2FIEA

Structure of human liver fbpase complexed with potent benzoxazole allosteric inhibitors
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
327
structure length
318
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Benzoxazole benzenesulfonamides as allosteric inhibitors of fructose-1,6-bisphosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase 1
total genus 98
structure length 318
sequence length 327
chains with identical sequence D, H, L
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2005-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2fieA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2fieA02
4GWYA 5ET7A 1FJ9A 4N81A 3RPLB 2QVVA 3IFAA 3IFCA 3B8BA 3KC1A 4HE1A 1IMAA 1XI6A 1NUWA 3A29A 4PTKA 4GX4A 1NV7A 2Q74A 1IMBA 4KXPA 1FPFA 2BJIA 2F3BA 3RYDA 2P3NA 1DBZA 5EYGA 2FIXA 5J16A 1FBDA 5IZ1A 1LEVA 1NV6A 1NV4A 4GWUA 3KC0A 2QFLA 1D9QA 4GWXA 5DW8A 2FVZA 1FBPA 1NV5A 5T3JA 4AS5A 4GX6A 2OWZA 1DCUA 2CZKA 1RDZA 5EQ8A 1FBGA 1G0IA 1JP4A 1K9ZA 1KA1A 1FBEA 2P3VA 1FPLA 1LBXA 4H46A 1IMDA 2FBPA 1LBWA 1EYKA 1RDXA 4HE2A 5IZ3B 1FSAA 3QMFA 1NV2A 2WEFA 1LBZA 1AWBA 3KBZA 1IMCA 1NUXA 5ET6A 1G0HA 1NUZA 2Y5LA 4HXVA 1KA0A 5ET8A 1FPGA 1FTAA 1QGXA 1FPDA 4GBVA 2WBDA 4O7IA 3FBPA 4H45A 5EQ7A 1IMEA 1SPIA 1K9YA 3RPLA 1CNQA 1NV0A 5ESYA 1VDWA 5EQAA 4GWZA 1FPBA 2CZIA 2Q8MA 5ET5A 3T0JA 1EYIA 3LUZA 2OX3A 4AS4A 2FIEA 1YXIA 5LDZA 5I3SA 4GWWA 4QXDA 4GWSA 4G61A 4HE0A 2R8TA 1LBYA 3ROJA 1FBHA 1NUYA 3D1RA 1FJ6A 1INPA 2WBBA 5EQ9A 3BIHA 2DDKA 2Y5KA 1KZ8A 1FPEA 5IZ3A 2F3DA 4I3EA 2QVRA 4IR8A 1EYJA 1LBVA 1FRPA 4GBWA 3BIGA 4MJOA 2FHYA 1FPJA 1FPKA 5FBPA 2JJKA 1DK4A 1Q9DA 5EYHA 1YZ0A 2CZHA 4GX3A 5F24A 1RDYA 4I3YA 1FBFA 1NI9A 1YYZA 3LV0A 2HHMA 2VT5A 1NV1A 5A5LA 1NV3A 2GQ1A 2PCRA 1FBCA 4FBPA 1BK4A 4I40A 2QVUA 1IMFA 1FPIA
chains in the Genus database with same CATH superfamily
3OSQA 5H8FB 4HTGA 4K3FA 1XOCA 5IKBA 1IXIA 3O29A 1DBZA 4F31B 1SDXA 2O69A 3KC0A 2DXYA 1A54A 3JZJA 3VVEA 4EQBA 4R6YA 1SYIA 2I49A 2CZKA 1RDZA 1DMBA 4H8JA 3IK6B 4R2FA 3RLFE 3T1BA 3K01A 4IGTA 3DELB 2WEFA 2X7PA 2O6AA 2A5TB 1JEVA 4PETA 1JW5A 1CE2A 1ELJA 3JV9A 4NN3A 4O7IA 1BIYA 1NL5A 5ESYA 3G3KA 1PEBA 3RTWB 2GHAA 4FJPA 2XXPA 3K6VA 1I69A 2QMXA 3EPEA 2HFBA 5I56B 1N7WA 5TPAB 4X04A 2HXRA 2OJTA 3RT6B 4F1UA 1SD3A 4U4SA 5L9MA 4F39A 4XF5A 3VLWA 3JYRA 5KZTA 3Q26A 4H5GA 4NF5A 4DI4B 4MJOA 1FTKA 3O9PA 4MNCA 5DEXB 2XD2A 4EQ7A 2DOJA 4GXSB 4GX3A 5CMMA 5I56A 1NI9A 3TTRA 2FA7A 4FE8A 3GXAA 2HHMA 2NXOA 1LAXA 4O3AA 4LONB 4GL0A 4FAJA 3U92A 1P1OA 4G68A 2B3BA 3EQ1A 1NV7A 5BUUA 3OENA 2BJIA 2F97A 2QMWA 4NTLA 2H5YA 4NF8B 3H6WA 2ZYNA 2QPQA 1DPPA 1Y3QA 4YKJA 4F18A 1ZIUA 1FBEA 1IMDA 3TTKA 4P8BA 2QSXA 3DLNA 1FSAA 1NV2A 1MM7A 4DXCA 1MPCA 2F5XA 3OEKA 1LB9A 4ISUA 1IMCA 5I59B 2FYIA 5EHMA 3PD9A 3GZGA 4NAPA 4GRKA 1MY0A 1MPBA 3OEMA 3PMXA 5H8NA 3R7XA 4H6DA 4WEDA 5KCJA 4JXIA 1TFAA 4OVJA 1M5FA 4NGUA 1UIUA 2WX9A 4KCCA 1MQIA 4QRZA 3M3FA 3T9XB 4GF8A 3T9HB 4AS4A 2RCAA 3N6UA 4NF6A 3OO6A 1Y4CA 2R8TA 3IB0A 3K1NA 3QSLA 3U8QA 1VSOA 3OMBA 1US5A 3MVWA 5IZ3A 1JVXA 4LZ8A 1XS5A 1B0LA 3EF7A 2Y7RA 4BDMA 2Z8FA 3U65A 2F78A 4LP2B 3U72A 3HFUA 4O8MA 4N6DA 4R75A 3TCFA 3TKDA 1M5EA 5B70A 3KBRA 5AA4B 2V4CA 3RPLB 4EDPA 3IFAA 3B8BA 3KC1A 4RPNA 4PE5B 1XI6A 3BBRA 1M5CA 2AYSA 2PYYA 1D9YA 5F1QA 3IO4A 4P0GA 4HCWA 4MIJA 3DP4A 4ZECA 3OELA 3KN8A 4JWXA 4R72A 1LBXA 4JSDA 3HN0A 2R6GE 1LFHA 4FEBA 4N4UA 3UORA 5BWJA 1N3XA 4LZ7A 1ZLQA 1G0HA 1I6AA 1NUZA 3IB2A 2G29A 4HW8A 1LBBA 5I59A 1MQHA 5H8QA 2DWIA 2PFZA 4ZEDA 3E13X 2RCBA 1UQWA 2P1SA 3O28A 4MCOA 3ZSFA 4AB5A 1EH3A 1B6HA 3C32A 2PVUA 4TQUQ 3SESA 4P3LA 4KPTA 2PT2A 3IJXB 4JDFA 4TLLB 5AA1A 1LCFA 4NF4B 1UTBB 3PMWA 1N76A 4EXKA 4PC9A 4ELPA 4G8NA 3KZGA 1BTJA 5F24A 1QVSA 4PDHA 2IEEA 4PTKA 4IO3A 2DE2A 5CMBA 4JB7A 4YMAA 5LOMA 1MY1A 1R9LA 4GFRA 2YLNA 4DLDA 3HPIA 1B5HA 4O94A 3LSXA 4QSCA 4RY1A 4NWDA 4PGPA 1NV4A 2P0SA 3PTYA 3RUMA 4XTCQ 1QKBA 1II5A 3TAJA 3VV5A 2W7YA 2OWTA 4ND9A 1B2HA 2DSFA 1Y4TA 1LBWA 2MKZA 4IO7A 2E1SA 2XX8A 5DVJA 4P9KA 1FPGA 4KYEA 1FTAA 3DP6A 5M2VA 2WBDA 4BDQA 5EQ7A 1WVJA 3VDFA 2R9JA 5FTIA 2DWJA 2DP8A 3FXQA 1LBCA 2GFEA 1MXVA 2GRVA 2QS1A 3M8UA 2VPOA 3H03A 3FVGA 3QXMA 2XXHA 2V3TA 4HE0A 1B58A 3MZ9A 5I5PA 3PPQA 2ZYKA 3UA8A 4UA8A 2DQVA 2XHDA 2FHYA 1A8FA 1N04A 5H8FA 2VPNA 2NWJA 2PMSA 1FQAA 3PPNA 1N7XA 3K1MA 1FBFA 4HCYA 3V83A 1EZPA 2QVUA 2XXRA 4YKIA 4OFLA 3SZPA 4QFLA 3Q28A 4U22A 2DWHA 4OFJA 4MEVA 1B40A 3W9VA 4QFKA 3E3KA 1Q35A 1JW1A 5HBCA 1IXCA 4NE4A 2WKYA 2F3BA 2ONKE 1JEUA 3PUYE 3KOTA 3MVYA 3MPKA 3T9UA 3CFXA 4P1EA 5DW8A 3PMVA 3OO9A 3UK4A 3ZKLA 2REGA 4DXBA 1Y9UA 5FHMA 2P3VA 1FPLA 1AL3A 4JWOA 4QF9A 5H8HA 1MY2A 2ABHA 2HAVA 4EUOA 5IZ3B 3K6WA 3KBZA 3CHGA 3FUZA 4EF2A 1NUXA 3KFMA 3CSGA 3E79A 4F2QA 2Q8JA 1SVXB 1AMFA 1LCTA 3HV1A 4GBVA 3FBPA 4NX1A 1Y1ZA 5I84A 3TELA 1J1NA 3HSTA 4OXVA 1OLCA 3MVZA 4KR5A 2I6EA 1NNKA 4YAHX 5AA2D 3FVOA 5H8NB 5I2KB 1SW1A 4G61A 3PUWE 1MXWA 3GLBA 4ELOA 3SERA 1FQBA 4HS7A 1UTBA 1LLSA 4H5FA 2F3DA 3K2DA 3QYTA 4LUBA 3S4UA 2LAOA 4ZEIA 3LBSA 3FJGA 4Z7EA 4QFOA 1P1NA 3QAXA 2CZHA 2ONRA 2OPDA 4ONYA 2VT5A 3RNNA 3BFUA 2PCRA 3MWBA 4ZZAA 3LSWA 3K00A 2QVVA 4ELRA 4F22A 5K2XA 3A09A 3LSFB 1RKMA 3IOTA 2KLFA 4IO4A 5DT6A 3FVKA 3FZVA 3HHGA 1VE4A 2I4CA 3O6GA 3C36A 2F34A 3C31A 3S9NC 4N07A 4GX6A 4LQ5A 4DZ1A 4PE3A 1HSEA 3MC2A 4YMBA 1FQFA 4PCDA 4LATA 3H3GA 4TOZA 1A40A 4YU0A 3FXBA 4NF5B 3O6IA 4G4PA 2ZZVA 4GIZA 2XWVA 1NFTA 2HZKA 4X8RA 3WAEA 1Y1MA 3QK6A 4NMYA 4OEUA 4H45A 2NVUB 1EZ9A 4QHQA 1K9YA 3CI8A 2E0SA 3MP6A 1B5JA 4L17A 1KWHA 1O7TA 1YPNA 5CMCA 2CZLA 1YXIA 3TTLA 2UVIA 4QXDA 4KI0E 1L5TA 5ITOA 1TWYA 1IXHA 3D1RA 3H7MA 1EZOA 2Y7WA 1DSNA 1P1WA 2UXAA 3BIHA 2DDKA 3FXRA 2P2AA 1EYJA 5HPQA 4G77A 4F2OA 2UVGA 1DK4A 3CRBA 1Q9DA 1NNPA 4GLIA 4YB7A 1MXYA 1D4NA 1YYZA 1ZJLA 3RQTA 4UACA 2XWIA 3O97A 4IO5A 1AIVA 1D9VA 3H06B 3N6TA 4FEDA 1P1QA 1N0TA 5L8DA 4DIGA 1IMAA 3NOHA 4GX4A 3MW0A 3RYDA 2THIA 4ESXA 5J16A 2PFYA 4XEQA 3B7DA 5IZZA 1LEVA 3FGSA 2QFLA 2ZYMA 2XWOA 1K9ZA 5F7VA 3PPPA 4NF0A 5K2YA 3VXCA 2WYKA 4E0WA 4EXLA 4Q8RA 4G8MA 4TLMB 1KA0A 1XVYA 4F3SA 5CRYA 3T22A 3PUVE 1SPIA 3DP8A 2X26A 3BKIB 5FTHA 4G8HA 4ZE9A 1LB8A 4NHBA 2Z8EA 5TU0A 1FTMA 4X9TA 1MQJA 5LDZA 3IOWA 4GOTA 4PFIA 1DPEA 3C9HA 4F3BA 3ISPA 3QUFA 2AL5A 1UIVA 1LBVA 5EYFA 2HAUA 3BIGA 3PU5A 4BDRA 4YB5A 1NKXA 5TPAA 2I48A 2VD3A 4KD5A 1FTOA 3UIFA 1OLAA 4FORA 1OMPA 1GGGA 3TUSA 1FJ9A 3W9WA 2DE4A 4KFQA 4OVPA 3H6TA 4OVSA 2I4BA 2DE3A 4F29A 2ALUA 4F19A 1R6ZA 5AA2B 4PAKA 3B6WA 2FVZA 1NV5A 4PP0A 3FJMA 2XXKA 4P11A 1FBGA 3GBBA 3K6UA 5J1DA 1SW4A 3EHUA 3A3CA 3FATA 3IORA 3V8XB 4C0RA 4P0IA 4OMBA 1MXUA 5JTYA 4PBHA 4KYDA 1FPDA 3VXBA 2ZZXA 3AXFA 4OWDA 3N26A 2Q8MA 5ET5A 4ECFA 5AE4A 1SI0A 3H6VA 3MBPA 1Y3PA 1QUKA 1MH4A 1UTHA 3KG2A 1D3KA 2XA5A 2O1MA 3KN7A 4NWCA 1PB8A 4JSOA 4RJZA 4PFTA 3K4UA 3MP1A 1B3EA 1B7HA 4OFOA 1B5IA 4WKMA 4MFIA 4IY5A 1VR5A 4OHNA 1LAGE 2GQ1A 4ZE8A 1R9QA 4I62A 5TP9B 3RPWA 1AH5A 1FPIA 2I3VA 5ET7A 5TP9A 1B7UA 4H0WA 1FQEA 1LFGA 5ISUA 4FIMA 4JVDA 4GWUA 2V25A 4OETA 4MH5A 1WDNA 5T3JA 3IO6A 4AS5A 5I58B 4O3CA 4QSDA 2OWZA 4F3PA 2RC8A 4GXAA 3G3GA 3VVFA 1VFDA 4KCDA 4THIA 3I3VA 2H98A 1Y20A 3B6QA 4QFPA 4RNSA 4BDNA 3QMFA 1HSLA 4LQ2A 1LBZA 2F7CA 1T0KA 3K02A 4MAGA 3FVNA 1OQGA 2B65A 4LN5A 2UYEA 2B4LA 1B51A 1NV0A 4MMPA 3UP9A 4F3GA 4GWZA 4DE8A 4N17A 4XKPA 1XHYA 1QJMA 3CFLA 4R2BA 2O68A 1I6QA 3C33A 2DVCA 1EU8A 1H44A 2ZMBA 3ECRA 4QBAA 1YCJA 3RY3A 4OENA 3BFTA 3S2VA 4ZDMA 1FRPA 3ILTB 1SW2A 3THIA 2H99A 3CSBA 4OA4A 5AA3A 1YZ0A 3VLVA 2V3QA 2F35A 1MQDA 3LV0A 2D5WA 5FHOA 4KHZE 4GL8A 3IB1A 4Z0IA 2DWAA 3SEWA 1S9TA 4DCXA 1MY4A 3D4GA 3TMGA 3TQWA 2WYPA 4M4GA 4PGNA 3KSXA 2XXIA 4ZEKA 1D9QA 3KJTA 4G68C 5EQ8A 2X7QA 1OQHA 3ILUB 2NUVA 1IQ7A 4RXLA 4P56A 1OVBA 4BDOA 1RDXA 4ESWA 4DXUA 3ZKKA 5KDTB 3MPLA 5I57A 3SETA 4HXVA 3TTMA 2REJA 1URSA 1QGXA 4H1XA 3FASA 4YKKA 1B32A 2ZNSA 3K0VA 4OTEA 2ANJA 4XXUA 3UGWA 1B9JA 1S7YA 3M3KA 2FIEA 5I2NA 4R73A 3MAMA 5H8QB 1NMUA 2QRYA 5EQ9A 5CMKA 2Q9TA 2DVZA 3FJ7A 4N8YA 4OEVA 1MY3A 2UYFA 2F8DA 1RYXA 1NH7A 2HQ0A 1FTJA 5AA4A 4YKPA 3EHTA 3B6TA 2P3NA 2QL3A 3K6XA 1IUDA 3MQ9A 2PX1A 4MLVA 2Z8DA 3HCQA 1B3GA 2QS3A 4QFNA 4EQ9A 1DOTA 1M5DA 3O66A 2XWKA 1DCUA 5I2NB 1G0IA 3TEPA 1KA1A 5JK4A 4H46A 3CG1A 3OOAA 4N8GA 4R6HA 1SI1A 4XFEA 1QULA 1Q1KA 3SEXA 2XXYA 2Y5LA 4O3BA 4R9GA 3CR9A 4I9DA 3LR1A 3O2AA 1FQDA 2AIXA 2KQZA 5I57B 4PBQA 1IMEA 3FV2A 2L5VA 4U21A 1YTVA 1MS7A 3T0JA 2ONSA 4U2RA 3PPRA 2XXXA 4PF8A 4ZEBA 1A7LA 4ZS9A 1USYH 2I58A 3VVDA 1ZMGA 4N91A 5ELVA 4PAIA 1VFEA 1PDAA 4OESA 1NUYA 2Q2CA 1FJ6A 3GBAA 3KN3A 2ZNUA 1F9BA 2RINA 2XX7A 5FBPA 4X1DA 1AOVA 1DTGA 4FATA 2UVJA 2O7UA 4N15A 1NV1A 5A5LA 2OPEA 4YICA 1FBCA 3I5OA 1BK4A 4I40A 2UVHA 3N94A 5L9SA 2V3UA 2CEXA 4GWYA 4OVRA 4N81A 4HE1A 2Q2AA 4Q30B 4IO6A 1NNTA 3A29A 1B3HA 1N84A 1P1UA 3OO8A 1IMBA 4KXPA 3W15C 1DTZA 4NF4A 1MDQA 3QIMA 2FIXA 3RGYA 5CBRA 5IZ1A 3V89B 4N13A 3I6VA 3O6HA 3SDFA 4RK9A 2BJJX 4OANA 1A8EA 3LSLA 2VOZA 3EHSA 5KDTA 5DYHA 2OK2A 3DM0A 2ZXTA 3CG3A 2RKMA 3H6UA 3IL1B 1B46A 4NQ8A 2AL4A 5LTCA 3U94A 3IAZA 1B4HA 1BLFA 2Y84A 1GR2A 1ZBMA 5ICTA 1SQYA 3G7WA 2Q88A 1QW0A 5I3SA 3CFZA 3RT8A 3PGFA 1POY1 3T9VA 1IIWA 5CM6A 2Q89A 2Y7KA 3ROJA 1FBHA 4MNPA 2V84A 2A5TA 3SEVA 3MUQA 1FPEA 4I3EA 4IR8A 2HPGA 2VHAA 2JJKA 4O7MA 1SW5A 4BDLA 4H65A 3MJNA 4I3YA 1QUIA 1MPDA 2NOOA 3Q25A 1LAHE 3IR1A 4RYAA 1PBQA 4R6KA 2D21A 5ICQA 4AB6A 2XXQA 1NUWA 1B52A 4E0XA 5I7IA 4GD5A 2Y7PA 4OZ9A 2QJEA 4KQPA 5A5XB 4YZZA 1O64A 1FBPA 4RA1A 1FQCA 3EKIA 3S9EA 1QUJA 3K1PA 4U1OA 4RPOA 4PQJA 1XC1A 3TPAA 1GV8A 5DVIA 5I58A 4F1YA 1A99A 4PAFA 1RYOA 2D3IA 5JTYB 3B50A 2HEUA 2H9BA 2H4IA 3OXNA 4IB2A 1FPBA 3PD8A 1EYIA 1JVYA 3T96B 3LUZA 3C35A 3OD7A 2OX3A 1R1NA 2DS9A 4IY6A 3D4CA 3E4RA 2B4MA 2XXTA 3L6HA 2QS2A 4POWA 3KSJA 1JNFA 4LZ5A 1FCKA 4GVOA 4R74A 4P47A 1INPA 4OYVA 4ZZEA 3CIJA 3KEIA 5FHNA 2Y5KA 1KZ8A 1P99A 3P7IA 3R26A 1H45A 2RC9A 4ELQA 1Z7ME 4PFYA 1URGA 5IM2A 3IOUA 3GYYA 2VP1A 4OVQA 3IJOB 3USDA 4FBPA 1TT1A 1B05A 2F6GA 5IGAA 3E9XA 3LC8A 1MDP1 2PBWA 4X48A 1O63A 1SYHA 1FTLA 2XD3A 2XXUA 4GWOA 3M3LA 3PV0E 3OO7A 1IXGA 3Q29A 1JP4A 4XIGQ 2Z23A 3TYHA 1B0HA 4ZEFA 2FBPA 3MVXA 4MBPA 1M5BA 1EYKA 1BKAA 2GHBA 3F11A 4MF3A 4LVQA 3R6UA 1XVXA 3HHFA 1PC3A 5ET6A 1URDA 3T66A 5ET8A 3PUZE 3IX1A 1MM6A 4KYSA 2R71A 1MXXA 1PBPA 4N6KA 5IAIA 4M1VA 1B4ZA 1B1HA 4XKRA 1B7ZA 4RK2A 4F1VA 5CBSA 2OZZA 4MHFA 1H43A 2O7IA 3FD3A 3MZ1A 3G3HA 3OSRA 4GWSA 4AQ4A 3TFLA 1NH8A 1LBYA 1I6BA 4DDDA 3TZAA 1GVCA 3KOSA 3MP8A 3IOVA 2OLBA 3TTNA 1LAFE 4BLAA 1FPKA 2IA4A 3TODA 4OVTA 2HZLA 1US4A 5EYHA 1JQFA 1OVTA 2F7BA 4FECA 3ONMA 2I0CA 4GQOA 3KJ7A 3ODBA 5EHSA 3TQLA 4EF1A 1ATGA 4OERA 1MXZA 1MG1A 1FPFA 3N5LA 3SEYA 3S9MC 1IEJA 1FBDA 1NV6A 1LSTA 2YJPA 2DYXA 4C1UA 4GWXA 3LUYA 2F36A 5B7DA 2RF1A 3VLUA 3HO7A 4U4XA 2HXWA 3G3FA 4U23A 3SEUA 1UTHB 4H8IA 4I1DA 3TCGA 5H8SA 2GH9A 3SKPA 3RN8A 2A5SA 1ZTYA 4PFWA 4LA9A 4MLQA 1YAEA 5KCJB 2PT1A 1CNQA 1QKAA 1GTKA 3FXUA 2CMOA 3C34A 4P1LA 3FIRA 1VDWA 3U93A 2XXVA 5EQAA 2RC7A 4YB6A 2ZNTA 4PDDA 2HCAA 2OCUA 3PUXE 5A5XA 4N6PA 4DCYA 5HM4B 4X1BA 4R9FA 3Q27A 2O84X 4POXA 2F7AA 1N3WA 3L6GA 1TFDA 5DTBA 3TCHA 2QVRA 1FPJA 5CI5A 1PB7A 1B3LA 1LGBC 2YPNA 4C1TA 3QUJA 4NF8A 4XKQA 4G2ZA 2ZZWA 4PFBA 5AA2A 1JETA 1NNFA 1B1XA 3T93B 2H25A 1USYE 4H67A 3CVGA 3IFCA 2Q74A 4JVCA 4NF6B 2I3WA 5EYGA 4PFRA 2ZYOA 4PF6A 2F6PA 1B3FA 1POTA 4NG7A 5DVFA 5ITPA 4JVIA 3MSTA 3EN3A 4OQOA 3MZBA 2VD2A 1MRPA 2Y7IA 4WXJA 1S50A 1TXFA 1HSJA 3G3JA 1XT8A 4JBZA 1A55A 4I8CA 1JW4A 1WODA 4U1ZA 2OBGA 2XXWA 4HE2A 1MQGA 1FW0A 3TDJA 2O1LA 1MH3A 3V5AA 1AWBA 3PPOA 4IO2A 3S9LC 2V93A 2M8CA 4Q0CA 1SBPA 1Y3NA 1IZ1A 4XKNA 2VGQA 3ZS6A 1H76A 4Q5TA 3RPLA 2Z22A 3VE1B 1OIBA 2CEYA 1PB9A 1ANFA 2CZIA 2XX9A 4JWYA 2FNCA 2OWSA 1Z7NE 5H8HB 1BP5A 2QS4A 4UABA 4GWWA 1ZU0A 5CC2A 1CB6A 3VFJA 3KGCA 2KR0A 3G3IA 4G68B 3E78A 4IGRA 4DI3D 3UN6A 3C4MA 2WBBA 5L9OA 3U1OA 2DXRA 1LFIA 4WEPA 3RTFB 4GBWA 3A3UA 5DEXA 3WAFA 1ZKBA 3H4ZA 5JEIA 1RDYA 4MNIA 1IITA 4MX6A 2I0BA 3FV1A 4NEDA 2O51A 2ESNA 1H3DA 4QSEA 1NV3A 2B3FA 5I2KA 4PFUA 3MYUA 1IMFA 2G93A
chains in the Genus database with same CATH topology
4GWYA 5ET7A 4OVRA 1FJ9A 4N81A 3RPLB 2V4CA 3W9WA 2QVVA 3IFAA 2DE4A 3IFCA 3B8BA 3KC1A 4HE1A 4MEVA 1IMAA 4OVPA 1XI6A 1NUWA 3A29A 4PTKA 3NOHA 4GX4A 1NV7A 2Q74A 4OVSA 3W9VA 5I7IA 4JVCA 1IMBA 4KXPA 2DE3A 1FPFA 4JVDA 2BJIA 2F3BA 2WYPA 3RYDA 4O94A 2P3NA 1DBZA 5EYGA 4PFRA 4F19A 4PF6A 2FIXA 5J16A 2PFYA 1FBDA 4PGNA 4NG7A 4XEQA 5IZZA 5IZ1A 1LEVA 1NV6A 4PAKA 1NV4A 4GWUA 3MSTA 4JVIA 3KC0A 2QPQA 2QFLA 4PC9A 4PGPA 4YZZA 4P1EA 1D9QA 3PTYA 4GWXA 5DW8A 4OANA 2FVZA 1FBPA 1NV5A 5T3JA 4AS5A 4GX6A 4HCWA 4MIJA 2XWKA 2OWZA 2XWOA 1DCUA 2CZKA 1RDZA 5EQ8A 3EKIA 4PE3A 2XXKA 1FBGA 1G0IA 1JP4A 5J1DA 4F18A 1K9ZA 1KA1A 4PCDA 1FBEA 2P3VA 1FPLA 1LBXA 4H46A 5JK4A 4P56A 1IMDA 4N8GA 4NF0A 2FBPA 1LBWA 4P8BA 3FXBA 1EYKA 1RDXA 4HE2A 5IZ3B 2MKZA 2WYKA 4N4UA 3T1BA 1FSAA 3QMFA 1NV2A 4XFEA 2ZZVA 2WEFA 2F5XA 1LBZA 1AWBA 3KBZA 2XWVA 3CHGA 1IMCA 1NUXA 5ET6A 1G0HA 4P9KA 4PETA 1NUZA 2Y5LA 2HZKA 4HXVA 1KA0A 4MAGA 4PBHA 5ET8A 3E79A 1FPGA 4NQ8A 4NAPA 5LTCA 4NN3A 1FTAA 4LN5A 1QGXA 4X8RA 1FPDA 4GBVA 2KQZA 4PAFA 2WBDA 2ZZXA 4O7IA 3FBPA 2B4LA 4NX1A 4H45A 5EQ7A 3B50A 4PBQA 1IMEA 1SPIA 1K9YA 3RPLA 2PFZA 1CNQA 2CEYA 1NV0A 5ESYA 4MMPA 4N6KA 4P1LA 1VDWA 2L5VA 5EQAA 4GWZA 1FPBA 2CZIA 4M1VA 4N17A 2Q8MA 4MCOA 4NHBA 5ET5A 3T0JA 4NGUA 1EYIA 2WX9A 4PDDA 3LUZA 3SZPA 4F1VA 2OX3A 4AS4A 2FIEA 4UABA 1YXIA 2VPOA 4X04A 4X9TA 4PF8A 2HXRA 5LDZA 5I3SA 4P3LA 4MHFA 4GWWA 4QXDA 2B4MA 4N91A 4GWSA 4G61A 4HE0A 4F1UA 5CM6A 2R8TA 2KR0A 4PAIA 4PFIA 3E78A 4DI3D 1LBYA 3ROJA 1FBHA 2XA5A 1NUYA 4MNPA 4XF5A 3D1RA 3ISPA 1FJ6A 4QBAA 4P47A 1INPA 2WBBA 5EQ9A 3BIHA 2DDKA 5I5PA 2Y5KA 4DI4B 1KZ8A 1FPEA 5IZ3A 2F3DA 4I3EA 2QVRA 4IR8A 1EYJA 1LBVA 1FRPA 4GBWA 2HPGA 3BIGA 4MJOA 2FHYA 1FPJA 1FPKA 5FBPA 2JJKA 2Q9TA 4O7MA 4OVTA 4MNCA 2HZLA 1DK4A 2VPNA 2DVZA 1Q9DA 5EYHA 4OA4A 1YZ0A 2CZHA 3U65A 4GX3A 5F24A 2V3QA 1RDYA 4I3YA 1FBFA 4MNIA 1NI9A 4MX6A 1YYZA 4HCYA 4N8YA 5IM2A 3GYYA 3HFUA 3LV0A 4N15A 2HHMA 2XWIA 2VT5A 1NV1A 2ZZWA 4O8MA 4N6DA 4OVQA 5A5LA 1NV3A 2GQ1A 2PCRA 1FBCA 4FBPA 4PDHA 4PFBA 1BK4A 4YICA 4I40A 2QVUA 3MYUA 1IMFA 5IGAA 1FPIA 2CEXA 2DE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GWY A;  5ET7 A;  1FJ9 A;  4N81 A;  3RPL B;  2QVV A;  3IFA A;  3IFC A;  3B8B A;  3KC1 A;  4HE1 A;  1IMA A;  1XI6 A;  1NUW A;  3A29 A;  4PTK A;  4GX4 A;  1NV7 A;  2Q74 A;  1IMB A;  4KXP A;  1FPF A;  2BJI A;  2F3B A;  3RYD A;  2P3N A;  1DBZ A;  5EYG A;  2FIX A;  5J16 A;  1FBD A;  5IZ1 A;  1LEV A;  1NV6 A;  1NV4 A;  4GWU A;  3KC0 A;  2QFL A;  1D9Q A;  4GWX A;  5DW8 A;  2FVZ A;  1FBP A;  1NV5 A;  5T3J A;  4AS5 A;  4GX6 A;  2OWZ A;  1DCU A;  2CZK A;  1RDZ A;  5EQ8 A;  1FBG A;  1G0I A;  1JP4 A;  1K9Z A;  1KA1 A;  1FBE A;  2P3V A;  1FPL A;  1LBX A;  4H46 A;  1IMD A;  2FBP A;  1LBW A;  1EYK A;  1RDX A;  4HE2 A;  5IZ3 B;  1FSA A;  3QMF A;  1NV2 A;  2WEF A;  1LBZ A;  1AWB A;  3KBZ A;  1IMC A;  1NUX A;  5ET6 A;  1G0H A;  1NUZ A;  2Y5L A;  4HXV A;  1KA0 A;  5ET8 A;  1FPG A;  1FTA A;  1QGX A;  1FPD A;  4GBV A;  2WBD A;  4O7I A;  3FBP A;  4H45 A;  5EQ7 A;  1IME A;  1SPI A;  1K9Y A;  3RPL A;  1CNQ A;  1NV0 A;  5ESY A;  1VDW A;  5EQA A;  4GWZ A;  1FPB A;  2CZI A;  2Q8M A;  5ET5 A;  3T0J A;  1EYI A;  3LUZ A;  2OX3 A;  4AS4 A;  2FIE A;  1YXI A;  5LDZ A;  5I3S A;  4GWW A;  4QXD A;  4GWS A;  4G61 A;  4HE0 A;  2R8T A;  1LBY A;  3ROJ A;  1FBH A;  1NUY A;  3D1R A;  1FJ6 A;  1INP A;  2WBB A;  5EQ9 A;  3BIH A;  2DDK A;  2Y5K A;  1KZ8 A;  1FPE A;  5IZ3 A;  2F3D A;  4I3E A;  2QVR A;  4IR8 A;  1EYJ A;  1LBV A;  1FRP A;  4GBW A;  3BIG A;  4MJO A;  2FHY A;  1FPJ A;  1FPK A;  5FBP A;  2JJK A;  1DK4 A;  1Q9D A;  5EYH A;  1YZ0 A;  2CZH A;  4GX3 A;  5F24 A;  1RDY A;  4I3Y A;  1FBF A;  1NI9 A;  1YYZ A;  3LV0 A;  2HHM A;  2VT5 A;  1NV1 A;  5A5L A;  1NV3 A;  2GQ1 A;  2PCR A;  1FBC A;  4FBP A;  1BK4 A;  4I40 A;  2QVU A;  1IMF A;  1FPI A; 
#chains in the Genus database with same CATH topology
 3OSQ A;  5H8F B;  4HTG A;  4K3F A;  1XOC A;  5IKB A;  1IXI A;  3O29 A;  1DBZ A;  4F31 B;  1SDX A;  2O69 A;  3KC0 A;  2DXY A;  1A54 A;  3JZJ A;  3VVE A;  4EQB A;  4R6Y A;  1SYI A;  2I49 A;  2CZK A;  1RDZ A;  1DMB A;  4H8J A;  3IK6 B;  4R2F A;  3RLF E;  3T1B A;  3K01 A;  4IGT A;  3DEL B;  2WEF A;  2X7P A;  2O6A A;  2A5T B;  1JEV A;  4PET A;  1JW5 A;  1CE2 A;  1ELJ A;  3JV9 A;  4NN3 A;  4O7I A;  1BIY A;  1NL5 A;  5ESY A;  3G3K A;  1PEB A;  3RTW B;  2GHA A;  4FJP A;  2XXP A;  3K6V A;  1I69 A;  2QMX A;  3EPE A;  2HFB A;  5I56 B;  1N7W A;  5TPA B;  4X04 A;  2HXR A;  2OJT A;  3RT6 B;  4F1U A;  1SD3 A;  4U4S A;  5L9M A;  4F39 A;  4XF5 A;  3VLW A;  3JYR A;  5KZT A;  3Q26 A;  4H5G A;  4NF5 A;  4DI4 B;  4MJO A;  1FTK A;  3O9P A;  4MNC A;  5DEX B;  2XD2 A;  4EQ7 A;  2DOJ A;  4GXS B;  4GX3 A;  5CMM A;  5I56 A;  1NI9 A;  3TTR A;  2FA7 A;  4FE8 A;  3GXA A;  2HHM A;  2NXO A;  1LAX A;  4O3A A;  4LON B;  4GL0 A;  4FAJ A;  3U92 A;  1P1O A;  4G68 A;  2B3B A;  3EQ1 A;  1NV7 A;  5BUU A;  3OEN A;  2BJI A;  2F97 A;  2QMW A;  4NTL A;  2H5Y A;  4NF8 B;  3H6W A;  2ZYN A;  2QPQ A;  1DPP A;  1Y3Q A;  4YKJ A;  4F18 A;  1ZIU A;  1FBE A;  1IMD A;  3TTK A;  4P8B A;  2QSX A;  3DLN A;  1FSA A;  1NV2 A;  1MM7 A;  4DXC A;  1MPC A;  2F5X A;  3OEK A;  1LB9 A;  4ISU A;  1IMC A;  5I59 B;  2FYI A;  5EHM A;  3PD9 A;  3GZG A;  4NAP A;  4GRK A;  1MY0 A;  1MPB A;  3OEM A;  3PMX A;  5H8N A;  3R7X A;  4H6D A;  4WED A;  5KCJ A;  4JXI A;  1TFA A;  4OVJ A;  1M5F A;  4NGU A;  1UIU A;  2WX9 A;  4KCC A;  1MQI A;  4QRZ A;  3M3F A;  3T9X B;  4GF8 A;  3T9H B;  4AS4 A;  2RCA A;  3N6U A;  4NF6 A;  3OO6 A;  1Y4C A;  2R8T A;  3IB0 A;  3K1N A;  3QSL A;  3U8Q A;  1VSO A;  3OMB A;  1US5 A;  3MVW A;  5IZ3 A;  1JVX A;  4LZ8 A;  1XS5 A;  1B0L A;  3EF7 A;  2Y7R A;  4BDM A;  2Z8F A;  3U65 A;  2F78 A;  4LP2 B;  3U72 A;  3HFU A;  4O8M A;  4N6D A;  4R75 A;  3TCF A;  3TKD A;  1M5E A;  5B70 A;  3KBR A;  5AA4 B;  2V4C A;  3RPL B;  4EDP A;  3IFA A;  3B8B A;  3KC1 A;  4RPN A;  4PE5 B;  1XI6 A;  3BBR A;  1M5C A;  2AYS A;  2PYY A;  1D9Y A;  5F1Q A;  3IO4 A;  4P0G A;  4HCW A;  4MIJ A;  3DP4 A;  4ZEC A;  3OEL A;  3KN8 A;  4JWX A;  4R72 A;  1LBX A;  4JSD A;  3HN0 A;  2R6G E;  1LFH A;  4FEB A;  4N4U A;  3UOR A;  5BWJ A;  1N3X A;  4LZ7 A;  1ZLQ A;  1G0H A;  1I6A A;  1NUZ A;  3IB2 A;  2G29 A;  4HW8 A;  1LBB A;  5I59 A;  1MQH A;  5H8Q A;  2DWI A;  2PFZ A;  4ZED A;  3E13 X;  2RCB A;  1UQW A;  2P1S A;  3O28 A;  4MCO A;  3ZSF A;  4AB5 A;  1EH3 A;  1B6H A;  3C32 A;  2PVU A;  4TQU Q;  3SES A;  4P3L A;  4KPT A;  2PT2 A;  3IJX B;  4JDF A;  4TLL B;  5AA1 A;  1LCF A;  4NF4 B;  1UTB B;  3PMW A;  1N76 A;  4EXK A;  4PC9 A;  4ELP A;  4G8N A;  3KZG A;  1BTJ A;  5F24 A;  1QVS A;  4PDH A;  2IEE A;  4PTK A;  4IO3 A;  2DE2 A;  5CMB A;  4JB7 A;  4YMA A;  5LOM A;  1MY1 A;  1R9L A;  4GFR A;  2YLN A;  4DLD A;  3HPI A;  1B5H A;  4O94 A;  3LSX A;  4QSC A;  4RY1 A;  4NWD A;  4PGP A;  1NV4 A;  2P0S A;  3PTY A;  3RUM A;  4XTC Q;  1QKB A;  1II5 A;  3TAJ A;  3VV5 A;  2W7Y A;  2OWT A;  4ND9 A;  1B2H A;  2DSF A;  1Y4T A;  1LBW A;  2MKZ A;  4IO7 A;  2E1S A;  2XX8 A;  5DVJ A;  4P9K A;  1FPG A;  4KYE A;  1FTA A;  3DP6 A;  5M2V A;  2WBD A;  4BDQ A;  5EQ7 A;  1WVJ A;  3VDF A;  2R9J A;  5FTI A;  2DWJ A;  2DP8 A;  3FXQ A;  1LBC A;  2GFE A;  1MXV A;  2GRV A;  2QS1 A;  3M8U A;  2VPO A;  3H03 A;  3FVG A;  3QXM A;  2XXH A;  2V3T A;  4HE0 A;  1B58 A;  3MZ9 A;  5I5P A;  3PPQ A;  2ZYK A;  3UA8 A;  4UA8 A;  2DQV A;  2XHD A;  2FHY A;  1A8F A;  1N04 A;  5H8F A;  2VPN A;  2NWJ A;  2PMS A;  1FQA A;  3PPN A;  1N7X A;  3K1M A;  1FBF A;  4HCY A;  3V83 A;  1EZP A;  2QVU A;  2XXR A;  4YKI A;  4OFL A;  3SZP A;  4QFL A;  3Q28 A;  4U22 A;  2DWH A;  4OFJ A;  4MEV A;  1B40 A;  3W9V A;  4QFK A;  3E3K A;  1Q35 A;  1JW1 A;  5HBC A;  1IXC A;  4NE4 A;  2WKY A;  2F3B A;  2ONK E;  1JEU A;  3PUY E;  3KOT A;  3MVY A;  3MPK A;  3T9U A;  3CFX A;  4P1E A;  5DW8 A;  3PMV A;  3OO9 A;  3UK4 A;  3ZKL A;  2REG A;  4DXB A;  1Y9U A;  5FHM A;  2P3V A;  1FPL A;  1AL3 A;  4JWO A;  4QF9 A;  5H8H A;  1MY2 A;  2ABH A;  2HAV A;  4EUO A;  5IZ3 B;  3K6W A;  3KBZ A;  3CHG A;  3FUZ A;  4EF2 A;  1NUX A;  3KFM A;  3CSG A;  3E79 A;  4F2Q A;  2Q8J A;  1SVX B;  1AMF A;  1LCT A;  3HV1 A;  4GBV A;  3FBP A;  4NX1 A;  1Y1Z A;  5I84 A;  3TEL A;  1J1N A;  3HST A;  4OXV A;  1OLC A;  3MVZ A;  4KR5 A;  2I6E A;  1NNK A;  4YAH X;  5AA2 D;  3FVO A;  5H8N B;  5I2K B;  1SW1 A;  4G61 A;  3PUW E;  1MXW A;  3GLB A;  4ELO A;  3SER A;  1FQB A;  4HS7 A;  1UTB A;  1LLS A;  4H5F A;  2F3D A;  3K2D A;  3QYT A;  4LUB A;  3S4U A;  2LAO A;  4ZEI A;  3LBS A;  3FJG A;  4Z7E A;  4QFO A;  1P1N A;  3QAX A;  2CZH A;  2ONR A;  2OPD A;  4ONY A;  2VT5 A;  3RNN A;  3BFU A;  2PCR A;  3MWB A;  4ZZA A;  3LSW A;  3K00 A;  2QVV A;  4ELR A;  4F22 A;  5K2X A;  3A09 A;  3LSF B;  1RKM A;  3IOT A;  2KLF A;  4IO4 A;  5DT6 A;  3FVK A;  3FZV A;  3HHG A;  1VE4 A;  2I4C A;  3O6G A;  3C36 A;  2F34 A;  3C31 A;  3S9N C;  4N07 A;  4GX6 A;  4LQ5 A;  4DZ1 A;  4PE3 A;  1HSE A;  3MC2 A;  4YMB A;  1FQF A;  4PCD A;  4LAT A;  3H3G A;  4TOZ A;  1A40 A;  4YU0 A;  3FXB A;  4NF5 B;  3O6I A;  4G4P A;  2ZZV A;  4GIZ A;  2XWV A;  1NFT A;  2HZK A;  4X8R A;  3WAE A;  1Y1M A;  3QK6 A;  4NMY A;  4OEU A;  4H45 A;  2NVU B;  1EZ9 A;  4QHQ A;  1K9Y A;  3CI8 A;  2E0S A;  3MP6 A;  1B5J A;  4L17 A;  1KWH A;  1O7T A;  1YPN A;  5CMC A;  2CZL A;  1YXI A;  3TTL A;  2UVI A;  4QXD A;  4KI0 E;  1L5T A;  5ITO A;  1TWY A;  1IXH A;  3D1R A;  3H7M A;  1EZO A;  2Y7W A;  1DSN A;  1P1W A;  2UXA A;  3BIH A;  2DDK A;  3FXR A;  2P2A A;  1EYJ A;  5HPQ A;  4G77 A;  4F2O A;  2UVG A;  1DK4 A;  3CRB A;  1Q9D A;  1NNP A;  4GLI A;  4YB7 A;  1MXY A;  1D4N A;  1YYZ A;  1ZJL A;  3RQT A;  4UAC A;  2XWI A;  3O97 A;  4IO5 A;  1AIV A;  1D9V A;  3H06 B;  3N6T A;  4FED A;  1P1Q A;  1N0T A;  5L8D A;  4DIG A;  1IMA A;  3NOH A;  4GX4 A;  3MW0 A;  3RYD A;  2THI A;  4ESX A;  5J16 A;  2PFY A;  4XEQ A;  3B7D A;  5IZZ A;  1LEV A;  3FGS A;  2QFL A;  2ZYM A;  2XWO A;  1K9Z A;  5F7V A;  3PPP A;  4NF0 A;  5K2Y A;  3VXC A;  2WYK A;  4E0W A;  4EXL A;  4Q8R A;  4G8M A;  4TLM B;  1KA0 A;  1XVY A;  4F3S A;  5CRY A;  3T22 A;  3PUV E;  1SPI A;  3DP8 A;  2X26 A;  3BKI B;  5FTH A;  4G8H A;  4ZE9 A;  1LB8 A;  4NHB A;  2Z8E A;  5TU0 A;  1FTM A;  4X9T A;  1MQJ A;  5LDZ A;  3IOW A;  4GOT A;  4PFI A;  1DPE A;  3C9H A;  4F3B A;  3ISP A;  3QUF A;  2AL5 A;  1UIV A;  1LBV A;  5EYF A;  2HAU A;  3BIG A;  3PU5 A;  4BDR A;  4YB5 A;  1NKX A;  5TPA A;  2I48 A;  2VD3 A;  4KD5 A;  1FTO A;  3UIF A;  1OLA A;  4FOR A;  1OMP A;  1GGG A;  3TUS A;  1FJ9 A;  3W9W A;  2DE4 A;  4KFQ A;  4OVP A;  3H6T A;  4OVS A;  2I4B A;  2DE3 A;  4F29 A;  2ALU A;  4F19 A;  1R6Z A;  5AA2 B;  4PAK A;  3B6W A;  2FVZ A;  1NV5 A;  4PP0 A;  3FJM A;  2XXK A;  4P11 A;  1FBG A;  3GBB A;  3K6U A;  5J1D A;  1SW4 A;  3EHU A;  3A3C A;  3FAT A;  3IOR A;  3V8X B;  4C0R A;  4P0I A;  4OMB A;  1MXU A;  5JTY A;  4PBH A;  4KYD A;  1FPD A;  3VXB A;  2ZZX A;  3AXF A;  4OWD A;  3N26 A;  2Q8M A;  5ET5 A;  4ECF A;  5AE4 A;  1SI0 A;  3H6V A;  3MBP A;  1Y3P A;  1QUK A;  1MH4 A;  1UTH A;  3KG2 A;  1D3K A;  2XA5 A;  2O1M A;  3KN7 A;  4NWC A;  1PB8 A;  4JSO A;  4RJZ A;  4PFT A;  3K4U A;  3MP1 A;  1B3E A;  1B7H A;  4OFO A;  1B5I A;  4WKM A;  4MFI A;  4IY5 A;  1VR5 A;  4OHN A;  1LAG E;  2GQ1 A;  4ZE8 A;  1R9Q A;  4I62 A;  5TP9 B;  3RPW A;  1AH5 A;  1FPI A;  2I3V A;  5ET7 A;  5TP9 A;  1B7U A;  4H0W A;  1FQE A;  1LFG A;  5ISU A;  4FIM A;  4JVD A;  4GWU A;  2V25 A;  4OET A;  4MH5 A;  1WDN A;  5T3J A;  3IO6 A;  4AS5 A;  5I58 B;  4O3C A;  4QSD A;  2OWZ A;  4F3P A;  2RC8 A;  4GXA A;  3G3G A;  3VVF A;  1VFD A;  4KCD A;  4THI A;  3I3V A;  2H98 A;  1Y20 A;  3B6Q A;  4QFP A;  4RNS A;  4BDN A;  3QMF A;  1HSL A;  4LQ2 A;  1LBZ A;  2F7C A;  1T0K A;  3K02 A;  4MAG A;  3FVN A;  1OQG A;  2B65 A;  4LN5 A;  2UYE A;  2B4L A;  1B51 A;  1NV0 A;  4MMP A;  3UP9 A;  4F3G A;  4GWZ A;  4DE8 A;  4N17 A;  4XKP A;  1XHY A;  1QJM A;  3CFL A;  4R2B A;  2O68 A;  1I6Q A;  3C33 A;  2DVC A;  1EU8 A;  1H44 A;  2ZMB A;  3ECR A;  4QBA A;  1YCJ A;  3RY3 A;  4OEN A;  3BFT A;  3S2V A;  4ZDM A;  1FRP A;  3ILT B;  1SW2 A;  3THI A;  2H99 A;  3CSB A;  4OA4 A;  5AA3 A;  1YZ0 A;  3VLV A;  2V3Q A;  2F35 A;  1MQD A;  3LV0 A;  2D5W A;  5FHO A;  4KHZ E;  4GL8 A;  3IB1 A;  4Z0I A;  2DWA A;  3SEW A;  1S9T A;  4DCX A;  1MY4 A;  3D4G A;  3TMG A;  3TQW A;  2WYP A;  4M4G A;  4PGN A;  3KSX A;  2XXI A;  4ZEK A;  1D9Q A;  3KJT A;  4G68 C;  5EQ8 A;  2X7Q A;  1OQH A;  3ILU B;  2NUV A;  1IQ7 A;  4RXL A;  4P56 A;  1OVB A;  4BDO A;  1RDX A;  4ESW A;  4DXU A;  3ZKK A;  5KDT B;  3MPL A;  5I57 A;  3SET A;  4HXV A;  3TTM A;  2REJ A;  1URS A;  1QGX A;  4H1X A;  3FAS A;  4YKK A;  1B32 A;  2ZNS A;  3K0V A;  4OTE A;  2ANJ A;  4XXU A;  3UGW A;  1B9J A;  1S7Y A;  3M3K A;  2FIE A;  5I2N A;  4R73 A;  3MAM A;  5H8Q B;  1NMU A;  2QRY A;  5EQ9 A;  5CMK A;  2Q9T A;  2DVZ A;  3FJ7 A;  4N8Y A;  4OEV A;  1MY3 A;  2UYF A;  2F8D A;  1RYX A;  1NH7 A;  2HQ0 A;  1FTJ A;  5AA4 A;  4YKP A;  3EHT A;  3B6T A;  2P3N A;  2QL3 A;  3K6X A;  1IUD A;  3MQ9 A;  2PX1 A;  4MLV A;  2Z8D A;  3HCQ A;  1B3G A;  2QS3 A;  4QFN A;  4EQ9 A;  1DOT A;  1M5D A;  3O66 A;  2XWK A;  1DCU A;  5I2N B;  1G0I A;  3TEP A;  1KA1 A;  5JK4 A;  4H46 A;  3CG1 A;  3OOA A;  4N8G A;  4R6H A;  1SI1 A;  4XFE A;  1QUL A;  1Q1K A;  3SEX A;  2XXY A;  2Y5L A;  4O3B A;  4R9G A;  3CR9 A;  4I9D A;  3LR1 A;  3O2A A;  1FQD A;  2AIX A;  2KQZ A;  5I57 B;  4PBQ A;  1IME A;  3FV2 A;  2L5V A;  4U21 A;  1YTV A;  1MS7 A;  3T0J A;  2ONS A;  4U2R A;  3PPR A;  2XXX A;  4PF8 A;  4ZEB A;  1A7L A;  4ZS9 A;  1USY H;  2I58 A;  3VVD A;  1ZMG A;  4N91 A;  5ELV A;  4PAI A;  1VFE A;  1PDA A;  4OES A;  1NUY A;  2Q2C A;  1FJ6 A;  3GBA A;  3KN3 A;  2ZNU A;  1F9B A;  2RIN A;  2XX7 A;  5FBP A;  4X1D A;  1AOV A;  1DTG A;  4FAT A;  2UVJ A;  2O7U A;  4N15 A;  1NV1 A;  5A5L A;  2OPE A;  4YIC A;  1FBC A;  3I5O A;  1BK4 A;  4I40 A;  2UVH A;  3N94 A;  5L9S A;  2V3U A;  2CEX A;  4GWY A;  4OVR A;  4N81 A;  4HE1 A;  2Q2A A;  4Q30 B;  4IO6 A;  1NNT A;  3A29 A;  1B3H A;  1N84 A;  1P1U A;  3OO8 A;  1IMB A;  4KXP A;  3W15 C;  1DTZ A;  4NF4 A;  1MDQ A;  3QIM A;  2FIX A;  3RGY A;  5CBR A;  5IZ1 A;  3V89 B;  4N13 A;  3I6V A;  3O6H A;  3SDF A;  4RK9 A;  2BJJ X;  4OAN A;  1A8E A;  3LSL A;  2VOZ A;  3EHS A;  5KDT A;  5DYH A;  2OK2 A;  3DM0 A;  2ZXT A;  3CG3 A;  2RKM A;  3H6U A;  3IL1 B;  1B46 A;  4NQ8 A;  2AL4 A;  5LTC A;  3U94 A;  3IAZ A;  1B4H A;  1BLF A;  2Y84 A;  1GR2 A;  1ZBM A;  5ICT A;  1SQY A;  3G7W A;  2Q88 A;  1QW0 A;  5I3S A;  3CFZ A;  3RT8 A;  3PGF A;  1POY 1;  3T9V A;  1IIW A;  5CM6 A;  2Q89 A;  2Y7K A;  3ROJ A;  1FBH A;  4MNP A;  2V84 A;  2A5T A;  3SEV A;  3MUQ A;  1FPE A;  4I3E A;  4IR8 A;  2HPG A;  2VHA A;  2JJK A;  4O7M A;  1SW5 A;  4BDL A;  4H65 A;  3MJN A;  4I3Y A;  1QUI A;  1MPD A;  2NOO A;  3Q25 A;  1LAH E;  3IR1 A;  4RYA A;  1PBQ A;  4R6K A;  2D21 A;  5ICQ A;  4AB6 A;  2XXQ A;  1NUW A;  1B52 A;  4E0X A;  5I7I A;  4GD5 A;  2Y7P A;  4OZ9 A;  2QJE A;  4KQP A;  5A5X B;  4YZZ A;  1O64 A;  1FBP A;  4RA1 A;  1FQC A;  3EKI A;  3S9E A;  1QUJ A;  3K1P A;  4U1O A;  4RPO A;  4PQJ A;  1XC1 A;  3TPA A;  1GV8 A;  5DVI A;  5I58 A;  4F1Y A;  1A99 A;  4PAF A;  1RYO A;  2D3I A;  5JTY B;  3B50 A;  2HEU A;  2H9B A;  2H4I A;  3OXN A;  4IB2 A;  1FPB A;  3PD8 A;  1EYI A;  1JVY A;  3T96 B;  3LUZ A;  3C35 A;  3OD7 A;  2OX3 A;  1R1N A;  2DS9 A;  4IY6 A;  3D4C A;  3E4R A;  2B4M A;  2XXT A;  3L6H A;  2QS2 A;  4POW A;  3KSJ A;  1JNF A;  4LZ5 A;  1FCK A;  4GVO A;  4R74 A;  4P47 A;  1INP A;  4OYV A;  4ZZE A;  3CIJ A;  3KEI A;  5FHN A;  2Y5K A;  1KZ8 A;  1P99 A;  3P7I A;  3R26 A;  1H45 A;  2RC9 A;  4ELQ A;  1Z7M E;  4PFY A;  1URG A;  5IM2 A;  3IOU A;  3GYY A;  2VP1 A;  4OVQ A;  3IJO B;  3USD A;  4FBP A;  1TT1 A;  1B05 A;  2F6G A;  5IGA A;  3E9X A;  3LC8 A;  1MDP 1;  2PBW A;  4X48 A;  1O63 A;  1SYH A;  1FTL A;  2XD3 A;  2XXU A;  4GWO A;  3M3L A;  3PV0 E;  3OO7 A;  1IXG A;  3Q29 A;  1JP4 A;  4XIG Q;  2Z23 A;  3TYH A;  1B0H A;  4ZEF A;  2FBP A;  3MVX A;  4MBP A;  1M5B A;  1EYK A;  1BKA A;  2GHB A;  3F11 A;  4MF3 A;  4LVQ A;  3R6U A;  1XVX A;  3HHF A;  1PC3 A;  5ET6 A;  1URD A;  3T66 A;  5ET8 A;  3PUZ E;  3IX1 A;  1MM6 A;  4KYS A;  2R71 A;  1MXX A;  1PBP A;  4N6K A;  5IAI A;  4M1V A;  1B4Z A;  1B1H A;  4XKR A;  1B7Z A;  4RK2 A;  4F1V A;  5CBS A;  2OZZ A;  4MHF A;  1H43 A;  2O7I A;  3FD3 A;  3MZ1 A;  3G3H A;  3OSR A;  4GWS A;  4AQ4 A;  3TFL A;  1NH8 A;  1LBY A;  1I6B A;  4DDD A;  3TZA A;  1GVC A;  3KOS A;  3MP8 A;  3IOV A;  2OLB A;  3TTN A;  1LAF E;  4BLA A;  1FPK A;  2IA4 A;  3TOD A;  4OVT A;  2HZL A;  1US4 A;  5EYH A;  1JQF A;  1OVT A;  2F7B A;  4FEC A;  3ONM A;  2I0C A;  4GQO A;  3KJ7 A;  3ODB A;  5EHS A;  3TQL A;  4EF1 A;  1ATG A;  4OER A;  1MXZ A;  1MG1 A;  1FPF A;  3N5L A;  3SEY A;  3S9M C;  1IEJ A;  1FBD A;  1NV6 A;  1LST A;  2YJP A;  2DYX A;  4C1U A;  4GWX A;  3LUY A;  2F36 A;  5B7D A;  2RF1 A;  3VLU A;  3HO7 A;  4U4X A;  2HXW A;  3G3F A;  4U23 A;  3SEU A;  1UTH B;  4H8I A;  4I1D A;  3TCG A;  5H8S A;  2GH9 A;  3SKP A;  3RN8 A;  2A5S A;  1ZTY A;  4PFW A;  4LA9 A;  4MLQ A;  1YAE A;  5KCJ B;  2PT1 A;  1CNQ A;  1QKA A;  1GTK A;  3FXU A;  2CMO A;  3C34 A;  4P1L A;  3FIR A;  1VDW A;  3U93 A;  2XXV A;  5EQA A;  2RC7 A;  4YB6 A;  2ZNT A;  4PDD A;  2HCA A;  2OCU A;  3PUX E;  5A5X A;  4N6P A;  4DCY A;  5HM4 B;  4X1B A;  4R9F A;  3Q27 A;  2O84 X;  4POX A;  2F7A A;  1N3W A;  3L6G A;  1TFD A;  5DTB A;  3TCH A;  2QVR A;  1FPJ A;  5CI5 A;  1PB7 A;  1B3L A;  1LGB C;  2YPN A;  4C1T A;  3QUJ A;  4NF8 A;  4XKQ A;  4G2Z A;  2ZZW A;  4PFB A;  5AA2 A;  1JET A;  1NNF A;  1B1X A;  3T93 B;  2H25 A;  1USY E;  4H67 A;  3CVG A;  3IFC A;  2Q74 A;  4JVC A;  4NF6 B;  2I3W A;  5EYG A;  4PFR A;  2ZYO A;  4PF6 A;  2F6P A;  1B3F A;  1POT A;  4NG7 A;  5DVF A;  5ITP A;  4JVI A;  3MST A;  3EN3 A;  4OQO A;  3MZB A;  2VD2 A;  1MRP A;  2Y7I A;  4WXJ A;  1S50 A;  1TXF A;  1HSJ A;  3G3J A;  1XT8 A;  4JBZ A;  1A55 A;  4I8C A;  1JW4 A;  1WOD A;  4U1Z A;  2OBG A;  2XXW A;  4HE2 A;  1MQG A;  1FW0 A;  3TDJ A;  2O1L A;  1MH3 A;  3V5A A;  1AWB A;  3PPO A;  4IO2 A;  3S9L C;  2V93 A;  2M8C A;  4Q0C A;  1SBP A;  1Y3N A;  1IZ1 A;  4XKN A;  2VGQ A;  3ZS6 A;  1H76 A;  4Q5T A;  3RPL A;  2Z22 A;  3VE1 B;  1OIB A;  2CEY A;  1PB9 A;  1ANF A;  2CZI A;  2XX9 A;  4JWY A;  2FNC A;  2OWS A;  1Z7N E;  5H8H B;  1BP5 A;  2QS4 A;  4UAB A;  4GWW A;  1ZU0 A;  5CC2 A;  1CB6 A;  3VFJ A;  3KGC A;  2KR0 A;  3G3I A;  4G68 B;  3E78 A;  4IGR A;  4DI3 D;  3UN6 A;  3C4M A;  2WBB A;  5L9O A;  3U1O A;  2DXR A;  1LFI A;  4WEP A;  3RTF B;  4GBW A;  3A3U A;  5DEX A;  3WAF A;  1ZKB A;  3H4Z A;  5JEI A;  1RDY A;  4MNI A;  1IIT A;  4MX6 A;  2I0B A;  3FV1 A;  4NED A;  2O51 A;  2ESN A;  1H3D A;  4QSE A;  1NV3 A;  2B3F A;  5I2K A;  4PFU A;  3MYU A;  1IMF A;  2G93 A; 
#chains in the Genus database with same CATH homology
 4GWY A;  5ET7 A;  4OVR A;  1FJ9 A;  4N81 A;  3RPL B;  2V4C A;  3W9W A;  2QVV A;  3IFA A;  2DE4 A;  3IFC A;  3B8B A;  3KC1 A;  4HE1 A;  4MEV A;  1IMA A;  4OVP A;  1XI6 A;  1NUW A;  3A29 A;  4PTK A;  3NOH A;  4GX4 A;  1NV7 A;  2Q74 A;  4OVS A;  3W9V A;  5I7I A;  4JVC A;  1IMB A;  4KXP A;  2DE3 A;  1FPF A;  4JVD A;  2BJI A;  2F3B A;  2WYP A;  3RYD A;  4O94 A;  2P3N A;  1DBZ A;  5EYG A;  4PFR A;  4F19 A;  4PF6 A;  2FIX A;  5J16 A;  2PFY A;  1FBD A;  4PGN A;  4NG7 A;  4XEQ A;  5IZZ A;  5IZ1 A;  1LEV A;  1NV6 A;  4PAK A;  1NV4 A;  4GWU A;  3MST A;  4JVI A;  3KC0 A;  2QPQ A;  2QFL A;  4PC9 A;  4PGP A;  4YZZ A;  4P1E A;  1D9Q A;  3PTY A;  4GWX A;  5DW8 A;  4OAN A;  2FVZ A;  1FBP A;  1NV5 A;  5T3J A;  4AS5 A;  4GX6 A;  4HCW A;  4MIJ A;  2XWK A;  2OWZ A;  2XWO A;  1DCU A;  2CZK A;  1RDZ A;  5EQ8 A;  3EKI A;  4PE3 A;  2XXK A;  1FBG A;  1G0I A;  1JP4 A;  5J1D A;  4F18 A;  1K9Z A;  1KA1 A;  4PCD A;  1FBE A;  2P3V A;  1FPL A;  1LBX A;  4H46 A;  5JK4 A;  4P56 A;  1IMD A;  4N8G A;  4NF0 A;  2FBP A;  1LBW A;  4P8B A;  3FXB A;  1EYK A;  1RDX A;  4HE2 A;  5IZ3 B;  2MKZ A;  2WYK A;  4N4U A;  3T1B A;  1FSA A;  3QMF A;  1NV2 A;  4XFE A;  2ZZV A;  2WEF A;  2F5X A;  1LBZ A;  1AWB A;  3KBZ A;  2XWV A;  3CHG A;  1IMC A;  1NUX A;  5ET6 A;  1G0H A;  4P9K A;  4PET A;  1NUZ A;  2Y5L A;  2HZK A;  4HXV A;  1KA0 A;  4MAG A;  4PBH A;  5ET8 A;  3E79 A;  1FPG A;  4NQ8 A;  4NAP A;  5LTC A;  4NN3 A;  1FTA A;  4LN5 A;  1QGX A;  4X8R A;  1FPD A;  4GBV A;  2KQZ A;  4PAF A;  2WBD A;  2ZZX A;  4O7I A;  3FBP A;  2B4L A;  4NX1 A;  4H45 A;  5EQ7 A;  3B50 A;  4PBQ A;  1IME A;  1SPI A;  1K9Y A;  3RPL A;  2PFZ A;  1CNQ A;  2CEY A;  1NV0 A;  5ESY A;  4MMP A;  4N6K A;  4P1L A;  1VDW A;  2L5V A;  5EQA A;  4GWZ A;  1FPB A;  2CZI A;  4M1V A;  4N17 A;  2Q8M A;  4MCO A;  4NHB A;  5ET5 A;  3T0J A;  4NGU A;  1EYI A;  2WX9 A;  4PDD A;  3LUZ A;  3SZP A;  4F1V A;  2OX3 A;  4AS4 A;  2FIE A;  4UAB A;  1YXI A;  2VPO A;  4X04 A;  4X9T A;  4PF8 A;  2HXR A;  5LDZ A;  5I3S A;  4P3L A;  4MHF A;  4GWW A;  4QXD A;  2B4M A;  4N91 A;  4GWS A;  4G61 A;  4HE0 A;  4F1U A;  5CM6 A;  2R8T A;  2KR0 A;  4PAI A;  4PFI A;  3E78 A;  4DI3 D;  1LBY A;  3ROJ A;  1FBH A;  2XA5 A;  1NUY A;  4MNP A;  4XF5 A;  3D1R A;  3ISP A;  1FJ6 A;  4QBA A;  4P47 A;  1INP A;  2WBB A;  5EQ9 A;  3BIH A;  2DDK A;  5I5P A;  2Y5K A;  4DI4 B;  1KZ8 A;  1FPE A;  5IZ3 A;  2F3D A;  4I3E A;  2QVR A;  4IR8 A;  1EYJ A;  1LBV A;  1FRP A;  4GBW A;  2HPG A;  3BIG A;  4MJO A;  2FHY A;  1FPJ A;  1FPK A;  5FBP A;  2JJK A;  2Q9T A;  4O7M A;  4OVT A;  4MNC A;  2HZL A;  1DK4 A;  2VPN A;  2DVZ A;  1Q9D A;  5EYH A;  4OA4 A;  1YZ0 A;  2CZH A;  3U65 A;  4GX3 A;  5F24 A;  2V3Q A;  1RDY A;  4I3Y A;  1FBF A;  4MNI A;  1NI9 A;  4MX6 A;  1YYZ A;  4HCY A;  4N8Y A;  5IM2 A;  3GYY A;  3HFU A;  3LV0 A;  4N15 A;  2HHM A;  2XWI A;  2VT5 A;  1NV1 A;  2ZZW A;  4O8M A;  4N6D A;  4OVQ A;  5A5L A;  1NV3 A;  2GQ1 A;  2PCR A;  1FBC A;  4FBP A;  4PDH A;  4PFB A;  1BK4 A;  4YIC A;  4I40 A;  2QVU A;  3MYU A;  1IMF A;  5IGA A;  1FPI A;  2CEX A;  2DE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...