2FIEA

Structure of human liver fbpase complexed with potent benzoxazole allosteric inhibitors
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
327
structure length
318
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Benzoxazole benzenesulfonamides as allosteric inhibitors of fructose-1,6-bisphosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase 1
total genus 98
structure length 318
sequence length 327
chains with identical sequence D, H, L
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2005-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2fieA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2fieA02
1QGXA 3BIGA 4GX4A 2FBPA 4PTKA 4GWXA 3KC1A 1RDXA 4MJOA 4G61A 3ROJA 1JP4A 4GWZA 1CNQA 1KA1A 1FPGA 2DDKA 4GWYA 4HE1A 5DW8A 1FJ9A 1FPIA 1DK4A 2GQ1A 2CZHA 1YXIA 5J16A 1NI9A 5ET5A 1BK4A 3LV0A 2Q74A 5ET7A 1EYIA 2F3BA 3D1RA 3BIHA 4I3YA 2FIEA 1FPJA 2FHYA 2WBBA 2WBDA 5IZ1A 2Y5KA 2CZKA 2QFLA 5ESYA 2FVZA 1NV7A 1EYKA 4I40A 2Q8MA 1IMFA 1FBFA 4O7IA 1YZ0A 4HE0A 1G0HA 2R8TA 2QVUA 3B8BA 1NV0A 1NV3A 5T3JA 5EQAA 4GWSA 4HE2A 1IMEA 1FBEA 1EYJA 1RDZA 4H46A 1FSAA 4HXVA 1FBDA 1FPLA 1G0IA 3IFCA 3RYDA 1FPEA 2HHMA 1NUZA 4QXDA 3FBPA 1IMBA 5F24A 2OWZA 2PCRA 2VT5A 1Q9DA 4I3EA 4FBPA 5EQ9A 5ET6A 2JJKA 1FBGA 1K9ZA 2P3VA 1INPA 1FPKA 4GWUA 4N81A 1NUYA 1DBZA 1AWBA 4GBVA 1K9YA 3QMFA 5EYHA 5LDZA 1IMDA 5EQ8A 1LBVA 1YYZA 5A5LA 1FPFA 1NUWA 1DCUA 2P3NA 5FBPA 1FJ6A 1NV4A 1NV1A 1XI6A 4AS5A 3IFAA 2Y5LA 3KC0A 3RPLB 1KA0A 2BJIA 2F3DA 5EQ7A 3RPLA 2OX3A 1LBZA 1VDWA 2QVRA 1LBYA 1KZ8A 4GX3A 3KBZA 3LUZA 1LEVA 1NV5A 4GWWA 4AS4A 2FIXA 3A29A 1FPDA 4IR8A 1RDYA 5IZ3B 1NV2A 4GBWA 2WEFA 1FPBA 5ET8A 1LBWA 4GX6A 5EYGA 1FBHA 3T0JA 5I3SA 2CZIA 1SPIA 1NV6A 4H45A 1FTAA 1FBPA 2QVVA 5IZ3A 1FRPA 1D9QA 4KXPA 1IMCA 1NUXA 1LBXA 1FBCA 1IMAA
chains in the Genus database with same CATH superfamily
2ZYKA 4PTKA 3PMXA 4N6PA 2O1MA 1B2HA 3MUQA 3FJMA 3ILTB 4JB7A 4GWYA 1N7WA 5B7DA 4N17A 1SW1A 2GFEA 3H6VA 5J16A 4PAKA 3B6WA 1B1HA 2RC9A 3PV0E 4KYEA 1B58A 4XIGQ 4WEPA 1BKAA 4OESA 2ALUA 4H5FA 4DXUA 3TCHA 3SEYA 4QFOA 1EYKA 1MXUA 2XD2A 5T3JA 4GWSA 4DCYA 1IMEA 1EYJA 1URSA 3C35A 4XKQA 3O66A 4R6YA 2GH9A 1B40A 4MNCA 1Z7NE 1SW2A 3VDFA 2VD2A 4F31B 3VXBA 3CFZA 4DXBA 3FASA 3SKPA 1JVYA 4F3BA 4X04A 1CB6A 5FBPA 3SETA 4LATA 3K02A 5K2XA 1B4HA 5JK4A 2Y5LA 2Z8DA 3Q28A 4GX3A 4KI0E 3TODA 4NG7A 5AA1A 1FPBA 4LQ2A 5EYGA 1PB7A 2HXWA 5I59B 4EF2A 1B1XA 1LCFA 2I49A 1LBBA 2H25A 4H6DA 3PPNA 1XS5A 1LLSA 3MWBA 2P1SA 4PBQA 3PMVA 1LCTA 3Q25A 3CG1A 3VLVA 3CSGA 1EZ9A 1PC3A 2RKMA 3KG2A 3DLNA 1B4ZA 1GTKA 1FJ9A 4OVQA 5JTYB 2HFBA 1N3XA 1MQIA 2F7AA 4GXSB 3IB1A 3D1RA 4FECA 3BFUA 4ZEDA 4ZEIA 3KFMA 2REGA 2P0SA 4NF0A 5IZ1A 5AA4B 2ZNSA 1A8EA 1MPBA 3C31A 1FQEA 1NNFA 3S9NC 4O7IA 4HE0A 1USYH 4QBAA 3B8BA 1XHYA 3RTFB 3C33A 3MP1A 3HN0A 2F6GA 2F5XA 5EHSA 2THIA 2Y7PA 3CVGA 4O3AA 1NH7A 4H65A 4F3GA 2WYPA 3KBRA 2PVUA 4HTGA 1UTBB 3O29A 3TTNA 2Q88A 1FQDA 5K2YA 1SVXB 1AIVA 1K9YA 3MVYA 3D4CA 3K4UA 1JW5A 4BDOA 1QW0A 3KEIA 2CMOA 1MPDA 4FIMA 3EHUA 3TELA 1MXWA 5EQ7A 1R6ZA 2ZZVA 1LBZA 3MC2A 1KZ8A 3QIMA 4YMBA 4X1DA 4H5GA 2F8DA 1XOCA 4GBWA 1LBWA 4GLIA 1N0TA 4YKJA 4PAIA 3O2AA 1UQWA 1NL5A 2FYIA 3LR1A 4NEDA 1T0KA 4DDDA 3GXAA 2O7IA 2E0SA 1LFHA 1UTHB 1SBPA 1RDXA 3UK4A 4G61A 4G2ZA 1JP4A 2DWIA 3TUSA 3KJ7A 4WKMA 1VFDA 4U22A 1NNKA 2GQ1A 1MDP1 4KYSA 4IY6A 5ET5A 4QFPA 1BK4A 1MH3A 4NWDA 2QMXA 4LONB 1SD3A 2XXHA 3O6GA 4PAFA 3OO6A 5ESYA 1UIVA 4I40A 5I84A 3T9VA 1IIWA 2B4MA 5KCJB 5HM4B 3O9PA 4U21A 3K2DA 2XD3A 4QSDA 1IMBA 4P8BA 3LSFB 1NFTA 4IB2A 1FTMA 4XKPA 4PFYA 3O6IA 3PPQA 3G3GA 3UGWA 4FATA 4E0XA 3IO6A 4OENA 1IMDA 1NUWA 2B4LA 1FJ6A 1P1UA 3U1OA 1XC1A 1MM7A 5CMKA 2BJIA 1URDA 4IY5A 2B3FA 4G8HA 3KBZA 2XXKA 3IJOB 4EXLA 2V25A 3CI8A 4TLMB 4MH5A 1VSOA 3OSRA 4GQOA 4P56A 3RTWB 4NN3A 4YU0A 5LOMA 4OFJA 3FJ7A 4G8MA 4PBHA 1SW5A 1OVTA 1FTAA 1QVSA 1D9QA 1XVYA 4GXAA 3RN8A 4Z7EA 1LBXA 2DWAA 4G8NA 4R6HA 1RKMA 2ZYNA 4EQBA 4MCOA 4P0GA 1JEVA 4GWZA 3WAEA 3QYTA 1B6HA 3IR1A 4TLLB 4HCYA 2V3UA 4N4UA 2CZHA 1EH3A 2ZYMA 5ITPA 5ET7A 3R26A 4OFOA 5FTHA 1Y4TA 2GHBA 3HHFA 2VPOA 2I0BA 3DP8A 1IUDA 2XX9A 2PT1A 2QMWA 3FIRA 4O7MA 2Q9TA 4JVIA 3MP8A 4ONYA 3SDFA 1BIYA 1EU8A 2H98A 4XF5A 4MBPA 3A09A 1FPLA 2A5SA 2BJJX 3MQ9A 3H06B 1FPEA 2HHMA 4BDMA 2XA5A 1WDNA 2R6GE 3FXBA 3V89B 3GBAA 4F1UA 5I59A 2OWZA 3FXRA 3FVGA 2YJPA 2D5WA 1DSNA 1INPA 3ILUB 2OBGA 4ZEKA 3OO9A 4KR5A 1O64A 2AL4A 4XEQA 2P3NA 4WXJA 1J1NA 4GF8A 3PGFA 3IFAA 3KC0A 1XVXA 1P1WA 3OENA 3G3KA 5DVFA 1NV2A 4EF1A 2VP1A 4OVSA 2WEFA 1IQ7A 1Z7ME 1FBHA 1B3GA 2PFZA 1LAFE 2UYFA 4YZZA 4N8YA 1LGBC 1A8FA 4ZZAA 3PUWE 5HPQA 5F1QA 5F7VA 1QGXA 1YCJA 4H0WA 4YKKA 2FBPA 1N76A 2OZZA 4IO6A 4MJOA 3Q26A 4UA8A 4G68B 3E9XA 1FPGA 5DW8A 2O1LA 1N04A 3CFXA 4TQUQ 4YICA 1NI9A 3U93A 4C1TA 2F3BA 1FCKA 1IZ1A 3VFJA 3EKIA 1B52A 1LFGA 2QFLA 5H8HB 1M5EA 5BWJA 5CBSA 5IZZA 1Y20A 3EHSA 2QRYA 1FBEA 4C1UA 3T96B 1FBDA 5I57B 2ABHA 4LA9A 1PEBA 5CM6A 3UP9A 4N6DA 4U1OA 2VT5A 1B7ZA 2HAUA 1R9LA 3L6HA 3FVNA 1O7TA 4U4SA 2F78A 1AWBA 4THIA 5LDZA 5I2NB 1MY0A 2XXWA 1IXGA 4H1XA 3N26A 3ZSFA 1KA0A 3OXNA 4QSEA 3KOSA 1LB8A 4DIGA 4Z0IA 3SZPA 1HSJA 5JEIA 5A5XB 3D4GA 3IOWA 3S4UA 4OVPA 1FBPA 2AL5A 3MVZA 3ZKLA 1TWYA 2PBWA 4KXPA 3PMWA 2VGQA 4MFIA 1H3DA 4DE8A 2AIXA 3RPWA 2MKZA 4LUBA 4OETA 4OA4A 3TTMA 3KSXA 1A54A 2QL3A 1A7LA 5TPAA 3TMGA 5I7IA 3BIHA 2Y84A 2FHYA 2WBDA 1D9VA 2PT2A 3MPLA 1IMFA 3IX1A 4NF6B 3RT8A 3N6UA 5TU0A 1IITA 4JSOA 3SESA 1FSAA 2RC7A 3OEKA 1G0IA 1MDQA 4U1ZA 5F24A 4G4PA 4N07A 2RCBA 2L5VA 1I6AA 1AMFA 1B0HA 3CR9A 5EQ8A 3V8XB 4F1VA 2HZLA 2DP8A 1US4A 1DOTA 4NAPA 3FGSA 1XI6A 3JZJA 4RYAA 2DWHA 3HV1A 2DQVA 5M2VA 1DTGA 3B50A 4P1LA 4C0RA 3U92A 4ZZEA 3WAFA 5ICQA 1LAHE 2A5TA 3EPEA 4QF9A 4XKRA 4F2QA 3LUYA 1B7HA 4M1VA 1YAEA 1I6BA 3UIFA 3T0JA 2NOOA 3MSTA 2CZLA 1XT8A 2O69A 4EQ9A 1MQHA 1B3LA 2YPNA 3SEXA 4QFKA 1Y4CA 3ROJA 5CRYA 3OO8A 2H5YA 5JTYA 4RPNA 3T9XB 3VLWA 4PETA 4M4GA 1I6QA 3G7WA 3O97A 4QFLA 4I3YA 2FIEA 4DI3D 4LQ5A 4OVJA 2Y5KA 2B3BA 3IK6B 1D4NA 1Y3PA 2RC8A 4QFNA 1RDZA 1OIBA 1WVJA 4ND9A 4NF5B 4BDLA 5ET6A 1NNTA 3FXUA 1FTOA 1PDAA 2P3VA 3E3KA 5AA4A 4GWUA 3M8UA 3JV9A 2F34A 5L9OA 1QKAA 2H9BA 2WX9A 4YKIA 4GD5A 2X26A 1GV8A 1FW0A 4PE3A 4PP0A 2H4IA 1QUKA 3VXCA 2HQ0A 3TDJA 3MZ9A 4ZECA 1LEVA 3Q29A 1FPDA 1RDYA 2KLFA 3B6TA 2XXPA 1S50A 5I2NA 1I69A 5L9MA 4R6KA 2QJEA 2XXVA 4MLVA 5IZ3A 2XHDA 1DPPA 3OD7A 3TAJA 1B3HA 3USDA 3R7XA 2O6AA 2FA7A 2FNCA 2F7CA 2DSFA 3C4MA 4P1EA 1P1NA 5I58A 1FPIA 1DK4A 3MP6A 3M3KA 5HBCA 5DTBA 3PUVE 3B7DA 1SW4A 4OQOA 4QRZA 4N13A 2GHAA 1D9YA 1FPJA 1ANFA 1ZMGA 4FE8A 1IEJA 5BUUA 4U4XA 4EQ7A 4JWOA 3FZVA 1JW4A 3JYRA 1FBFA 4NQ8A 1MQDA 3UN6A 3F11A 5EQAA 1FQBA 2O68A 2DE2A 4IGTA 4DCXA 1ZBMA 2G93A 2ONRA 2OWSA 1A55A 1FBGA 1OVBA 3T9UA 2O51A 4Q30B 1FQCA 4OEVA 1LBVA 5IAIA 4ZEFA 2F97A 3H6UA 3KZGA 1A40A 2DE4A 4ZEBA 4WEDA 3ZKKA 2R9JA 4PCDA 4YMAA 1ZJLA 2Z23A 2OX3A 2A5TB 4GL8A 4BLAA 2M8CA 4F29A 3LUZA 2UXAA 2YLNA 4IR8A 2HAVA 2HPGA 4UABA 2HCAA 4L17A 1RYOA 1SPIA 1MY1A 2CEYA 3K6VA 2QS3A 4HS7A 1ZIUA 3MVWA 4O8MA 4ESXA 4HW8A 2XWOA 3VVEA 4XKNA 3K0VA 4H8IA 3TTLA 1QUIA 3IORA 3PD9A 4OEUA 2NWJA 4KD5A 4DXCA 2ANJA 2DWJA 2Q2CA 3PPOA 2Y7IA 5H8FB 4N15A 1UIUA 3TQLA 1IXIA 2QSXA 4H8JA 4P47A 3FATA 4YB5A 2I4CA 4RK9A 3T1BA 4LZ5A 3BKIB 4ELOA 3VV5A 1N84A 1SQYA 4U2RA 4X9TA 1RYXA 5H8QA 4GVOA 1DMBA 3MBPA 4FBPA 4PF8A 2I6EA 5L9SA 3U8QA 3QMFA 4R75A 3GZGA 2V4CA 1L5TA 1MM6A 1URGA 2ZMBA 4NX1A 4YKPA 4OWDA 3RPLA 1JEUA 1JNFA 4R9FA 1JQFA 1NV5A 2I58A 3HSTA 2WKYA 1JETA 4R2BA 4BDRA 3S2VA 4IO7A 1GR2A 3G3HA 1ZLQA 2IEEA 1ZU0A 3FVOA 1B3FA 2DVCA 2XWIA 4PFIA 2UVJA 3QK6A 3TFLA 1S9TA 3H3GA 5KDTB 4LZ7A 3KC1A 2V93A 3K1MA 3SERA 1MQGA 3B6QA 1B9JA 4HCWA 2DDKA 3GYYA 1MXZA 4IO2A 1NKXA 4Q5TA 2D21A 1POTA 3THIA 2OPDA 2Q74A 1EYIA 2I3WA 2DOJA 2QPQA 3I5OA 1MY4A 1NV7A 1KWHA 1B3EA 4IO3A 4O3CA 1LSTA 4KCCA 3FV1A 4GRKA 4OVRA 3M3LA 1NV0A 2LAOA 4XTCQ 4ISUA 4I1DA 2Y7KA 5I56A 3IFCA 4PDHA 2NXOA 3KOTA 4NGUA 4QHQA 1O63A 1II5A 1S7YA 5EQ9A 1P99A 2DXYA 1AH5A 2F6PA 1MY2A 3EHTA 4N81A 4OZ9A 3U65A 5EYHA 5AA2B 1FTLA 1YYZA 1F9BA 3H6WA 4LVQA 4PFRA 1NMUA 3SEUA 3BBRA 1BP5A 2XXYA 2NUVA 1FQFA 2W7YA 1Y3NA 4KYDA 4RY1A 5I57A 4MNIA 1OLCA 3DELB 1Q1KA 4MEVA 5DEXB 3TQWA 3IOTA 1DPEA 3FV2A 1B51A 3QUJA 4X48A 5ET8A 4F22A 4PE5B 4NMYA 2CZIA 4LZ8A 2KQZA 3U94A 4F39A 1TT1A 3PUZE 4GX4A 3PTYA 4GWXA 1Y9UA 1LAGE 1QJMA 5IM2A 2ONKE 1CNQA 3FUZA 3NOHA 4E0WA 4OANA 4YB7A 3K1PA 4JVDA 3C9HA 2IA4A 3TTKA 4G77A 3N5LA 1USYE 5B70A 1H76A 3VE1B 4PGNA 2WBBA 4X1BA 1FTKA 3K00A 1YZ0A 1MRPA 1NNPA 2R8TA 2QVUA 2G29A 2XXIA 4QSCA 3RUMA 5H8FA 3N94A 4GFRA 3PPRA 4H46A 4PC9A 3GBBA 4HXVA 3VLUA 1NUZA 2B65A 4I3EA 4MHFA 3H03A 4NF8B 3VVFA 4ELPA 4DZ1A 5FHMA 1B32A 1SYHA 1ZTYA 2XWKA 4GL0A 3V5AA 4R72A 3ODBA 2XX8A 4R73A 1OLAA 3IB0A 5A5LA 1DCUA 1NV4A 3RT6B 4OVTA 3W15C 2Q2AA 4RPOA 3V83A 5H8QB 3OMBA 4KHZE 3CIJA 4AB5A 1M5DA 1B5IA 3LSXA 3S9EA 1MQJA 4DI4B 5CMCA 2XWVA 5I3SA 1R1NA 2AYSA 1NV6A 4H45A 4P3LA 3ECRA 3E4RA 1FRPA 2ESNA 4H67A 4G68A 4UACA 5I2KA 1IMCA 1NUXA 1MH4A 3HCQA 3GLBA 4R74A 3BIGA 1TXFA 3MVXA 3TCGA 1YTVA 2F36A 5CBRA 3MW0A 3TPAA 4F3PA 5DT6A 4EUOA 4G68C 2Z8EA 4MX6A 2UYEA 5L8DA 4R9GA 5H8HA 1OQGA 3KN8A 3W9VA 4N6KA 4NE4A 5H8SA 1P1OA 2OWTA 3C32A 3E13X 2CZKA 3L6GA 2Q8MA 2Q89A 4MF3A 2P2AA 3O28A 4PQJA 1A99A 4JWYA 1UTBA 4X8RA 1LFIA 2I4BA 3CFLA 1H45A 1PBQA 4NF6A 3T22A 2V3TA 1VE4A 2JJKA 2O84X 3W9WA 3MAMA 4ZS9A 3K6WA 3DM0A 5CC2A 1BTJA 1FPFA 4BDQA 3A3CA 1H43A 2ZZXA 4ELQA 4AS5A 5FHOA 2Y7RA 1SYIA 4PDDA 5J1DA 4RK2A 2V84A 5A5XA 4FEDA 4NF5A 1JVXA 3MPKA 2Y7WA 3IB2A 1WODA 4LP2B 1Y1MA 3C36A 4NF4B 1TFAA 4F3SA 2I3VA 4RJZA 4PF6A 3TEPA 1IXCA 3BFTA 4N8GA 1PBPA 4JVCA 4POWA 2CEXA 1MS7A 4PFTA 1SI1A 3HO7A 4FAJA 3HFUA 3TTRA 2UVGA 5ELVA 4MIJA 5I58B 4OXVA 1US5A 1AOVA 5I5PA 1VR5A 3IOUA 1N3WA 4NWCA 4Q0CA 5H8NB 3UORA 2ZNUA 3QSLA 4ESWA 3DP6A 1P1QA 1QULA 4PFWA 2FVZA 2HZKA 2ONSA 4IGRA 4OMBA 3T9HB 1D3KA 4F19A 1R9QA 3C34A 4F1YA 1TFDA 2OCUA 3CHGA 3FD3A 2DS9A 4MMPA 3FJGA 1QKBA 4P0IA 1SI0A 2D3IA 4RA1A 1DTZA 2DYXA 2XXTA 4MNPA 2PFYA 1MG1A 3ZS6A 4PGPA 5AA2D 5FTIA 2KR0A 2RCAA 3K1NA 4JBZA 4OFLA 2V3QA 1ZKBA 3RGYA 2R71A 4POXA 4I62A 4KFQA 3K6XA 2F3DA 2QVRA 1LBYA 2GRVA 1Q35A 3IO4A 3RLFE 3SEWA 1MPCA 4AQ4A 1Y1ZA 4EXKA 3G3IA 2DXRA 3IJXB 3HHGA 4YAHX 5ICTA 3AXFA 2Z22A 1BLFA 2UVHA 2XXRA 2RINA 4GOTA 1UTHA 4Q8RA 1M5CA 1HSLA 2HEUA 4NTLA 4ELRA 4JWXA 2OJTA 5TP9B 4P11A 4ECFA 1YPNA 4I9DA 2Z8FA 1YXIA 3S9MC 1B5HA 4XXUA 3KSJA 4TOZA 1POY1 1LB9A 1FTJA 3UA8A 4JSDA 3OEMA 4ZE8A 1LBCA 4EDPA 4LN5A 3I3VA 5DYHA 3A3UA 5KCJA 1EZOA 1B05A 5TP9A 5EYFA 2ZNTA 3MZBA 3IAZA 3QUFA 1Q9DA 2E1SA 3G3JA 4MAGA 3PUYE 3E78A 4P9KA 4GWOA 4XFEA 3MJNA 3N6TA 1NV1A 1B5JA 2XX7A 3RPLB 2VPNA 4K3FA 2OLBA 2XXXA 4GWWA 3H7MA 3A29A 3LSWA 3O6HA 3PD8A 5IZ3B 2ZZWA 2RF1A 4NF4A 2WYKA 3TCFA 2VOZA 4NHBA 3H4ZA 1FQAA 2VHAA 2ZXTA 2PMSA 1MXVA 3QXMA 1OMPA 4JDFA 5EHMA 1FBCA 5IGAA 3KGCA 3T66A 3ISPA 1GVCA 1KA1A 1B7UA 3SEVA 4HE1A 4N91A 4F2OA 2DE3A 1Y3QA 5KZTA 4YB6A 3TZAA 2X7QA 4I8CA 3R6UA 1B0LA 1GGGA 3LV0A 3TYHA 5CMBA 1M5BA 1CE2A 2F7BA 2X7PA 5DVJA 3KN7A 4AB6A 2QS1A 5TPAB 3ONMA 4KPTA 2DVZA 1NV3A 5DVIA 1ELJA 1EZPA 2OK2A 5I56B 3Q27A 1H44A 4QXDA 1B46A 3IOVA 4OERA 5CMMA 2PCRA 2VD3A 3FXQA 2UVIA 3H6TA 1K9ZA 1FPKA 4FJPA 1DBZA 4GBVA 3T93B 3RQTA 3IL1B 3CG3A 3KN3A 3MYUA 3LC8A 3TKDA 3EQ1A 3S9LC 1VDWA 3K6UA 4O94A 4AS4A 3OO7A 3I6VA 1LAXA 2Q8JA 3DP4A 2ZYOA 3P7IA 2F35A 5H8NA 4GX6A 4BDNA 3OSQA 2QVVA 1OQHA 3U72A 1M5FA 2OPEA 4KQPA 2PYYA 2REJA 1NH8A 1IMAA 2H99A 2XXQA 2QS4A 4MLQA 5IKBA 3PUXE 4FEBA 1VFEA 5ISUA 5KDTA 4KCDA 3PU5A 3M3FA 1JW1A 3E79A 4F18A 2QS2A 3HPIA 3EF7A 4OYVA 3OELA 1MXYA 3LBSA 5CI5A 4IO5A 4OHNA 1MXXA 4O3BA 1G0HA 3CSBA 1SDXA 4HE2A 1PB8A 3RYDA 1IXHA 3G3FA 3RNNA 2XXUA 3FBPA 3KJTA 3OOAA 4FORA 4JXIA 1MY3A 4U23A 4ZDMA 1N7XA 1NUYA 2O7UA 2I0CA 4PFBA 3EN3A 3K01A 5ITOA 3PPPA 1ATGA 1PB9A 3QAXA 5FHNA 5AA2A 2I48A 3MZ1A 4RNSA 3RY3A 4GIZA 3LSLA 2FIXA 3VVDA 4NF8A 4DLDA 2NVUB 1AL3A 1QUJA 2PX1A 4PFUA 4ZE9A 5LTCA 5AA3A 5DEXA 4IO4A 4R2FA 5I2KB 2HXRA 3FVKA 1HSEA 3CRBA 5AE4A 4OTEA 4RXLA
chains in the Genus database with same CATH topology
1QGXA 3BIGA 4GX4A 2FBPA 4PTKA 3PTYA 4GWXA 4MCOA 3HFUA 3KC1A 1RDXA 4MJOA 4G61A 3ROJA 3ISPA 5IM2A 1JP4A 4GWZA 1CNQA 1KA1A 4MIJA 4HCWA 1FPGA 2DDKA 4GWYA 4HE1A 5DW8A 2MKZA 3NOHA 2DE3A 3GYYA 4HCYA 1FJ9A 4N91A 4N4UA 4OANA 4OVQA 4P1EA 1FPIA 4MX6A 1DK4A 4N17A 2GQ1A 2CZHA 4N15A 4OA4A 1YXIA 4YICA 4PETA 4JVDA 5J16A 1NI9A 5ET5A 3E79A 4PAKA 4F18A 1BK4A 3LV0A 3W9VA 4N6KA 2Q74A 5ET7A 1EYIA 2F3BA 5I7IA 3D1RA 3BIHA 4I3YA 2FIEA 1FPJA 2QPQA 2VPOA 4PAFA 4DI3D 4PGNA 4P47A 2FHYA 4NF0A 4PFIA 2WBBA 2WBDA 5IZ1A 3EKIA 2Y5KA 2CZKA 2QFLA 5ESYA 3T1BA 2FVZA 2HZKA 1NV7A 1EYKA 4I40A 2Q8MA 4O7MA 2Q9TA 4JVIA 1IMFA 1FBFA 4NQ8A 4O7IA 5IZZA 1YZ0A 4HE0A 1G0HA 4OVRA 4F19A 4QBAA 2R8TA 2DVZA 4LN5A 2QVUA 3B8BA 1NV0A 1NV3A 5T3JA 5EQAA 2B4MA 2F5XA 4XF5A 4GWSA 4X8RA 4HE2A 3CHGA 1IMEA 1FBEA 1EYJA 1RDZA 4H46A 5IGAA 1FSAA 4PC9A 4MMPA 4X9TA 4HXVA 1FBDA 1FPLA 5I5PA 1G0IA 3IFCA 3RYDA 5CM6A 1FPEA 2HHMA 4PDHA 1NUZA 4QXDA 3FBPA 1IMBA 2XA5A 4N6DA 4NGUA 4MNCA 3FXBA 4P8BA 2WYPA 5F24A 2DE2A 4F1UA 2OWZA 2PCRA 2VT5A 1Q9DA 4I3EA 4MHFA 4FBPA 5EQ9A 5ET6A 2JJKA 4PF8A 1FBGA 2L5VA 1K9ZA 2P3VA 2XWKA 1INPA 1FPKA 4MAGA 4MNPA 3W9WA 4GWUA 4N81A 3E78A 2PFYA 1NUYA 1DBZA 1AWBA 4GBVA 1K9YA 3QMFA 5EYHA 5LDZA 4P9KA 1IMDA 4PGPA 5EQ8A 4PFBA 2V4CA 1LBVA 1YYZA 2KR0A 4X04A 4PFRA 4XFEA 5A5LA 1FPFA 1NUWA 2V3QA 2WX9A 1DCUA 2P3NA 5FBPA 1FJ6A 2B4LA 1NV4A 2HZLA 4XEQA 2DE4A 4NAPA 1NV1A 1XI6A 2ZZXA 4AS5A 3MYUA 3IFAA 4OVTA 4PCDA 5JK4A 2Y5LA 4NX1A 3U65A 3KC0A 4PDDA 5J1DA 3RPLB 1KA0A 4PE3A 2BJIA 2XWIA 2F3DA 3B50A 5EQ7A 3RPLA 2OX3A 2VPNA 4P1LA 2ZZVA 1LBZA 1VDWA 4MNIA 2QVRA 1LBYA 1KZ8A 4O94A 4GX3A 3KBZA 3LUZA 1LEVA 1NV5A 4GWWA 4AS4A 2FIXA 2XXKA 3A29A 4MEVA 1FPDA 4IR8A 1RDYA 4NG7A 5IZ3B 1NV2A 2ZZWA 4GBWA 2WYKA 2WEFA 4OVSA 1FPBA 5ET8A 1LBWA 2HPGA 4M1VA 4P56A 4GX6A 4NHBA 4UABA 3SZPA 4DI4B 5EYGA 4NN3A 1FBHA 3T0JA 2XWVA 5I3SA 2CZIA 1SPIA 4PAIA 5LTCA 2PFZA 4PBHA 2CEYA 1NV6A 4H45A 2KQZA 3MSTA 1FTAA 4P3LA 1FBPA 2QVVA 4OVPA 4PF6A 5IZ3A 4F1VA 4N8GA 1FRPA 4JVCA 1D9QA 2HXRA 4YZZA 4N8YA 4PBQA 2CEXA 4KXPA 1IMCA 4O8MA 1NUXA 1LBXA 1FBCA 1IMAA 2XWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QGX A;  3BIG A;  4GX4 A;  2FBP A;  4PTK A;  4GWX A;  3KC1 A;  1RDX A;  4MJO A;  4G61 A;  3ROJ A;  1JP4 A;  4GWZ A;  1CNQ A;  1KA1 A;  1FPG A;  2DDK A;  4GWY A;  4HE1 A;  5DW8 A;  1FJ9 A;  1FPI A;  1DK4 A;  2GQ1 A;  2CZH A;  1YXI A;  5J16 A;  1NI9 A;  5ET5 A;  1BK4 A;  3LV0 A;  2Q74 A;  5ET7 A;  1EYI A;  2F3B A;  3D1R A;  3BIH A;  4I3Y A;  2FIE A;  1FPJ A;  2FHY A;  2WBB A;  2WBD A;  5IZ1 A;  2Y5K A;  2CZK A;  2QFL A;  5ESY A;  2FVZ A;  1NV7 A;  1EYK A;  4I40 A;  2Q8M A;  1IMF A;  1FBF A;  4O7I A;  1YZ0 A;  4HE0 A;  1G0H A;  2R8T A;  2QVU A;  3B8B A;  1NV0 A;  1NV3 A;  5T3J A;  5EQA A;  4GWS A;  4HE2 A;  1IME A;  1FBE A;  1EYJ A;  1RDZ A;  4H46 A;  1FSA A;  4HXV A;  1FBD A;  1FPL A;  1G0I A;  3IFC A;  3RYD A;  1FPE A;  2HHM A;  1NUZ A;  4QXD A;  3FBP A;  1IMB A;  5F24 A;  2OWZ A;  2PCR A;  2VT5 A;  1Q9D A;  4I3E A;  4FBP A;  5EQ9 A;  5ET6 A;  2JJK A;  1FBG A;  1K9Z A;  2P3V A;  1INP A;  1FPK A;  4GWU A;  4N81 A;  1NUY A;  1DBZ A;  1AWB A;  4GBV A;  1K9Y A;  3QMF A;  5EYH A;  5LDZ A;  1IMD A;  5EQ8 A;  1LBV A;  1YYZ A;  5A5L A;  1FPF A;  1NUW A;  1DCU A;  2P3N A;  5FBP A;  1FJ6 A;  1NV4 A;  1NV1 A;  1XI6 A;  4AS5 A;  3IFA A;  2Y5L A;  3KC0 A;  3RPL B;  1KA0 A;  2BJI A;  2F3D A;  5EQ7 A;  3RPL A;  2OX3 A;  1LBZ A;  1VDW A;  2QVR A;  1LBY A;  1KZ8 A;  4GX3 A;  3KBZ A;  3LUZ A;  1LEV A;  1NV5 A;  4GWW A;  4AS4 A;  2FIX A;  3A29 A;  1FPD A;  4IR8 A;  1RDY A;  5IZ3 B;  1NV2 A;  4GBW A;  2WEF A;  1FPB A;  5ET8 A;  1LBW A;  4GX6 A;  5EYG A;  1FBH A;  3T0J A;  5I3S A;  2CZI A;  1SPI A;  1NV6 A;  4H45 A;  1FTA A;  1FBP A;  2QVV A;  5IZ3 A;  1FRP A;  1D9Q A;  4KXP A;  1IMC A;  1NUX A;  1LBX A;  1FBC A;  1IMA A; 
#chains in the Genus database with same CATH topology
 2ZYK A;  4PTK A;  3PMX A;  4N6P A;  2O1M A;  1B2H A;  3MUQ A;  3FJM A;  3ILT B;  4JB7 A;  4GWY A;  1N7W A;  5B7D A;  4N17 A;  1SW1 A;  2GFE A;  3H6V A;  5J16 A;  4PAK A;  3B6W A;  1B1H A;  2RC9 A;  3PV0 E;  4KYE A;  1B58 A;  4XIG Q;  4WEP A;  1BKA A;  4OES A;  2ALU A;  4H5F A;  4DXU A;  3TCH A;  3SEY A;  4QFO A;  1EYK A;  1MXU A;  2XD2 A;  5T3J A;  4GWS A;  4DCY A;  1IME A;  1EYJ A;  1URS A;  3C35 A;  4XKQ A;  3O66 A;  4R6Y A;  2GH9 A;  1B40 A;  4MNC A;  1Z7N E;  1SW2 A;  3VDF A;  2VD2 A;  4F31 B;  3VXB A;  3CFZ A;  4DXB A;  3FAS A;  3SKP A;  1JVY A;  4F3B A;  4X04 A;  1CB6 A;  5FBP A;  3SET A;  4LAT A;  3K02 A;  5K2X A;  1B4H A;  5JK4 A;  2Y5L A;  2Z8D A;  3Q28 A;  4GX3 A;  4KI0 E;  3TOD A;  4NG7 A;  5AA1 A;  1FPB A;  4LQ2 A;  5EYG A;  1PB7 A;  2HXW A;  5I59 B;  4EF2 A;  1B1X A;  1LCF A;  2I49 A;  1LBB A;  2H25 A;  4H6D A;  3PPN A;  1XS5 A;  1LLS A;  3MWB A;  2P1S A;  4PBQ A;  3PMV A;  1LCT A;  3Q25 A;  3CG1 A;  3VLV A;  3CSG A;  1EZ9 A;  1PC3 A;  2RKM A;  3KG2 A;  3DLN A;  1B4Z A;  1GTK A;  1FJ9 A;  4OVQ A;  5JTY B;  2HFB A;  1N3X A;  1MQI A;  2F7A A;  4GXS B;  3IB1 A;  3D1R A;  4FEC A;  3BFU A;  4ZED A;  4ZEI A;  3KFM A;  2REG A;  2P0S A;  4NF0 A;  5IZ1 A;  5AA4 B;  2ZNS A;  1A8E A;  1MPB A;  3C31 A;  1FQE A;  1NNF A;  3S9N C;  4O7I A;  4HE0 A;  1USY H;  4QBA A;  3B8B A;  1XHY A;  3RTF B;  3C33 A;  3MP1 A;  3HN0 A;  2F6G A;  2F5X A;  5EHS A;  2THI A;  2Y7P A;  3CVG A;  4O3A A;  1NH7 A;  4H65 A;  4F3G A;  2WYP A;  3KBR A;  2PVU A;  4HTG A;  1UTB B;  3O29 A;  3TTN A;  2Q88 A;  1FQD A;  5K2Y A;  1SVX B;  1AIV A;  1K9Y A;  3MVY A;  3D4C A;  3K4U A;  1JW5 A;  4BDO A;  1QW0 A;  3KEI A;  2CMO A;  1MPD A;  4FIM A;  3EHU A;  3TEL A;  1MXW A;  5EQ7 A;  1R6Z A;  2ZZV A;  1LBZ A;  3MC2 A;  1KZ8 A;  3QIM A;  4YMB A;  4X1D A;  4H5G A;  2F8D A;  1XOC A;  4GBW A;  1LBW A;  4GLI A;  1N0T A;  4YKJ A;  4PAI A;  3O2A A;  1UQW A;  1NL5 A;  2FYI A;  3LR1 A;  4NED A;  1T0K A;  4DDD A;  3GXA A;  2O7I A;  2E0S A;  1LFH A;  1UTH B;  1SBP A;  1RDX A;  3UK4 A;  4G61 A;  4G2Z A;  1JP4 A;  2DWI A;  3TUS A;  3KJ7 A;  4WKM A;  1VFD A;  4U22 A;  1NNK A;  2GQ1 A;  1MDP 1;  4KYS A;  4IY6 A;  5ET5 A;  4QFP A;  1BK4 A;  1MH3 A;  4NWD A;  2QMX A;  4LON B;  1SD3 A;  2XXH A;  3O6G A;  4PAF A;  3OO6 A;  5ESY A;  1UIV A;  4I40 A;  5I84 A;  3T9V A;  1IIW A;  2B4M A;  5KCJ B;  5HM4 B;  3O9P A;  4U21 A;  3K2D A;  2XD3 A;  4QSD A;  1IMB A;  4P8B A;  3LSF B;  1NFT A;  4IB2 A;  1FTM A;  4XKP A;  4PFY A;  3O6I A;  3PPQ A;  3G3G A;  3UGW A;  4FAT A;  4E0X A;  3IO6 A;  4OEN A;  1IMD A;  1NUW A;  2B4L A;  1FJ6 A;  1P1U A;  3U1O A;  1XC1 A;  1MM7 A;  5CMK A;  2BJI A;  1URD A;  4IY5 A;  2B3F A;  4G8H A;  3KBZ A;  2XXK A;  3IJO B;  4EXL A;  2V25 A;  3CI8 A;  4TLM B;  4MH5 A;  1VSO A;  3OSR A;  4GQO A;  4P56 A;  3RTW B;  4NN3 A;  4YU0 A;  5LOM A;  4OFJ A;  3FJ7 A;  4G8M A;  4PBH A;  1SW5 A;  1OVT A;  1FTA A;  1QVS A;  1D9Q A;  1XVY A;  4GXA A;  3RN8 A;  4Z7E A;  1LBX A;  2DWA A;  4G8N A;  4R6H A;  1RKM A;  2ZYN A;  4EQB A;  4MCO A;  4P0G A;  1JEV A;  4GWZ A;  3WAE A;  3QYT A;  1B6H A;  3IR1 A;  4TLL B;  4HCY A;  2V3U A;  4N4U A;  2CZH A;  1EH3 A;  2ZYM A;  5ITP A;  5ET7 A;  3R26 A;  4OFO A;  5FTH A;  1Y4T A;  2GHB A;  3HHF A;  2VPO A;  2I0B A;  3DP8 A;  1IUD A;  2XX9 A;  2PT1 A;  2QMW A;  3FIR A;  4O7M A;  2Q9T A;  4JVI A;  3MP8 A;  4ONY A;  3SDF A;  1BIY A;  1EU8 A;  2H98 A;  4XF5 A;  4MBP A;  3A09 A;  1FPL A;  2A5S A;  2BJJ X;  3MQ9 A;  3H06 B;  1FPE A;  2HHM A;  4BDM A;  2XA5 A;  1WDN A;  2R6G E;  3FXB A;  3V89 B;  3GBA A;  4F1U A;  5I59 A;  2OWZ A;  3FXR A;  3FVG A;  2YJP A;  2D5W A;  1DSN A;  1INP A;  3ILU B;  2OBG A;  4ZEK A;  3OO9 A;  4KR5 A;  1O64 A;  2AL4 A;  4XEQ A;  2P3N A;  4WXJ A;  1J1N A;  4GF8 A;  3PGF A;  3IFA A;  3KC0 A;  1XVX A;  1P1W A;  3OEN A;  3G3K A;  5DVF A;  1NV2 A;  4EF1 A;  2VP1 A;  4OVS A;  2WEF A;  1IQ7 A;  1Z7M E;  1FBH A;  1B3G A;  2PFZ A;  1LAF E;  2UYF A;  4YZZ A;  4N8Y A;  1LGB C;  1A8F A;  4ZZA A;  3PUW E;  5HPQ A;  5F1Q A;  5F7V A;  1QGX A;  1YCJ A;  4H0W A;  4YKK A;  2FBP A;  1N76 A;  2OZZ A;  4IO6 A;  4MJO A;  3Q26 A;  4UA8 A;  4G68 B;  3E9X A;  1FPG A;  5DW8 A;  2O1L A;  1N04 A;  3CFX A;  4TQU Q;  4YIC A;  1NI9 A;  3U93 A;  4C1T A;  2F3B A;  1FCK A;  1IZ1 A;  3VFJ A;  3EKI A;  1B52 A;  1LFG A;  2QFL A;  5H8H B;  1M5E A;  5BWJ A;  5CBS A;  5IZZ A;  1Y20 A;  3EHS A;  2QRY A;  1FBE A;  4C1U A;  3T96 B;  1FBD A;  5I57 B;  2ABH A;  4LA9 A;  1PEB A;  5CM6 A;  3UP9 A;  4N6D A;  4U1O A;  2VT5 A;  1B7Z A;  2HAU A;  1R9L A;  3L6H A;  3FVN A;  1O7T A;  4U4S A;  2F78 A;  1AWB A;  4THI A;  5LDZ A;  5I2N B;  1MY0 A;  2XXW A;  1IXG A;  4H1X A;  3N26 A;  3ZSF A;  1KA0 A;  3OXN A;  4QSE A;  3KOS A;  1LB8 A;  4DIG A;  4Z0I A;  3SZP A;  1HSJ A;  5JEI A;  5A5X B;  3D4G A;  3IOW A;  3S4U A;  4OVP A;  1FBP A;  2AL5 A;  3MVZ A;  3ZKL A;  1TWY A;  2PBW A;  4KXP A;  3PMW A;  2VGQ A;  4MFI A;  1H3D A;  4DE8 A;  2AIX A;  3RPW A;  2MKZ A;  4LUB A;  4OET A;  4OA4 A;  3TTM A;  3KSX A;  1A54 A;  2QL3 A;  1A7L A;  5TPA A;  3TMG A;  5I7I A;  3BIH A;  2Y84 A;  2FHY A;  2WBD A;  1D9V A;  2PT2 A;  3MPL A;  1IMF A;  3IX1 A;  4NF6 B;  3RT8 A;  3N6U A;  5TU0 A;  1IIT A;  4JSO A;  3SES A;  1FSA A;  2RC7 A;  3OEK A;  1G0I A;  1MDQ A;  4U1Z A;  5F24 A;  4G4P A;  4N07 A;  2RCB A;  2L5V A;  1I6A A;  1AMF A;  1B0H A;  3CR9 A;  5EQ8 A;  3V8X B;  4F1V A;  2HZL A;  2DP8 A;  1US4 A;  1DOT A;  4NAP A;  3FGS A;  1XI6 A;  3JZJ A;  4RYA A;  2DWH A;  3HV1 A;  2DQV A;  5M2V A;  1DTG A;  3B50 A;  4P1L A;  4C0R A;  3U92 A;  4ZZE A;  3WAF A;  5ICQ A;  1LAH E;  2A5T A;  3EPE A;  4QF9 A;  4XKR A;  4F2Q A;  3LUY A;  1B7H A;  4M1V A;  1YAE A;  1I6B A;  3UIF A;  3T0J A;  2NOO A;  3MST A;  2CZL A;  1XT8 A;  2O69 A;  4EQ9 A;  1MQH A;  1B3L A;  2YPN A;  3SEX A;  4QFK A;  1Y4C A;  3ROJ A;  5CRY A;  3OO8 A;  2H5Y A;  5JTY A;  4RPN A;  3T9X B;  3VLW A;  4PET A;  4M4G A;  1I6Q A;  3G7W A;  3O97 A;  4QFL A;  4I3Y A;  2FIE A;  4DI3 D;  4LQ5 A;  4OVJ A;  2Y5K A;  2B3B A;  3IK6 B;  1D4N A;  1Y3P A;  2RC8 A;  4QFN A;  1RDZ A;  1OIB A;  1WVJ A;  4ND9 A;  4NF5 B;  4BDL A;  5ET6 A;  1NNT A;  3FXU A;  1FTO A;  1PDA A;  2P3V A;  3E3K A;  5AA4 A;  4GWU A;  3M8U A;  3JV9 A;  2F34 A;  5L9O A;  1QKA A;  2H9B A;  2WX9 A;  4YKI A;  4GD5 A;  2X26 A;  1GV8 A;  1FW0 A;  4PE3 A;  4PP0 A;  2H4I A;  1QUK A;  3VXC A;  2HQ0 A;  3TDJ A;  3MZ9 A;  4ZEC A;  1LEV A;  3Q29 A;  1FPD A;  1RDY A;  2KLF A;  3B6T A;  2XXP A;  1S50 A;  5I2N A;  1I69 A;  5L9M A;  4R6K A;  2QJE A;  2XXV A;  4MLV A;  5IZ3 A;  2XHD A;  1DPP A;  3OD7 A;  3TAJ A;  1B3H A;  3USD A;  3R7X A;  2O6A A;  2FA7 A;  2FNC A;  2F7C A;  2DSF A;  3C4M A;  4P1E A;  1P1N A;  5I58 A;  1FPI A;  1DK4 A;  3MP6 A;  3M3K A;  5HBC A;  5DTB A;  3PUV E;  3B7D A;  1SW4 A;  4OQO A;  4QRZ A;  4N13 A;  2GHA A;  1D9Y A;  1FPJ A;  1ANF A;  1ZMG A;  4FE8 A;  1IEJ A;  5BUU A;  4U4X A;  4EQ7 A;  4JWO A;  3FZV A;  1JW4 A;  3JYR A;  1FBF A;  4NQ8 A;  1MQD A;  3UN6 A;  3F11 A;  5EQA A;  1FQB A;  2O68 A;  2DE2 A;  4IGT A;  4DCX A;  1ZBM A;  2G93 A;  2ONR A;  2OWS A;  1A55 A;  1FBG A;  1OVB A;  3T9U A;  2O51 A;  4Q30 B;  1FQC A;  4OEV A;  1LBV A;  5IAI A;  4ZEF A;  2F97 A;  3H6U A;  3KZG A;  1A40 A;  2DE4 A;  4ZEB A;  4WED A;  3ZKK A;  2R9J A;  4PCD A;  4YMA A;  1ZJL A;  2Z23 A;  2OX3 A;  2A5T B;  4GL8 A;  4BLA A;  2M8C A;  4F29 A;  3LUZ A;  2UXA A;  2YLN A;  4IR8 A;  2HAV A;  2HPG A;  4UAB A;  2HCA A;  4L17 A;  1RYO A;  1SPI A;  1MY1 A;  2CEY A;  3K6V A;  2QS3 A;  4HS7 A;  1ZIU A;  3MVW A;  4O8M A;  4ESX A;  4HW8 A;  2XWO A;  3VVE A;  4XKN A;  3K0V A;  4H8I A;  3TTL A;  1QUI A;  3IOR A;  3PD9 A;  4OEU A;  2NWJ A;  4KD5 A;  4DXC A;  2ANJ A;  2DWJ A;  2Q2C A;  3PPO A;  2Y7I A;  5H8F B;  4N15 A;  1UIU A;  3TQL A;  1IXI A;  2QSX A;  4H8J A;  4P47 A;  3FAT A;  4YB5 A;  2I4C A;  4RK9 A;  3T1B A;  4LZ5 A;  3BKI B;  4ELO A;  3VV5 A;  1N84 A;  1SQY A;  4U2R A;  4X9T A;  1RYX A;  5H8Q A;  4GVO A;  1DMB A;  3MBP A;  4FBP A;  4PF8 A;  2I6E A;  5L9S A;  3U8Q A;  3QMF A;  4R75 A;  3GZG A;  2V4C A;  1L5T A;  1MM6 A;  1URG A;  2ZMB A;  4NX1 A;  4YKP A;  4OWD A;  3RPL A;  1JEU A;  1JNF A;  4R9F A;  1JQF A;  1NV5 A;  2I58 A;  3HST A;  2WKY A;  1JET A;  4R2B A;  4BDR A;  3S2V A;  4IO7 A;  1GR2 A;  3G3H A;  1ZLQ A;  2IEE A;  1ZU0 A;  3FVO A;  1B3F A;  2DVC A;  2XWI A;  4PFI A;  2UVJ A;  3QK6 A;  3TFL A;  1S9T A;  3H3G A;  5KDT B;  4LZ7 A;  3KC1 A;  2V93 A;  3K1M A;  3SER A;  1MQG A;  3B6Q A;  1B9J A;  4HCW A;  2DDK A;  3GYY A;  1MXZ A;  4IO2 A;  1NKX A;  4Q5T A;  2D21 A;  1POT A;  3THI A;  2OPD A;  2Q74 A;  1EYI A;  2I3W A;  2DOJ A;  2QPQ A;  3I5O A;  1MY4 A;  1NV7 A;  1KWH A;  1B3E A;  4IO3 A;  4O3C A;  1LST A;  4KCC A;  3FV1 A;  4GRK A;  4OVR A;  3M3L A;  1NV0 A;  2LAO A;  4XTC Q;  4ISU A;  4I1D A;  2Y7K A;  5I56 A;  3IFC A;  4PDH A;  2NXO A;  3KOT A;  4NGU A;  4QHQ A;  1O63 A;  1II5 A;  1S7Y A;  5EQ9 A;  1P99 A;  2DXY A;  1AH5 A;  2F6P A;  1MY2 A;  3EHT A;  4N81 A;  4OZ9 A;  3U65 A;  5EYH A;  5AA2 B;  1FTL A;  1YYZ A;  1F9B A;  3H6W A;  4LVQ A;  4PFR A;  1NMU A;  3SEU A;  3BBR A;  1BP5 A;  2XXY A;  2NUV A;  1FQF A;  2W7Y A;  1Y3N A;  4KYD A;  4RY1 A;  5I57 A;  4MNI A;  1OLC A;  3DEL B;  1Q1K A;  4MEV A;  5DEX B;  3TQW A;  3IOT A;  1DPE A;  3FV2 A;  1B51 A;  3QUJ A;  4X48 A;  5ET8 A;  4F22 A;  4PE5 B;  4NMY A;  2CZI A;  4LZ8 A;  2KQZ A;  3U94 A;  4F39 A;  1TT1 A;  3PUZ E;  4GX4 A;  3PTY A;  4GWX A;  1Y9U A;  1LAG E;  1QJM A;  5IM2 A;  2ONK E;  1CNQ A;  3FUZ A;  3NOH A;  4E0W A;  4OAN A;  4YB7 A;  3K1P A;  4JVD A;  3C9H A;  2IA4 A;  3TTK A;  4G77 A;  3N5L A;  1USY E;  5B70 A;  1H76 A;  3VE1 B;  4PGN A;  2WBB A;  4X1B A;  1FTK A;  3K00 A;  1YZ0 A;  1MRP A;  1NNP A;  2R8T A;  2QVU A;  2G29 A;  2XXI A;  4QSC A;  3RUM A;  5H8F A;  3N94 A;  4GFR A;  3PPR A;  4H46 A;  4PC9 A;  3GBB A;  4HXV A;  3VLU A;  1NUZ A;  2B65 A;  4I3E A;  4MHF A;  3H03 A;  4NF8 B;  3VVF A;  4ELP A;  4DZ1 A;  5FHM A;  1B32 A;  1SYH A;  1ZTY A;  2XWK A;  4GL0 A;  3V5A A;  4R72 A;  3ODB A;  2XX8 A;  4R73 A;  1OLA A;  3IB0 A;  5A5L A;  1DCU A;  1NV4 A;  3RT6 B;  4OVT A;  3W15 C;  2Q2A A;  4RPO A;  3V83 A;  5H8Q B;  3OMB A;  4KHZ E;  3CIJ A;  4AB5 A;  1M5D A;  1B5I A;  3LSX A;  3S9E A;  1MQJ A;  4DI4 B;  5CMC A;  2XWV A;  5I3S A;  1R1N A;  2AYS A;  1NV6 A;  4H45 A;  4P3L A;  3ECR A;  3E4R A;  1FRP A;  2ESN A;  4H67 A;  4G68 A;  4UAC A;  5I2K A;  1IMC A;  1NUX A;  1MH4 A;  3HCQ A;  3GLB A;  4R74 A;  3BIG A;  1TXF A;  3MVX A;  3TCG A;  1YTV A;  2F36 A;  5CBR A;  3MW0 A;  3TPA A;  4F3P A;  5DT6 A;  4EUO A;  4G68 C;  2Z8E A;  4MX6 A;  2UYE A;  5L8D A;  4R9G A;  5H8H A;  1OQG A;  3KN8 A;  3W9V A;  4N6K A;  4NE4 A;  5H8S A;  1P1O A;  2OWT A;  3C32 A;  3E13 X;  2CZK A;  3L6G A;  2Q8M A;  2Q89 A;  4MF3 A;  2P2A A;  3O28 A;  4PQJ A;  1A99 A;  4JWY A;  1UTB A;  4X8R A;  1LFI A;  2I4B A;  3CFL A;  1H45 A;  1PBQ A;  4NF6 A;  3T22 A;  2V3T A;  1VE4 A;  2JJK A;  2O84 X;  3W9W A;  3MAM A;  4ZS9 A;  3K6W A;  3DM0 A;  5CC2 A;  1BTJ A;  1FPF A;  4BDQ A;  3A3C A;  1H43 A;  2ZZX A;  4ELQ A;  4AS5 A;  5FHO A;  2Y7R A;  1SYI A;  4PDD A;  5J1D A;  4RK2 A;  2V84 A;  5A5X A;  4FED A;  4NF5 A;  1JVX A;  3MPK A;  2Y7W A;  3IB2 A;  1WOD A;  4LP2 B;  1Y1M A;  3C36 A;  4NF4 B;  1TFA A;  4F3S A;  2I3V A;  4RJZ A;  4PF6 A;  3TEP A;  1IXC A;  3BFT A;  4N8G A;  1PBP A;  4JVC A;  4POW A;  2CEX A;  1MS7 A;  4PFT A;  1SI1 A;  3HO7 A;  4FAJ A;  3HFU A;  3TTR A;  2UVG A;  5ELV A;  4MIJ A;  5I58 B;  4OXV A;  1US5 A;  1AOV A;  5I5P A;  1VR5 A;  3IOU A;  1N3W A;  4NWC A;  4Q0C A;  5H8N B;  3UOR A;  2ZNU A;  3QSL A;  4ESW A;  3DP6 A;  1P1Q A;  1QUL A;  4PFW A;  2FVZ A;  2HZK A;  2ONS A;  4IGR A;  4OMB A;  3T9H B;  1D3K A;  4F19 A;  1R9Q A;  3C34 A;  4F1Y A;  1TFD A;  2OCU A;  3CHG A;  3FD3 A;  2DS9 A;  4MMP A;  3FJG A;  1QKB A;  4P0I A;  1SI0 A;  2D3I A;  4RA1 A;  1DTZ A;  2DYX A;  2XXT A;  4MNP A;  2PFY A;  1MG1 A;  3ZS6 A;  4PGP A;  5AA2 D;  5FTI A;  2KR0 A;  2RCA A;  3K1N A;  4JBZ A;  4OFL A;  2V3Q A;  1ZKB A;  3RGY A;  2R71 A;  4POX A;  4I62 A;  4KFQ A;  3K6X A;  2F3D A;  2QVR A;  1LBY A;  2GRV A;  1Q35 A;  3IO4 A;  3RLF E;  3SEW A;  1MPC A;  4AQ4 A;  1Y1Z A;  4EXK A;  3G3I A;  2DXR A;  3IJX B;  3HHG A;  4YAH X;  5ICT A;  3AXF A;  2Z22 A;  1BLF A;  2UVH A;  2XXR A;  2RIN A;  4GOT A;  1UTH A;  4Q8R A;  1M5C A;  1HSL A;  2HEU A;  4NTL A;  4ELR A;  4JWX A;  2OJT A;  5TP9 B;  4P11 A;  4ECF A;  1YPN A;  4I9D A;  2Z8F A;  1YXI A;  3S9M C;  1B5H A;  4XXU A;  3KSJ A;  4TOZ A;  1POY 1;  1LB9 A;  1FTJ A;  3UA8 A;  4JSD A;  3OEM A;  4ZE8 A;  1LBC A;  4EDP A;  4LN5 A;  3I3V A;  5DYH A;  3A3U A;  5KCJ A;  1EZO A;  1B05 A;  5TP9 A;  5EYF A;  2ZNT A;  3MZB A;  3IAZ A;  3QUF A;  1Q9D A;  2E1S A;  3G3J A;  4MAG A;  3PUY E;  3E78 A;  4P9K A;  4GWO A;  4XFE A;  3MJN A;  3N6T A;  1NV1 A;  1B5J A;  2XX7 A;  3RPL B;  2VPN A;  4K3F A;  2OLB A;  2XXX A;  4GWW A;  3H7M A;  3A29 A;  3LSW A;  3O6H A;  3PD8 A;  5IZ3 B;  2ZZW A;  2RF1 A;  4NF4 A;  2WYK A;  3TCF A;  2VOZ A;  4NHB A;  3H4Z A;  1FQA A;  2VHA A;  2ZXT A;  2PMS A;  1MXV A;  3QXM A;  1OMP A;  4JDF A;  5EHM A;  1FBC A;  5IGA A;  3KGC A;  3T66 A;  3ISP A;  1GVC A;  1KA1 A;  1B7U A;  3SEV A;  4HE1 A;  4N91 A;  4F2O A;  2DE3 A;  1Y3Q A;  5KZT A;  4YB6 A;  3TZA A;  2X7Q A;  4I8C A;  3R6U A;  1B0L A;  1GGG A;  3LV0 A;  3TYH A;  5CMB A;  1M5B A;  1CE2 A;  2F7B A;  2X7P A;  5DVJ A;  3KN7 A;  4AB6 A;  2QS1 A;  5TPA B;  3ONM A;  4KPT A;  2DVZ A;  1NV3 A;  5DVI A;  1ELJ A;  1EZP A;  2OK2 A;  5I56 B;  3Q27 A;  1H44 A;  4QXD A;  1B46 A;  3IOV A;  4OER A;  5CMM A;  2PCR A;  2VD3 A;  3FXQ A;  2UVI A;  3H6T A;  1K9Z A;  1FPK A;  4FJP A;  1DBZ A;  4GBV A;  3T93 B;  3RQT A;  3IL1 B;  3CG3 A;  3KN3 A;  3MYU A;  3LC8 A;  3TKD A;  3EQ1 A;  3S9L C;  1VDW A;  3K6U A;  4O94 A;  4AS4 A;  3OO7 A;  3I6V A;  1LAX A;  2Q8J A;  3DP4 A;  2ZYO A;  3P7I A;  2F35 A;  5H8N A;  4GX6 A;  4BDN A;  3OSQ A;  2QVV A;  1OQH A;  3U72 A;  1M5F A;  2OPE A;  4KQP A;  2PYY A;  2REJ A;  1NH8 A;  1IMA A;  2H99 A;  2XXQ A;  2QS4 A;  4MLQ A;  5IKB A;  3PUX E;  4FEB A;  1VFE A;  5ISU A;  5KDT A;  4KCD A;  3PU5 A;  3M3F A;  1JW1 A;  3E79 A;  4F18 A;  2QS2 A;  3HPI A;  3EF7 A;  4OYV A;  3OEL A;  1MXY A;  3LBS A;  5CI5 A;  4IO5 A;  4OHN A;  1MXX A;  4O3B A;  1G0H A;  3CSB A;  1SDX A;  4HE2 A;  1PB8 A;  3RYD A;  1IXH A;  3G3F A;  3RNN A;  2XXU A;  3FBP A;  3KJT A;  3OOA A;  4FOR A;  4JXI A;  1MY3 A;  4U23 A;  4ZDM A;  1N7X A;  1NUY A;  2O7U A;  2I0C A;  4PFB A;  3EN3 A;  3K01 A;  5ITO A;  3PPP A;  1ATG A;  1PB9 A;  3QAX A;  5FHN A;  5AA2 A;  2I48 A;  3MZ1 A;  4RNS A;  3RY3 A;  4GIZ A;  3LSL A;  2FIX A;  3VVD A;  4NF8 A;  4DLD A;  2NVU B;  1AL3 A;  1QUJ A;  2PX1 A;  4PFU A;  4ZE9 A;  5LTC A;  5AA3 A;  5DEX A;  4IO4 A;  4R2F A;  5I2K B;  2HXR A;  3FVK A;  1HSE A;  3CRB A;  5AE4 A;  4OTE A;  4RXL A; 
#chains in the Genus database with same CATH homology
 1QGX A;  3BIG A;  4GX4 A;  2FBP A;  4PTK A;  3PTY A;  4GWX A;  4MCO A;  3HFU A;  3KC1 A;  1RDX A;  4MJO A;  4G61 A;  3ROJ A;  3ISP A;  5IM2 A;  1JP4 A;  4GWZ A;  1CNQ A;  1KA1 A;  4MIJ A;  4HCW A;  1FPG A;  2DDK A;  4GWY A;  4HE1 A;  5DW8 A;  2MKZ A;  3NOH A;  2DE3 A;  3GYY A;  4HCY A;  1FJ9 A;  4N91 A;  4N4U A;  4OAN A;  4OVQ A;  4P1E A;  1FPI A;  4MX6 A;  1DK4 A;  4N17 A;  2GQ1 A;  2CZH A;  4N15 A;  4OA4 A;  1YXI A;  4YIC A;  4PET A;  4JVD A;  5J16 A;  1NI9 A;  5ET5 A;  3E79 A;  4PAK A;  4F18 A;  1BK4 A;  3LV0 A;  3W9V A;  4N6K A;  2Q74 A;  5ET7 A;  1EYI A;  2F3B A;  5I7I A;  3D1R A;  3BIH A;  4I3Y A;  2FIE A;  1FPJ A;  2QPQ A;  2VPO A;  4PAF A;  4DI3 D;  4PGN A;  4P47 A;  2FHY A;  4NF0 A;  4PFI A;  2WBB A;  2WBD A;  5IZ1 A;  3EKI A;  2Y5K A;  2CZK A;  2QFL A;  5ESY A;  3T1B A;  2FVZ A;  2HZK A;  1NV7 A;  1EYK A;  4I40 A;  2Q8M A;  4O7M A;  2Q9T A;  4JVI A;  1IMF A;  1FBF A;  4NQ8 A;  4O7I A;  5IZZ A;  1YZ0 A;  4HE0 A;  1G0H A;  4OVR A;  4F19 A;  4QBA A;  2R8T A;  2DVZ A;  4LN5 A;  2QVU A;  3B8B A;  1NV0 A;  1NV3 A;  5T3J A;  5EQA A;  2B4M A;  2F5X A;  4XF5 A;  4GWS A;  4X8R A;  4HE2 A;  3CHG A;  1IME A;  1FBE A;  1EYJ A;  1RDZ A;  4H46 A;  5IGA A;  1FSA A;  4PC9 A;  4MMP A;  4X9T A;  4HXV A;  1FBD A;  1FPL A;  5I5P A;  1G0I A;  3IFC A;  3RYD A;  5CM6 A;  1FPE A;  2HHM A;  4PDH A;  1NUZ A;  4QXD A;  3FBP A;  1IMB A;  2XA5 A;  4N6D A;  4NGU A;  4MNC A;  3FXB A;  4P8B A;  2WYP A;  5F24 A;  2DE2 A;  4F1U A;  2OWZ A;  2PCR A;  2VT5 A;  1Q9D A;  4I3E A;  4MHF A;  4FBP A;  5EQ9 A;  5ET6 A;  2JJK A;  4PF8 A;  1FBG A;  2L5V A;  1K9Z A;  2P3V A;  2XWK A;  1INP A;  1FPK A;  4MAG A;  4MNP A;  3W9W A;  4GWU A;  4N81 A;  3E78 A;  2PFY A;  1NUY A;  1DBZ A;  1AWB A;  4GBV A;  1K9Y A;  3QMF A;  5EYH A;  5LDZ A;  4P9K A;  1IMD A;  4PGP A;  5EQ8 A;  4PFB A;  2V4C A;  1LBV A;  1YYZ A;  2KR0 A;  4X04 A;  4PFR A;  4XFE A;  5A5L A;  1FPF A;  1NUW A;  2V3Q A;  2WX9 A;  1DCU A;  2P3N A;  5FBP A;  1FJ6 A;  2B4L A;  1NV4 A;  2HZL A;  4XEQ A;  2DE4 A;  4NAP A;  1NV1 A;  1XI6 A;  2ZZX A;  4AS5 A;  3MYU A;  3IFA A;  4OVT A;  4PCD A;  5JK4 A;  2Y5L A;  4NX1 A;  3U65 A;  3KC0 A;  4PDD A;  5J1D A;  3RPL B;  1KA0 A;  4PE3 A;  2BJI A;  2XWI A;  2F3D A;  3B50 A;  5EQ7 A;  3RPL A;  2OX3 A;  2VPN A;  4P1L A;  2ZZV A;  1LBZ A;  1VDW A;  4MNI A;  2QVR A;  1LBY A;  1KZ8 A;  4O94 A;  4GX3 A;  3KBZ A;  3LUZ A;  1LEV A;  1NV5 A;  4GWW A;  4AS4 A;  2FIX A;  2XXK A;  3A29 A;  4MEV A;  1FPD A;  4IR8 A;  1RDY A;  4NG7 A;  5IZ3 B;  1NV2 A;  2ZZW A;  4GBW A;  2WYK A;  2WEF A;  4OVS A;  1FPB A;  5ET8 A;  1LBW A;  2HPG A;  4M1V A;  4P56 A;  4GX6 A;  4NHB A;  4UAB A;  3SZP A;  4DI4 B;  5EYG A;  4NN3 A;  1FBH A;  3T0J A;  2XWV A;  5I3S A;  2CZI A;  1SPI A;  4PAI A;  5LTC A;  2PFZ A;  4PBH A;  2CEY A;  1NV6 A;  4H45 A;  2KQZ A;  3MST A;  1FTA A;  4P3L A;  1FBP A;  2QVV A;  4OVP A;  4PF6 A;  5IZ3 A;  4F1V A;  4N8G A;  1FRP A;  4JVC A;  1D9Q A;  2HXR A;  4YZZ A;  4N8Y A;  4PBQ A;  2CEX A;  4KXP A;  1IMC A;  4O8M A;  1NUX A;  1LBX A;  1FBC A;  1IMA A;  2XWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...