB 4Q7XA 2TGAA 1AMHA 1J16A 1SGNE 1MAXA 3A8BA 1P2JA 2BVXH 1P3EA 4NA7A 2GCTB 4U2WA 5DP3A 1Y3WA 2CHAC 4ZROA 1BBRE 1W3CA 1ANCA 3F2HA 3KHVA 1BT7A 1SB1H 2ZFTA 3RXIA 4NFEA 5T6FA 4YO9A 1F7ZA 2RCEA 2NWNA 2QXJA 2VINA 1TGTA 1YBWA 1JXPA 2VIVA 1ABIH 2HPQH 1AFEH 1QBVH 1WAYB 1GL1A 2GV7A 3ZZ6A 1C1OA 2AGEX 1V2PT 1O0DH 5AFZH
chains in the Genus database with same CATH topology
1O2UA 2ODYB 4GUXA 1O2GH 3I77A 4IC5A 1MKXH 2YNBA 2GZ8A 2Z3CA 5GCHF 2FMJA 2GGVB 3SUEA 4XDEA 3UR6A 2P8OC 1C4U2 1P12E 1ZHRA 1Z6JH 2Z94A 2B9LA 1AVXA 1TGBA 1SGRE 2VIQA 3H5CB 5T6GA 3S9AA 1GGDB 1NZQH 1XVMA 3SQEE 3BTEE 3MH6A 4ZAEA 1RJXB 2BX4A 1SR5C 1KXCA 5HYOA 1F5RA 2AGIX 1K9OE 2FPZA 1MTWA 2THFB 2UWLA 4DJZB 3B9FH 1G36A 1A3EH 2C3SA 2GV6A 2PGBB 2ZFSA 1HNEE 3H7TA 1YPEH 3MU8A 1AQ7A 5EOKA 5ETXA 1IQGA 2PSYA 1RTFB 2BHGA 4DURA 1BMMH 1A5HA 3MTYA 4M7GA 2QGRA 1ESTA 4O97A 4ABFA 1LVBA 5C20A 1NFUA 4A1VA 2FS9A 2LPRA 2W3KA 4YESB 1RRKA 1MKWK 3P8FA 3RM2H 1Z8GA 1T8NA 1E34B 2VVCA 4A1XA 1ZRKA 1ANEA 1ANBA 3T29A 3TVJB 2FLRH 2ZU4A 5E2PA 4IN2A 1EOJA 1P05A 2BD2A 5C3NA 3HKIB 1VITH 4Q7ZA 3VEQB 2ASUB 4XOJA 4LZ4B 2A7JA 5AF9H 1YKTA 5AFYH 1VGCC 3A7XA 1NRRH 3PM3A 3UFAA 2ZDVH 1O30A 1O3GA 3RU4D 3GDVA 1UCYK 2A2QH 1SGFA 1O36A 1FUJA 2ZHDA 1EP6A 2EA3A 2HNTF 3TH2H 4DOQA 1QIXB 3BG4C 4OS2A 1E38B 1ZHPA 1AU8A 2B0FA 4ESTE 2VIOA 1HCGA 2JH6D 6LPRA 1C9TA 1TYNA 1DUAA 2UWPA 3GY3A 2ZGXH 1HJAC 3P92A 2V3HH 1CA0B 1OPHB 5GDSH 2A7HA 3F9HA 3ZVDA 5BRRE 2FIRH 1GJBB 1ELVA 3EE0B 1C1TA 1WU1A 1DVAH 1SMFE 3DA9B 1FY3A 5ESTE 3Q76A 5C1UA 1TNJA 3A7TA 1TNLA 3MO9A 4X2YA 1KTTB 5F8TA 1SLUB 3ZVBA 1SGTA 3SGAE 4CR9A 1P2MA 1ANDA 4J1YA 1HAVB 7GCHG 1XUFA 3TJUA 4ABJA 2SGFE 1GHAG 2O8UA 2VWOA 1UJ1A 1WUNH 2D26C 3TGIE 4Q2KA 2D1JA 1L4DA 1W11U 2OQUA 3ZZ4A 3ENSB 4HGCA 1LKBA 4X6NA 2OQ5A 3BF6H 2OC8A 5A0AE 3A84A 1NTPA 2ZF0H 1S6HA 8GCHF 1ZOMA 4NIXA 1P02A 1S0RA 4MNYA 1NC6A 2G52A 1P57B 2BDIA 1QBNA 2IJOB 1P01A 3TGKE 1QFKH 1GHBF 1K22H 1S85A 2PLXA 1KLJH 1GDUA 2DE9A 2TPIZ 1HAYB 3L3TA 1EAIA 3F6UH 1LHEH 3T28A 1F92A 1N6YA 1MTVA 1VCPA 1GMHF 4YT7H 4X2XA 2XC5A 1SGQE 3ZVCA 1BCUH 1BQYA 1MUEB 2ANKH 3CP7A 4MNVA 1NU7B 1FAXA 1DE7H 2VGCC 2GX4A 1O2WA 2FI4E 1O2JA 4CBOA 1V2LT 1O2MA 4BTTB 2WPLS 2XRCA 4B1TA 3L33A 1OX1A 1UTNA 1J15A 3ITIA 1DLEA 2J4IA 1MZDA 3KL6A 5C67A 4IBLH 3RXHA 3A80A 3M7TA 2ZKSA 1DWEH 2QXHA 3KQDA 3RXQA 5A2MH 4CH8B 3VXEH 2F83A 3URDA 3W94A 4KTSA 1DSUA 2VH0A 3BTWE 1UHBB 3UNSA 2WUCA 1O2YA 2SGPE 1C1RA 1C5MD 2ZGBH 3TLOA 1NRNH 4DY7B 1NROH 3HPTB 4ZUHA 1Z1JA 3AASA 2ZDMA 1WTGH 1RFNA 4BAOB 3TK5A 1T8OA 1PPBH 1BHXF 1TMUH 4AOQA 4A6LA 4CRGA 1O5BB 2PGQB 4AORA 3TJVA 1O33A 5JPMH 4AZ2B 4NGAH 4KKDA 4TPIZ 2VWLA 3GCHC 1BTPA 1NM6A 1O5FH 1V2WT 1AKSB 2GT7A 1A5IA 1V2VT 1IQMA 1TGSZ 2UUFB 2ZCHP 4H4FA 4J2YB 2ZPSA 1N1LA 1NN6A 1S84A 2FX6A 1LCYA 2QV1A 5E2OA 2FOCA 2ZA5A 2PTCE 3BTFE 1LVYA 1NPMA 2ZDNA 3D62A 1C5VA 2FWWA 2QXIA 4FUCA 1YPHC 4BOHA 2PSXA 2A4GA 4AFUA 3PLKA 1GBCA 2UUYA 1RTLA 2QA9E 1KYNA 2Y7XA 3BIUH 3V12A 1M9UA 3MHWU 1GI6A 4E7RG 1LHFH 2NU2E 4BAKB 1ORFA 5K0HA 3S7HB 1MTUA 2GTBA 5DK1A 2XBYA 1DUEA 1HXFH 1TQ7B 4MQAA 1GJ8B 1ELTA 2EI6A 5F03A 3E6PH 1NT1A 3ZZCA 1ARCA 3MMGA 1P3CA 7LPRA 1BDAA 1QR3E 1DANH 2TBSA 4CRAA 2Z9LA 1NESE 4ZKRU 1GMCF 1GI7B 1C5NH 1EZQA 3GY5A 3E1XB 1BRBE 3L6PA 1YF4A 1IAUA 4H6SB 5EXLA 4D8NA 5CE1A 2STBE 3PMHB 1DXWA 1FMGA 5FXLA 2P16A 1FXYA 5E0HA 3SNCA 2BTCE 1W13U 2VWNA 1CT4E 2BQ6B 2A4OA 3UY9A 1L2EA 8LPRA 3SU3A 1LPGB 4FU8A 3IITA 2XTTB 3EAJA 3CENA 1E36B 1O3IA 3QWCH 1LHGH 1O2RA 3VB5A 2JKHA 1MU6B 4JK5A 4CHAB 1IQLA 1J17T 1O2IA 1UTJA 1ELDE 2XWBI 1VITF 2VB0A 4XBDA 3S7KB 2OBOA 1W7GH 4TPYA 1OWHA 1HAZB 3SV6A 2GDDA 3O8DA 3MNBA 1V3XA 1UTMA 1H9LB 2QCYA 1FDPA 1WOFA 1Y3UA 1O39A 1YCPK 3SJOA 1O5GH 1ZJDA 1K2I1 2TRMA 1MTSA 1RD3B 3BTTE 1BJVA 2VIPA 2GVFA 4YOJA 1TX6A 4KGAA 4ISLA 4Z0KA 1CBWC 2XBWA 2GD4B 1A2CH 3FAOA 1B7XB 1BRCE 1CHGA 1S6FA 2Q6FA 4UEHH 4ZHLU 4UONA 1ZPZA 3HK6B 1ZZZA 3SBKA 3SV9A 1PPGE 1GL0E 4IC6A 1GI2A 2ZTYA 4CBNA 1BRUP 1GI9B 9LPRA 1HYLA 1FPHH 2ZZUH 3A8AA 1A4WH 1EAXA 1K21H 3RXGA 2PR3A 1W2KH 6GCHG 1MQ6A 2A5IA 4YT6H 3MU4A 3U69H 1XUJA 3SN8A 1EUFA 1A61H 3I78A 1AWHB 1SGYE 2BLWA 2TGTA 1GBAA 4PROA 1ETSH 3PB1E 1C4Y2 2C4FH 1NRSH 1C2KA 2BOHB 2GP9B 1F0SA 5C2ZA 1VCWA 3F9EA 1A46H 2HNTC 5CMXH 3V0XA 4Q7YA 1QCPA 4U30A 3SNBA 1CE5A 1HGTH 1KLTA 3BEIB 4UE7H 1H1BA 5C1XA 4AFZA 3R3GB 1NY22 2W7SA 5DPAA 1TNGA 3P8NA 1ID5H 5CHAB 1DS2E 5A8XA 1HAVA 1WTHD 3OSYA 4NA9H 3UNRA 3VGCC 1O3BA 3Q3YA 3UIRA 2AERH 2DUCA 3P8OA 2GMTC 3S69A 2JH5D 1HV7A 1QQUA 1IHTH 3FANA 3FFGA 5DKMA 5EXNA 4OGYA 3RXAA 3MU1A 3LOXA 2Y80A 3TNSA 1JRSA 4LXBH 5HMAA 3LT3A 1AVWA 2GZ7A 5AVDA 3RU4T 1TPOA 2AS9A 3V13A 1PYTD 1SLVB 1D3QB 4FUIA 2G8TA 3F9FA 2Z9IA 3M5MA 2A45B 2BVRH 1FAKH 2WYGA 5L2YH 2ZQ2A 2LNCA 2PKSC 3T5FH 1HJ8A 1Y5BT 2TGPZ 3FZZA 3PYHA 2GZ9A 4B74A 4GAWA 1BBRH 1C1VH 2NU3E 1T4VH 1AO5A 3ZZBA 2Z9GA 4JK6A 4FUBA 2J2UA 1ZHMA 1NRQH 1QQ4A 4FUEA 1X7AC 1TNIA 4K60A 1DWCH 4OS6A 3K65B 2BX3A 5LGOA 1GI8B 2VU8E 8KME2 3ZZ3A 4MNWA 3E0PB 1ZYOA 2A0QB 4OGXA 1HBTH 4AN7A 1J9CH 1LQDB 3BIVH 2C90B 2R2MB 3QUMP 4FUDA 4X6MA 4ZXYH 3NUMA 2F3CE 1GJDB 2CHAB 1DT2A 3FP6E 2H2ZA 1LHCH 1YPMH 3LH1A 7ESTE 5FHTA 3M5NA 1XX9A 1GG6C 1O3EA 1SI5H 1C1QA 3TGJE 3A8CA 5GIBA 3M3VA 4U01A 3M3TA 3F9GA 1UHBA 5EXMA 1V2NT 3RLYH 4OS4A 2HRVA 4JZ1A 2BDYA 1XKAC 2AYWA 3KEEA 3KN2A 3S9CA 1A0LA 5SGAE 5FAHA 3RXPA 2A1DB 2FO9A 1THSH 4TWWA 5GCHG 1C9PA 5LH8A 1XM1A 3RMLH 2BOKA 1C5PA 1EP5A 1GHYH 4IGDA 1KIGH 1F0UA 2BYAX 2JETC 2ZIQH 5HM2A 1C1WH 2TIOA 2P8OB 3OY6U 3SV2H 2A5KA 3LGYA 1O3PB 1P10A 2OCVB 2F9UA 3SI4H 5J4SA 3SQHE 1VCQA 3PLBA 1A3BH 4WXVA 3F1SB 2YNAA 1O3OA 1AKSA 1O5EH 5FBIA 2STAE 1TFXA 1FN6A 1CQQA 2WPJS 3SOSA 2H9EH 4BAQB 1GI3A 4IMQA 4NZQA 1GBEA 2FX4A 1SGFG 2ZU5A 3ELAH 5ESBA 1DOJA 1T31A 2ZHFH 3Q3XA 3PWCA 4ASHA 4X1SU 5FX6A 2Z6BD 2GDEH 4JZEH 3A8DA 3NKKA 1QURH 2R0LA 1EASA 4HZHA 3O8RA 2O8WA 3P95A 1FY5A 1QBOA 1MTNC 2BY7X 2BD5A 1BMAA 1TRYA 5JBCS 4NWKA 2M5TA 1OWKA 4DVAU 3KCGH 3WY8A 1GJ7B 2CJIA 4IW4E 1SL3A 4DIHH 1C2FA 2ZDLA 4B2BA 3DFJA 5L2ZH 3KGPA 4LZ1H 2OC1A 2FYQA 3QTOH 1EJMA 2QF3A 3SV8A 1MMJN 3RXFA 1PPFE 1XUKA 2C8WB 2BD8A 1LO6A 3FP8E 2C8XB 2QAAA 1WCZA 1VGCB 4FVDA 1TABE 3M7QA 1PQAA 2BDAA 1HLTH 2BY6X 2ZO3H 1QHRB 1YP9A 1CU1A 2WPIS 4INLA 4WWYA 3ZYEA 1TONA 2BLQA 4ZMAH 3MH7A 5DP5A 3UWJH 1BJUA 1O3FA 4FU9A 4MPWA 3RXMA 3BG4B 1UCYH 2BDBA 1Z8IB 1NFXA 3MU5A 2H6MA 4MNXA 4MPXA 3FP7E 2IN2A 3RC4A 6CHAC 2P3TB 5JYIA 1FY8E 2PV9B 1V2RT 1HJAB 1P03A 2FI3E 4ABIA 1Z1IA 1TRNA 4NA8A 1DX5M 2R3YA 1MCTA 3LGIA 3VFEA 3EYDA 5JBTA 3DHKH 4HI3A 4JYVH 1F2SE 1IQKA 1ZGVA 3AAUA 3ZVFA 4I8JA 3TJNA 3RXCA 2XBVA 1UVSH 4X1PU 3LH3A 4E06H 3RLWH 1UTPA 3OX7U 4OS1A 4OS5A 4K8BA 2O8LA 2Z9KA 2PUXB 2ZFPH 1O37A 3HGNA 1O3LA 4UFEH 2VH6A 3LGVA 3UNQA 2HGTH 4NIVA 1G37A 1QY6A 1UCYE 5LPEA 1GBHA 1PJPA 4WMDA 3RU4E 1AD8H 2F9PA 1N8OC 1S81A 8GCHG 1O2TA 3P8GA 4THNH 4X2VA 2ZECA 1GHXH 2J95A 3QX5H 5L30H 1BMNH 1P2KA 1GHBG 3MFJA 1BTHH 3HKJB 1SC8U 3MYWA 4HTCH 3ZZAA 1G2LA 1S0QA 1YPKH 4A5TS 1G32B 3RMOH 5A0CA 1EAWA 3E91A 1EPTC 3TK6A 1L4ZA 5GWZA 1MAYA 1K1MA 1XVOA 2FOGA 3SU0A 1GBJA 3EA9A 3SUFA 1GMHG 1TWXB 3MNSA 1QJ7B 1JOUB 2G81E 3UR9A 2CGAA 2ZHEH 1GI4A 4WH8A 4B75A 1G30B 2P93A 3VXFH 3V7TA 3PTNA 1F5LA 3TK9A 1LPKB 2PTNA 2Q6DA 2WPHS 2WYJA 2P3UB 1WQVH 2VGCB 4INKA 1LQEA 2W5EA 3TIUA 3RC5A 1OP2A 1CT2E 3MU0A 1K1NA 1GJ6A 3NXPA 1HXEH 1BTWA 2DE8A 2ZHQH 1KTSB 3SGQE 3U8TH 1ABJH 2J92A 4FXGH 1K1IA 3A87A 3RXUA 3RXBA 1ETRH 3U9AH 5GXPA 2BQWB 3DT0H 1C5XB 1C1UH 1GJCB 1Q2WA 1ZTKA 3M35A 4ZHAA 5AHGH 4AB9A 3HGPA 1ZMJA 4I32A 2CXVA 4I7YH 4ISHH 1KXEA 1W0YH 2ILNA 2FOEA 1H9HE 3TU7H 3MNCA 2FOHA 2F9BH 3V3MA 1ZLRA 2B8OH 1SHHB 4FVBA 3EA7A 1O2NA 4ISIH 4Y8YA 1MCVA 1L1NA 3GCHB 4ABDA 1ESAA 4FUFA 1AI8H 2ZFFH 4BAMB 1PPEE 1SBWA 1IQEA 1Z6EA 3Q00A 4CRBA 2XC0A 1HAIH 1DY8A 1KDQB 4TY7A 1SQOA 3AW0A 2FTMA 1FY1A 1A1RA 1DFPA 2SGEE 2G51A 4A7IB 2ZDKA 1YPGH 3M61U 1DWBH 1V2KT 1B0FA 4MLFB 3OU0A 2QN5T 1C5RA 3A82A 4B2CA 5DP7A 3UTUH 3T62A 5EPYA 1GBMA 2V3OH 4KELA 1AGJA 1PQ7A 2Z3EA 1ETTH 1J8AA 2R2WU 1Q3XA 3T2NA 2WV5A 1GJ9B 4E7NA 3PO1C 2HOBA 3BTQE 4FU7A 1LMWB 4SGBE 1YPHE 1P2IA 1O5AB 4YLQH 5JDUB 4K8YA 5FCKA 1QA0A 1YGCH 3E8LA 2SNVA 2BM2A 4YOIA 3QTVH 1ZTLA 1EOLA 1GMCG 2Y81A 3QO6A 1G3DA 3SJ9A 2FODA 1C5UA 2ZFRH 3ZV9A 4DG4A 5A09A 1EAUA 1O2XA 1YLCA 5EQQA 1C2JA 2W3IA 4B71A 1B5GH 1HAGE 3JZ2B 3RUOA 1Y3XA 2C8YB 1ZSLA 1C5TA 4IMZA 1P2QA 1WBGB 1G3CA 2VVUA 2XXLA 3T26A