2FIEA

Structure of human liver fbpase complexed with potent benzoxazole allosteric inhibitors
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
327
structure length
318
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Benzoxazole benzenesulfonamides as allosteric inhibitors of fructose-1,6-bisphosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 98
structure length 318
sequence length 327
chains with identical sequence D, H, L
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2005-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2fieA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2fieA02
1FBCA 3D1RA 1G0IA 1RDYA 1QGXA 4FBPA 5IZ3A 3RPLB 1NV6A 4I3YA 2P3NA 3RPLA 3RYDA 1LBYA 5LDZA 1DBZA 5DW8A 2BJIA 2CZKA 2FHYA 4HE0A 1FSAA 1FBHA 2OWZA 4O7IA 5ET5A 1IMEA 1K9ZA 1FBPA 5T3JA 2Q8MA 1FPBA 2QVUA 3FBPA 4GWZA 4KXPA 4G61A 1DCUA 2CZHA 5EQ7A 1G0HA 5IZ3B 1NUWA 3IFCA 5EQ8A 1CNQA 4GX6A 4GWWA 1DK4A 1NI9A 1FJ6A 2FBPA 3IFAA 2QVVA 1NUZA 3ROJA 5J16A 1IMCA 2GQ1A 5IZ1A 1YXIA 2P3VA 3LV0A 1EYIA 1FPEA 5EYGA 2Y5LA 1FPIA 1INPA 4I40A 1NV1A 4H46A 1NV2A 4HE2A 5ET6A 1NV3A 1FBEA 1LBWA 4QXDA 5ESYA 1FJ9A 5FBPA 2CZIA 1BK4A 1RDXA 1KA1A 1NV5A 1FPDA 2F3BA 1VDWA 4GWXA 2FVZA 2PCRA 4GX3A 1EYKA 3KBZA 3QMFA 5ET7A 1LBXA 2R8TA 1IMFA 5EYHA 5A5LA 5EQAA 4HE1A 2WBBA 1D9QA 3BIGA 1NV7A 1AWBA 1XI6A 1FRPA 1IMBA 3B8BA 1IMAA 5I3SA 1FPGA 4PTKA 3T0JA 5ET8A 5F24A 1KZ8A 2F3DA 1JP4A 1LBVA 3A29A 1FBDA 4AS4A 1LBZA 4GX4A 1FPFA 2WEFA 1FBGA 1FBFA 2QVRA 4N81A 4GBWA 2VT5A 1EYJA 2JJKA 2Q74A 2Y5KA 2FIEA 1FPKA 1LEVA 1FPJA 1NUYA 1SPIA 1KA0A 4I3EA 2FIXA 1YZ0A 1RDZA 3KC0A 4GWYA 1IMDA 1NUXA 1YYZA 3KC1A 1NV4A 2DDKA 4GWSA 2QFLA 2WBDA 1FPLA 4GBVA 4GWUA 2HHMA 1NV0A 3BIHA 3LUZA 4IR8A 1K9YA 4H45A 1Q9DA 4HXVA 5EQ9A 4MJOA 4AS5A 2OX3A 1FTAA
chains in the Genus database with same CATH superfamily
1JEVA 4WKMA 3OO6A 2DVCA 1MQGA 3RPLB 4I3YA 3RYDA 1LCFA 2I48A 2I4CA 5FTIA 4R72A 2IEEA 3IB2A 4R9GA 5IGAA 4POXA 4R9FA 3RN8A 3KGCA 5FTHA 3G3KA 4XKRA 3PU5A 4PC9A 4PFBA 1B1XA 5DVJA 4C1UA 4FE8A 3K00A 1ZMGA 4ZEFA 2ZZXA 1GV8A 1MQHA 2Y7WA 4QHQA 4ZS9A 2XXIA 3H6TA 3Q25A 2CEYA 4MF3A 4O3CA 1FBEA 3IJOB 3E78A 3KJTA 2CZIA 4BDLA 4LZ5A 3K6UA 2ZNUA 4FECA 1VDWA 5FHMA 4GWXA 2I4BA 3IX1A 1HSEA 3PTYA 2Y7PA 3CFXA 3B8BA 3VE1B 2MKZA 2UVIA 4OQOA 1FBDA 3MVWA 1UIUA 1FBGA 2VT5A 1OLAA 3PPOA 3DP6A 2FIEA 1LFIA 3TCFA 1R1NA 1IMDA 2QS1A 3KN7A 3JZJA 4F3SA 4N6PA 5ITPA 1AMFA 2QSXA 3EHUA 2VP1A 3BFUA 1PB8A 2VGQA 4NF8B 2V3TA 1SVXB 5ITOA 1RYOA 2CZLA 2FA7A 5LDZA 1DBZA 2CEXA 1SW4A 5I59A 4X1DA 2E0SA 3O29A 1XVXA 3RTWB 4LQ5A 1P1OA 2VD2A 1R9LA 2XXHA 2Q8MA 3TPAA 3GZGA 2QVUA 1CE2A 3KN3A 4RK9A 4F2OA 4C0RA 2BJJX 1QULA 3FV1A 2WYPA 4O94A 2O7UA 2GQ1A 3JV9A 4U4XA 4X04A 2Q9TA 3CR9A 4AB6A 3MVZA 3TODA 5EYGA 2H4IA 1ZTYA 2PX1A 5IM2A 3UIFA 4ZECA 4EQ9A 1DPEA 2ZYKA 4EDPA 3TZAA 4ZE9A 3UP9A 1LBWA 1BK4A 3VFJA 3C32A 3RGYA 1SBPA 3A09A 1L5TA 5ET7A 4DDDA 4N17A 3EHSA 4MH5A 1FQAA 5DVIA 3BIGA 1QVSA 2HFBA 2O84X 1MRPA 3GBBA 4RA1A 3TCGA 1PC3A 4KYEA 1FBFA 4H67A 2Y5KA 4P0IA 1NUYA 1VFDA 4TOZA 1NKXA 3PD8A 1XS5A 4LVQA 4GBVA 4QFOA 5B7DA 4KI0E 2RC8A 4H45A 4LN5A 2DQVA 1FTAA 3T22A 3SEYA 4GQOA 1MY3A 3A3CA 3IK6B 3OD7A 4ZEIA 1XT8A 3CG1A 5HPQA 4XIGQ 4ELPA 4U2RA 3QUJA 5KCJB 3PV0E 3TEPA 3C35A 5AA2D 4TQUQ 4GWWA 1ZBMA 2FBPA 1NUZA 2Y84A 3U93A 5I84A 3O9PA 1PEBA 1B7UA 2O68A 3LSXA 4H46A 3PMXA 4ZE8A 1FQCA 3CI8A 4QFNA 4K3FA 4R2BA 1OLCA 1P1UA 1VFEA 1IXGA 2PFZA 4XEQA 5AA2A 4IO2A 3E13X 3PMWA 2FYIA 3V83A 1AWBA 4DXUA 5CI5A 1FRPA 2X7QA 2PT1A 4OHNA 3PPRA 1Q35A 3GBAA 3PUVE 1NFTA 4I62A 4GX4A 1KWHA 4KHZE 2B65A 4BDQA 1AOVA 1FCKA 1FPKA 4M4GA 2ESNA 1N7XA 1NV4A 3T93B 5LOMA 4PBHA 2HEUA 5EHMA 4OA4A 3D1RA 1A54A 1FQFA 3DM0A 2P3NA 2PYYA 2XXVA 4IO6A 3TMGA 1IQ7A 3FZVA 1J1NA 2REGA 4EXLA 4KPTA 4O7MA 2O69A 4Z0IA 3FXQA 4C1TA 4ELQA 3WAFA 5IZ3B 4F1VA 1GR2A 3OO9A 5EQ8A 2DE4A 2OZZA 4PF8A 2F7AA 4PFRA 1DSNA 1MQJA 2H99A 4PE3A 4PFUA 2W7YA 2R9JA 3LV0A 3OEMA 4ONYA 4F18A 3P7IA 3ONMA 5FHNA 3HFUA 4R75A 3EKIA 2FNCA 4FAJA 3WAEA 3E3KA 2FVZA 1I6BA 1EU8A 1IMFA 1BTJA 3KFMA 5LTCA 4OYVA 4HTGA 4BDMA 4PE5B 2HXRA 5ET8A 4OERA 2KR0A 1BP5A 1LB9A 2Z8DA 2XWIA 1JW1A 2XXKA 3VLWA 2QVRA 4N81A 4H5FA 4BDRA 3B7DA 2NVUB 4DLDA 4O3BA 1LEVA 4XFEA 5CRYA 3H03A 2FIXA 1ANFA 1MPCA 3ODBA 3KC1A 1IITA 4H5GA 1PBQA 1FPLA 5H8FB 1K9YA 1MXUA 2QMWA 5AA4B 4AS5A 4X8RA 4RY1A 3KEIA 2NUVA 3O28A 4U4SA 5IZ3A 2RC9A 1SD3A 4YKKA 1B7HA 3CFLA 3MAMA 3MQ9A 3SEWA 4H0WA 2D5WA 4LA9A 4JVDA 1N84A 3EN3A 1DMBA 2DE3A 4PFTA 2QS2A 1B9JA 2UYEA 3CFZA 2Z22A 4GXSB 2F6PA 2CZHA 3IOUA 3C31A 3UK4A 4U22A 4TLLB 3FJGA 3GXAA 3AXFA 4MFIA 4BDNA 3HPIA 3IORA 2P3VA 1OMPA 2IA4A 4OTEA 4FORA 1LSTA 3LSLA 1B5IA 5ET6A 4KCCA 4YZZA 3TDJA 2XWVA 4NF6A 1TFDA 5H8HA 1SW2A 4Q8RA 2V84A 1IZ1A 3PUWE 4RPOA 2AL4A 5A5LA 1LAXA 5H8NA 4AB5A 1Y1ZA 1QKBA 5CC2A 3E9XA 4N6KA 5H8FA 3MVXA 1SW1A 1Z7NE 4OEVA 3KN8A 1ZU0A 1KZ8A 1LFGA 4F3GA 1O63A 3BFTA 1H76A 1MY2A 3IOWA 3FXBA 3IOTA 1OIBA 3OSRA 4ELOA 3S9LC 2A5SA 1Q9DA 4HXVA 4ZEKA 2V3QA 2OX3A 2H98A 3O6IA 5KDTB 1FTJA 5TPAB 2GHAA 3MZBA 4NAPA 2B3FA 1NMUA 5H8SA 1B51A 3B6QA 1LAFE 4YB5A 3MC2A 2R6GE 4X9TA 3H6WA 2XWOA 1FSAA 3E4RA 3MP1A 4R73A 3IL1B 1Y3QA 1GVCA 1NL5A 1FPBA 2V25A 3FBPA 2QMXA 4MLQA 2Q2AA 1Y1MA 1NI9A 1ZKBA 3VDFA 2RCBA 4NX1A 2F7CA 4H8IA 3UN6A 4FEBA 3TCHA 4QSEA 1QUIA 3M8UA 1FPIA 3CSBA 5F1QA 5I5PA 4G68B 4GL8A 2F35A 1JQFA 4JXIA 5J1DA 2DWAA 1MXWA 1FJ9A 4F1UA 3W9WA 4EXKA 2OWTA 4G68C 2F7BA 2GHBA 2L5VA 1NNKA 1US4A 5DEXB 1FTOA 3HHGA 1MY1A 4OVRA 4G2ZA 1FPGA 3RT8A 3FD3A 3MZ1A 2P1SA 4UA8A 3S4UA 3G3IA 4GWOA 3SEXA 1D4NA 4KD5A 2D3IA 2JJKA 2ONRA 3H4ZA 1QW0A 2I0CA 2VOZA 4O8MA 4QRZA 1YZ0A 2F5XA 1NUXA 3N94A 1I6QA 2DXYA 5AE4A 4MIJA 4HW8A 3T1BA 3M3FA 4MJOA 1MG1A 4H8JA 1FW0A 1IXIA 3RPLA 4UACA 5DW8A 4LP2B 3B50A 4QF9A 2DOJA 3RPWA 2F36A 1Y3NA 4U23A 4FEDA 4FIMA 1N0TA 1UTHB 4ESXA 2O51A 3A3UA 5I58B 4OWDA 1USYE 1CNQA 4DIGA 1LFHA 5B70A 5J16A 4ZDMA 2Y5LA 2B4MA 3S2VA 1MXZA 3F11A 3LSFB 1MY0A 3FASA 4NF5B 3LSWA 3RNNA 2I58A 4XF5A 5ESYA 3H06B 4P3LA 2ZNSA 2UVJA 3HSTA 2HAUA 3KBZA 1LBBA 1AIVA 4RPNA 4L17A 3G3HA 2VPNA 2OPEA 4HE1A 1PBPA 1RKMA 1Y4CA 3U8QA 1Y20A 5DT6A 2F3DA 1BIYA 3PGFA 3IO4A 5I2NB 5IAIA 2ONSA 2OJTA 3LBSA 1P1QA 3UA8A 3N6TA 1VR5A 1P99A 1IEJA 3OO8A 4H6DA 1F9BA 3RT6B 4PP0A 4GWSA 4OENA 5CBRA 3VVFA 1MQIA 3ZKKA 3D4GA 5CMKA 1UTHA 1DPPA 4QFPA 2Y7KA 4FBPA 4NF8A 1B0LA 1HSJA 3VVEA 3BBRA 1B05A 4MHFA 4X48A 1FTLA 1JW5A 2O7IA 5A5XB 3R26A 1FBPA 5T3JA 3SEUA 4PQJA 2THIA 4DCYA 1DCUA 3RUMA 1DK4A 2Z23A 1IIWA 1GTKA 4RXLA 3ZKLA 4JVCA 1BKAA 2KQZA 1TXFA 3PPPA 4I40A 3FJ7A 3ILUB 3OELA 5I2KB 4Z7EA 4R2FA 3T66A 3I5OA 4N91A 4JSDA 4G8MA 1YCJA 1B4ZA 3VXBA 4KCDA 4GX3A 1B3FA 3T9VA 4U1ZA 3K4UA 1POY1 1NNFA 3UGWA 3S9EA 2Q2CA 5I57B 1FTKA 3OENA 1D9VA 3CRBA 2XWKA 2DSFA 1URDA 1JP4A 3H6VA 3QYTA 3HV1A 4IO4A 1NNPA 3O66A 1EYJA 2D21A 4KQPA 4MX6A 4NN3A 4P1EA 3MYUA 3FXRA 2F6GA 1DTGA 3FV2A 5DTBA 3PUZE 4QFLA 4F22A 2H5YA 5A5XA 2X26A 4KFQA 1B3EA 4FJPA 3PMVA 4QBAA 4GVOA 3C9HA 1DOTA 2OK2A 3IO6A 2Y7IA 1Z7ME 5L9SA 4HCYA 5K2YA 4WXJA 1Y3PA 1JVXA 4DXBA 4Q30B 4GFRA 4OZ9A 4GIZA 5I2KA 3QXMA 1B3LA 5DYHA 1FQBA 3M3LA 3O97A 5KCJA 4F2QA 5I7IA 1VSOA 2QVVA 4YB7A 3G3JA 1M5FA 3K1NA 4F1YA 5I57A 4WEDA 2G29A 1QKAA 1ZIUA 3FVGA 1NV3A 4IY6A 1KA1A 4F3PA 4OVQA 3HCQA 3N26A 4YKPA 2I49A 1A8FA 1H43A 1IXHA 1B7ZA 1LBVA 4M1VA 1S9TA 3U94A 4P1LA 4Q0CA 2REJA 5CBSA 1N3WA 2Q74A 1JVYA 4PFWA 1N7WA 1I69A 4N15A 2XX8A 3N5LA 5KZTA 4LZ8A 5EYFA 2A5TB 1XVYA 3KZGA 3TTRA 2DDKA 2XXPA 2XXYA 4XKQA 2RC7A 3BIHA 2QL3A 2I3WA 2DWJA 2XA5A 4KYSA 3PUXE 4OXVA 4TLMB 1FQDA 1MS7A 1IUDA 1II5A 3FVNA 4F19A 1LBYA 1H44A 4P56A 1MXXA 3K01A 4PAIA 1N04A 3TFLA 2P0SA 2F97A 3EF7A 3B6WA 4G61A 2V4CA 2ZNTA 1H3DA 1D9YA 2VHAA 4JWOA 4YMAA 1EZ9A 1PB9A 2H25A 2O1LA 1A8EA 1TWYA 4Q5TA 1FPEA 3C33A 4DCXA 4N8YA 1WDNA 1I6AA 3V89B 2O6AA 4GD5A 2XXQA 3G3GA 2NXOA 3IAZA 1EYKA 2WYKA 1BLFA 4BDOA 5JTYB 4N13A 3KJ7A 2XD2A 3Q27A 1T0KA 1M5BA 4ZZAA 2E1SA 1OVBA 3KSXA 5HBCA 2NOOA 2PT2A 2WX9A 3T9UA 4NWDA 2ZZWA 4POWA 4PFYA 3VLVA 1SQYA 4IY5A 4EQBA 4GWYA 4OVSA 4OETA 4MAGA 1SDXA 2GH9A 1OVTA 2VPOA 4JBZA 3TTLA 5AA4A 3DP4A 4H1XA 2QPQA 1SI0A 3PUYE 3K6WA 1URGA 3KG2A 3K02A 1MH4A 3D4CA 2RF1A 4NGUA 2FHYA 1B52A 4HE0A 4O7IA 2XHDA 4PAFA 1XC1A 1FTMA 3QIMA 3Q26A 3KBRA 4WEPA 1OQGA 4GWZA 4LUBA 4E0WA 2OWSA 3G7WA 1G0HA 3MVYA 4UABA 4GX6A 5JTYA 1OQHA 1EZOA 1IMCA 1YXIA 3PPNA 1MDP1 4GRKA 1INPA 1NV1A 4U1OA 3DP8A 3ZS6A 1R6ZA 4PFIA 5CM6A 3MUQA 1US5A 3O2AA 1RDXA 2F3BA 1SW5A 3I3VA 3VLUA 3QMFA 2XX9A 1M5DA 1B2HA 2DWIA 1D9QA 1P1NA 5L9OA 2DE2A 2OCUA 3SZPA 1IMBA 4LONB 5I3SA 3K6XA 2F78A 1WODA 4OMBA 3FVOA 3IJXB 1FPFA 1JEUA 5DVFA 1B46A 4GXAA 1LBCA 4NEDA 4GOTA 4OFOA 2ZZVA 4XKPA 3IR1A 1LLSA 3FXUA 1SYIA 2XXTA 2HHMA 3LUZA 4MCOA 4G8NA 4THIA 4EF2A 1FBCA 3OMBA 3FIRA 4PF6A 3FGSA 1D3KA 5KDTA 1QGXA 1B5JA 2Y7RA 1NV6A 4HS7A 5TPAA 4G8HA 4MNIA 2ABHA 2BJIA 1DTZA 1JW4A 5I59B 4I9DA 4EF1A 1MM7A 1UQWA 3MZ9A 4F3BA 1IMEA 3S9NC 3U65A 4GF8A 3C34A 4YICA 1NNTA 1M5CA 4KXPA 2XXUA 1GGGA 3H7MA 5EQ7A 5HM4B 2Q89A 2V3UA 3L6HA 3TKDA 1LGBC 2DP8A 2M8CA 3ROJA 1Y9UA 1PB7A 5CMMA 4PGPA 3FVKA 4G68A 4HE2A 1MXYA 3PD9A 1NV5A 4JSOA 4N4UA 3QSLA 3SEVA 2B3BA 3K1MA 2PMSA 4PCDA 1ZJLA 3Q28A 3ISPA 1LAHE 5EYHA 4LZ7A 5DEXA 2WBBA 2DS9A 1XI6A 2RINA 2RCAA 1HSLA 3RTFB 1B58A 4XKNA 4I1DA 3KOSA 4OVPA 1NH8A 1LB8A 3MP8A 4RK2A 1WVJA 2YPNA 3W9VA 1KA0A 4MNPA 2VD3A 4NF4B 3USDA 2QFLA 4IB2A 4XTCQ 3KSJA 4MMPA 3R7XA 4X1BA 1JNFA 4G4PA 3Q29A 4QFKA 4P8BA 2ZYMA 5TU0A 4R6KA 1ELJA 3I6VA 3B6TA 4PGNA 2I6EA 2DXRA 5H8QB 3W15C 2ZYNA 3IB0A 2UYFA 5I58A 1IXCA 3IFCA 4RYAA 3U1OA 3IFAA 4P11A 1P1WA 3ECRA 4IGRA 2G93A 1POTA 1A99A 3SDFA 1EYIA 2CMOA 2AYSA 1VE4A 1NV2A 4NF5A 3MJNA 5L8DA 1AH5A 1XOCA 1B1HA 4ELRA 3OOAA 4OANA 2PFYA 4EUOA 5AA2B 4DZ1A 1Q1KA 5EQAA 2B4LA 4LATA 3ILTB 2UVHA 4NF4A 3MPKA 4QSDA 4PAKA 4QSCA 2DYXA 4NTLA 4E0XA 4N6DA 5I2NA 2GFEA 4N07A 2WEFA 2XD3A 4GBWA 4R74A 4OESA 1R9QA 4OFLA 3EQ1A 1RDZA 3KC0A 3RQTA 3R6UA 3EHTA 4F31B 4YB6A 3E79A 5AA1A 5EHSA 2KLFA 1YTVA 4N8GA 1MDQA 4JDFA 5H8QA 4OVJA 4DI3D 2HZLA 4PBQA 1G0IA 1MH3A 3GLBA 2NWJA 3DLNA 4ECFA 5ISUA 1ZLQA 2Z8FA 4LQ2A 1A55A 3K6VA 3EPEA 2ZXTA 4NQ8A 2CZKA 1O64A 4PDDA 3MWBA 1USYH 1A40A 1B32A 4JVIA 3THIA 3FJMA 2Q88A 4YKJA 3DELB 1LCTA 3K0VA 4F39A 4MLVA 4YAHX 4YKIA 1FJ6A 2GRVA 3SESA 3CHGA 3OXNA 4OFJA 3IB1A 2YLNA 3HHFA 3T96B 1TFAA 4IO5A 1EZPA 3HN0A 3GYYA 2LAOA 4F29A 4NMYA 3CIJA 2HQ0A 5FBPA 1MQDA 4P47A 4IO7A 4FATA 3VV5A 1B40A 1B6HA 1B3HA 1A7LA 3TAJA 2QS4A 1SYHA 1QUJA 4ND9A 5ELVA 4KYDA 1NV7A 1YPNA 2OLBA 5ICTA 4U21A 4R6YA 2AL5A 4RNSA 3MSTA 5JK4A 2HZKA 4JWXA 4HCWA 3MW0A 4NE4A 4ZEBA 3LC8A 5AA3A 1MXVA 1SPIA 4I3EA 4GL0A 1S50A 2F8DA 3S9MC 1FQEA 1B4HA 3OO7A 1NV0A 2X7PA 2XX7A 4KR5A 1MM6A 3LUYA 1MY4A 2XXXA 3VVDA 1N76A 4MBPA 5F7VA 2XXRA 1QJMA 3UORA 3BKIB 3TTMA 3QK6A 4YU0A 1QUKA 1ATGA 1FBHA 2OWZA 2V93A 5ET5A 1K9ZA 3T9HB 3TUSA 4P0GA 1PDAA 4DI4B 2OPDA 4DE8A 5I56B 2R71A 5ICQA 3U92A 2ZMBA 2ALUA 2HCAA 3TTNA 5IZ1A 2OBGA 3IOVA 2HXWA 3RLFE 4ESWA 2RKMA 4RJZA 3U72A 2O1MA 3H6UA 3H3GA 1YAEA 1UTBB 2DVZA 3SETA 4IGTA 4I8CA 4NF6B 2QS3A 5H8HB 2I0BA 2PCRA 4GLIA 3SERA 1JETA 3LR1A 3QAXA 1LBXA 5IKBA 4NHBA 5H8NB 2XXWA 3OSQA 3TQWA 1IMAA 2PVUA 2HPGA 3M3KA 4PTKA 5BWJA 4EQ7A 3A29A 3TYHA 2YJPA 4AS4A 1Y4TA 1LBZA 5TP9B 2I3VA 3NOHA 5BUUA 1B5HA 3V8XB 1N3XA 1TT1A 4R6HA 1B0HA 4AQ4A 4ZZEA 4PETA 3ZSFA 2A5TA 4OVTA 5L9MA 2WBDA 2F34A 4H65A 1MPDA 1XHYA 4BLAA 4GWUA 3MPLA 2H9BA 4IR8A 2ZYOA 3K2DA 1NH7A 4NF0A 4O3AA 5JEIA 2ONKE 3G3FA 3RY3A 1RDYA 3TELA 5I56A 3FATA 4NG7A 4MNCA 3JYRA 5K2XA 3T9XB 3C4MA 3CVGA 1URSA 1B3GA 1SI1A 4ISUA 2QJEA 2UVGA 5CMCA 1UTBA 1O7TA 1NUWA 1RYXA 2Z8EA 1LAGE 1UIVA 1CB6A 3O6HA 2Q8JA 3OEKA 2WKYA 4MEVA 3CSGA 3FUZA 3N6UA 3TQLA 4IO3A 1S7YA 2QRYA 4QXDA 2P2AA 5TP9A 2PBWA 2DWHA 1FPDA 4XXUA 4ZEDA 5IZZA 3L6GA 2ANJA 2AIXA 3CG3A 2R8TA 4PDHA 3TTKA 4P9KA 3K1PA 3MP6A 3SKPA 4G77A 3T0JA 4YMBA 5F24A 5M2VA 3HO7A 3VXCA 4DXCA 4JWYA 1MPBA 4OEUA 4JB7A 3V5AA 1FPJA 3C36A 2UXAA 1AL3A 1YYZA 3O6GA 1M5EA 1EH3A 1H45A 3QUFA 5CMBA 5FHOA 3PPQA 3KOTA 5EQ9A 4NWCA 2HAVA 3MBPA
chains in the Genus database with same CATH topology
5IZ3A 3RPLB 4I3YA 3RYDA 4HCYA 4P8BA 4JVDA 5IGAA 2DE3A 4PGNA 2CZHA 5I7IA 3IFCA 4PC9A 4PFBA 3IFAA 2QVVA 2ZZXA 2P3VA 1EYIA 2CEYA 1NV2A 5ET6A 1NV3A 1FBEA 3E78A 4YZZA 2CZIA 1KA1A 4OANA 2XWVA 2PFYA 1VDWA 4GWXA 4OVQA 5A5LA 3PTYA 5EQAA 2B4LA 4PAKA 4N6KA 3B8BA 2MKZA 1KZ8A 1LBVA 4M1VA 1FBDA 4N6DA 4P1LA 2WEFA 1FBGA 4GBWA 2VT5A 2Q74A 2FIEA 4N15A 1RDZA 3KC0A 3FXBA 1IMDA 2DDKA 3E79A 3BIHA 1Q9DA 4HXVA 4N8GA 2XA5A 2V3QA 2OX3A 4DI3D 2HZLA 4PBQA 1G0IA 4NAPA 4F19A 1LBYA 4P56A 5LDZA 1DBZA 2CEXA 4X9TA 4NQ8A 2CZKA 4PAIA 2XWOA 1FSAA 4PDDA 4JVIA 2Q8MA 1FPBA 2QVUA 3FBPA 4G61A 2V4CA 1NI9A 1FJ6A 2WYPA 4O94A 3CHGA 4NX1A 2GQ1A 4X04A 2Q9TA 1FPEA 5EYGA 1FPIA 5I5PA 5IM2A 3GYYA 4N8YA 5J1DA 1LBWA 1FJ9A 5FBPA 4F1UA 1BK4A 3W9WA 4P47A 2L5VA 1EYKA 2WYKA 5ET7A 4N17A 3BIGA 4OVRA 1NV7A 1FPGA 3MSTA 5JK4A 2HZKA 4HCWA 2WX9A 1FBFA 2ZZWA 2JJKA 2Y5KA 4O8MA 1NUYA 1SPIA 4I3EA 1YZ0A 2F5XA 4GWYA 1NUXA 4OVSA 4MAGA 4MIJA 4GBVA 1NV0A 2VPOA 3T1BA 4H45A 4MJOA 4LN5A 1FTAA 2QPQA 3RPLA 5DW8A 4NGUA 2FHYA 4HE0A 4O7IA 1FBHA 2OWZA 5ET5A 3B50A 1K9ZA 4PAFA 4GWZA 4DI4B 1G0HA 4UABA 1CNQA 4GX6A 4GWWA 2FBPA 1NUZA 5J16A 1IMCA 5IZ1A 1YXIA 2Y5LA 2B4MA 1INPA 1NV1A 4H46A 4PFIA 5CM6A 4XF5A 5ESYA 2DVZA 4P3LA 1RDXA 2F3BA 2PFZA 2PCRA 3KBZA 4XEQA 3QMFA 1LBXA 4NHBA 2VPNA 4HE1A 1D9QA 2DE2A 1AWBA 3SZPA 1FRPA 1IMBA 1IMAA 2HPGA 5I3SA 4PTKA 2F3DA 3A29A 4AS4A 1LBZA 4GX4A 1FPFA 3NOHA 1FPKA 2ZZVA 4PETA 1NV4A 4OVTA 4GWSA 2WBDA 4GWUA 2HHMA 3LUZA 4IR8A 4PBHA 4NF0A 4OA4A 4MCOA 1FBCA 3D1RA 4PF6A 1RDYA 1QGXA 4FBPA 1NV6A 2P3NA 4NG7A 4MNCA 4MNIA 2BJIA 4MHFA 1IMEA 3U65A 4O7MA 1FBPA 5T3JA 4YICA 4KXPA 1DCUA 5EQ7A 5IZ3B 1NUWA 4F1VA 5EQ8A 2DE4A 1DK4A 4PF8A 4PFRA 4PE3A 3ROJA 3LV0A 4JVCA 4PGPA 2KQZA 4MEVA 4I40A 4F18A 4HE2A 3HFUA 4QXDA 3EKIA 1NV5A 4N91A 1FPDA 4N4UA 5IZZA 2FVZA 4GX3A 4PCDA 3ISPA 2R8TA 1IMFA 5EYHA 4PDHA 2WBBA 4P9KA 5LTCA 1XI6A 2HXRA 3T0JA 2XWKA 5ET8A 5F24A 1JP4A 2KR0A 4OVPA 2XWIA 2XXKA 2QVRA 4N81A 1EYJA 4NN3A 4MX6A 4P1EA 3MYUA 3W9VA 1LEVA 4XFEA 1FPJA 1KA0A 2FIXA 4MNPA 1YYZA 3KC1A 2QFLA 1FPLA 1K9YA 5EQ9A 4AS5A 4X8RA 4MMPA 4QBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBC A;  3D1R A;  1G0I A;  1RDY A;  1QGX A;  4FBP A;  5IZ3 A;  3RPL B;  1NV6 A;  4I3Y A;  2P3N A;  3RPL A;  3RYD A;  1LBY A;  5LDZ A;  1DBZ A;  5DW8 A;  2BJI A;  2CZK A;  2FHY A;  4HE0 A;  1FSA A;  1FBH A;  2OWZ A;  4O7I A;  5ET5 A;  1IME A;  1K9Z A;  1FBP A;  5T3J A;  2Q8M A;  1FPB A;  2QVU A;  3FBP A;  4GWZ A;  4KXP A;  4G61 A;  1DCU A;  2CZH A;  5EQ7 A;  1G0H A;  5IZ3 B;  1NUW A;  3IFC A;  5EQ8 A;  1CNQ A;  4GX6 A;  4GWW A;  1DK4 A;  1NI9 A;  1FJ6 A;  2FBP A;  3IFA A;  2QVV A;  1NUZ A;  3ROJ A;  5J16 A;  1IMC A;  2GQ1 A;  5IZ1 A;  1YXI A;  2P3V A;  3LV0 A;  1EYI A;  1FPE A;  5EYG A;  2Y5L A;  1FPI A;  1INP A;  4I40 A;  1NV1 A;  4H46 A;  1NV2 A;  4HE2 A;  5ET6 A;  1NV3 A;  1FBE A;  1LBW A;  4QXD A;  5ESY A;  1FJ9 A;  5FBP A;  2CZI A;  1BK4 A;  1RDX A;  1KA1 A;  1NV5 A;  1FPD A;  2F3B A;  1VDW A;  4GWX A;  2FVZ A;  2PCR A;  4GX3 A;  1EYK A;  3KBZ A;  3QMF A;  5ET7 A;  1LBX A;  2R8T A;  1IMF A;  5EYH A;  5A5L A;  5EQA A;  4HE1 A;  2WBB A;  1D9Q A;  3BIG A;  1NV7 A;  1AWB A;  1XI6 A;  1FRP A;  1IMB A;  3B8B A;  1IMA A;  5I3S A;  1FPG A;  4PTK A;  3T0J A;  5ET8 A;  5F24 A;  1KZ8 A;  2F3D A;  1JP4 A;  1LBV A;  3A29 A;  1FBD A;  4AS4 A;  1LBZ A;  4GX4 A;  1FPF A;  2WEF A;  1FBG A;  1FBF A;  2QVR A;  4N81 A;  4GBW A;  2VT5 A;  1EYJ A;  2JJK A;  2Q74 A;  2Y5K A;  2FIE A;  1FPK A;  1LEV A;  1FPJ A;  1NUY A;  1SPI A;  1KA0 A;  4I3E A;  2FIX A;  1YZ0 A;  1RDZ A;  3KC0 A;  4GWY A;  1IMD A;  1NUX A;  1YYZ A;  3KC1 A;  1NV4 A;  2DDK A;  4GWS A;  2QFL A;  2WBD A;  1FPL A;  4GBV A;  4GWU A;  2HHM A;  1NV0 A;  3BIH A;  3LUZ A;  4IR8 A;  1K9Y A;  4H45 A;  1Q9D A;  4HXV A;  5EQ9 A;  4MJO A;  4AS5 A;  2OX3 A;  1FTA A; 
#chains in the Genus database with same CATH topology
 1JEV A;  4WKM A;  3OO6 A;  2DVC A;  1MQG A;  3RPL B;  4I3Y A;  3RYD A;  1LCF A;  2I48 A;  2I4C A;  5FTI A;  4R72 A;  2IEE A;  3IB2 A;  4R9G A;  5IGA A;  4POX A;  4R9F A;  3RN8 A;  3KGC A;  5FTH A;  3G3K A;  4XKR A;  3PU5 A;  4PC9 A;  4PFB A;  1B1X A;  5DVJ A;  4C1U A;  4FE8 A;  3K00 A;  1ZMG A;  4ZEF A;  2ZZX A;  1GV8 A;  1MQH A;  2Y7W A;  4QHQ A;  4ZS9 A;  2XXI A;  3H6T A;  3Q25 A;  2CEY A;  4MF3 A;  4O3C A;  1FBE A;  3IJO B;  3E78 A;  3KJT A;  2CZI A;  4BDL A;  4LZ5 A;  3K6U A;  2ZNU A;  4FEC A;  1VDW A;  5FHM A;  4GWX A;  2I4B A;  3IX1 A;  1HSE A;  3PTY A;  2Y7P A;  3CFX A;  3B8B A;  3VE1 B;  2MKZ A;  2UVI A;  4OQO A;  1FBD A;  3MVW A;  1UIU A;  1FBG A;  2VT5 A;  1OLA A;  3PPO A;  3DP6 A;  2FIE A;  1LFI A;  3TCF A;  1R1N A;  1IMD A;  2QS1 A;  3KN7 A;  3JZJ A;  4F3S A;  4N6P A;  5ITP A;  1AMF A;  2QSX A;  3EHU A;  2VP1 A;  3BFU A;  1PB8 A;  2VGQ A;  4NF8 B;  2V3T A;  1SVX B;  5ITO A;  1RYO A;  2CZL A;  2FA7 A;  5LDZ A;  1DBZ A;  2CEX A;  1SW4 A;  5I59 A;  4X1D A;  2E0S A;  3O29 A;  1XVX A;  3RTW B;  4LQ5 A;  1P1O A;  2VD2 A;  1R9L A;  2XXH A;  2Q8M A;  3TPA A;  3GZG A;  2QVU A;  1CE2 A;  3KN3 A;  4RK9 A;  4F2O A;  4C0R A;  2BJJ X;  1QUL A;  3FV1 A;  2WYP A;  4O94 A;  2O7U A;  2GQ1 A;  3JV9 A;  4U4X A;  4X04 A;  2Q9T A;  3CR9 A;  4AB6 A;  3MVZ A;  3TOD A;  5EYG A;  2H4I A;  1ZTY A;  2PX1 A;  5IM2 A;  3UIF A;  4ZEC A;  4EQ9 A;  1DPE A;  2ZYK A;  4EDP A;  3TZA A;  4ZE9 A;  3UP9 A;  1LBW A;  1BK4 A;  3VFJ A;  3C32 A;  3RGY A;  1SBP A;  3A09 A;  1L5T A;  5ET7 A;  4DDD A;  4N17 A;  3EHS A;  4MH5 A;  1FQA A;  5DVI A;  3BIG A;  1QVS A;  2HFB A;  2O84 X;  1MRP A;  3GBB A;  4RA1 A;  3TCG A;  1PC3 A;  4KYE A;  1FBF A;  4H67 A;  2Y5K A;  4P0I A;  1NUY A;  1VFD A;  4TOZ A;  1NKX A;  3PD8 A;  1XS5 A;  4LVQ A;  4GBV A;  4QFO A;  5B7D A;  4KI0 E;  2RC8 A;  4H45 A;  4LN5 A;  2DQV A;  1FTA A;  3T22 A;  3SEY A;  4GQO A;  1MY3 A;  3A3C A;  3IK6 B;  3OD7 A;  4ZEI A;  1XT8 A;  3CG1 A;  5HPQ A;  4XIG Q;  4ELP A;  4U2R A;  3QUJ A;  5KCJ B;  3PV0 E;  3TEP A;  3C35 A;  5AA2 D;  4TQU Q;  4GWW A;  1ZBM A;  2FBP A;  1NUZ A;  2Y84 A;  3U93 A;  5I84 A;  3O9P A;  1PEB A;  1B7U A;  2O68 A;  3LSX A;  4H46 A;  3PMX A;  4ZE8 A;  1FQC A;  3CI8 A;  4QFN A;  4K3F A;  4R2B A;  1OLC A;  1P1U A;  1VFE A;  1IXG A;  2PFZ A;  4XEQ A;  5AA2 A;  4IO2 A;  3E13 X;  3PMW A;  2FYI A;  3V83 A;  1AWB A;  4DXU A;  5CI5 A;  1FRP A;  2X7Q A;  2PT1 A;  4OHN A;  3PPR A;  1Q35 A;  3GBA A;  3PUV E;  1NFT A;  4I62 A;  4GX4 A;  1KWH A;  4KHZ E;  2B65 A;  4BDQ A;  1AOV A;  1FCK A;  1FPK A;  4M4G A;  2ESN A;  1N7X A;  1NV4 A;  3T93 B;  5LOM A;  4PBH A;  2HEU A;  5EHM A;  4OA4 A;  3D1R A;  1A54 A;  1FQF A;  3DM0 A;  2P3N A;  2PYY A;  2XXV A;  4IO6 A;  3TMG A;  1IQ7 A;  3FZV A;  1J1N A;  2REG A;  4EXL A;  4KPT A;  4O7M A;  2O69 A;  4Z0I A;  3FXQ A;  4C1T A;  4ELQ A;  3WAF A;  5IZ3 B;  4F1V A;  1GR2 A;  3OO9 A;  5EQ8 A;  2DE4 A;  2OZZ A;  4PF8 A;  2F7A A;  4PFR A;  1DSN A;  1MQJ A;  2H99 A;  4PE3 A;  4PFU A;  2W7Y A;  2R9J A;  3LV0 A;  3OEM A;  4ONY A;  4F18 A;  3P7I A;  3ONM A;  5FHN A;  3HFU A;  4R75 A;  3EKI A;  2FNC A;  4FAJ A;  3WAE A;  3E3K A;  2FVZ A;  1I6B A;  1EU8 A;  1IMF A;  1BTJ A;  3KFM A;  5LTC A;  4OYV A;  4HTG A;  4BDM A;  4PE5 B;  2HXR A;  5ET8 A;  4OER A;  2KR0 A;  1BP5 A;  1LB9 A;  2Z8D A;  2XWI A;  1JW1 A;  2XXK A;  3VLW A;  2QVR A;  4N81 A;  4H5F A;  4BDR A;  3B7D A;  2NVU B;  4DLD A;  4O3B A;  1LEV A;  4XFE A;  5CRY A;  3H03 A;  2FIX A;  1ANF A;  1MPC A;  3ODB A;  3KC1 A;  1IIT A;  4H5G A;  1PBQ A;  1FPL A;  5H8F B;  1K9Y A;  1MXU A;  2QMW A;  5AA4 B;  4AS5 A;  4X8R A;  4RY1 A;  3KEI A;  2NUV A;  3O28 A;  4U4S A;  5IZ3 A;  2RC9 A;  1SD3 A;  4YKK A;  1B7H A;  3CFL A;  3MAM A;  3MQ9 A;  3SEW A;  4H0W A;  2D5W A;  4LA9 A;  4JVD A;  1N84 A;  3EN3 A;  1DMB A;  2DE3 A;  4PFT A;  2QS2 A;  1B9J A;  2UYE A;  3CFZ A;  2Z22 A;  4GXS B;  2F6P A;  2CZH A;  3IOU A;  3C31 A;  3UK4 A;  4U22 A;  4TLL B;  3FJG A;  3GXA A;  3AXF A;  4MFI A;  4BDN A;  3HPI A;  3IOR A;  2P3V A;  1OMP A;  2IA4 A;  4OTE A;  4FOR A;  1LST A;  3LSL A;  1B5I A;  5ET6 A;  4KCC A;  4YZZ A;  3TDJ A;  2XWV A;  4NF6 A;  1TFD A;  5H8H A;  1SW2 A;  4Q8R A;  2V84 A;  1IZ1 A;  3PUW E;  4RPO A;  2AL4 A;  5A5L A;  1LAX A;  5H8N A;  4AB5 A;  1Y1Z A;  1QKB A;  5CC2 A;  3E9X A;  4N6K A;  5H8F A;  3MVX A;  1SW1 A;  1Z7N E;  4OEV A;  3KN8 A;  1ZU0 A;  1KZ8 A;  1LFG A;  4F3G A;  1O63 A;  3BFT A;  1H76 A;  1MY2 A;  3IOW A;  3FXB A;  3IOT A;  1OIB A;  3OSR A;  4ELO A;  3S9L C;  2A5S A;  1Q9D A;  4HXV A;  4ZEK A;  2V3Q A;  2OX3 A;  2H98 A;  3O6I A;  5KDT B;  1FTJ A;  5TPA B;  2GHA A;  3MZB A;  4NAP A;  2B3F A;  1NMU A;  5H8S A;  1B51 A;  3B6Q A;  1LAF E;  4YB5 A;  3MC2 A;  2R6G E;  4X9T A;  3H6W A;  2XWO A;  1FSA A;  3E4R A;  3MP1 A;  4R73 A;  3IL1 B;  1Y3Q A;  1GVC A;  1NL5 A;  1FPB A;  2V25 A;  3FBP A;  2QMX A;  4MLQ A;  2Q2A A;  1Y1M A;  1NI9 A;  1ZKB A;  3VDF A;  2RCB A;  4NX1 A;  2F7C A;  4H8I A;  3UN6 A;  4FEB A;  3TCH A;  4QSE A;  1QUI A;  3M8U A;  1FPI A;  3CSB A;  5F1Q A;  5I5P A;  4G68 B;  4GL8 A;  2F35 A;  1JQF A;  4JXI A;  5J1D A;  2DWA A;  1MXW A;  1FJ9 A;  4F1U A;  3W9W A;  4EXK A;  2OWT A;  4G68 C;  2F7B A;  2GHB A;  2L5V A;  1NNK A;  1US4 A;  5DEX B;  1FTO A;  3HHG A;  1MY1 A;  4OVR A;  4G2Z A;  1FPG A;  3RT8 A;  3FD3 A;  3MZ1 A;  2P1S A;  4UA8 A;  3S4U A;  3G3I A;  4GWO A;  3SEX A;  1D4N A;  4KD5 A;  2D3I A;  2JJK A;  2ONR A;  3H4Z A;  1QW0 A;  2I0C A;  2VOZ A;  4O8M A;  4QRZ A;  1YZ0 A;  2F5X A;  1NUX A;  3N94 A;  1I6Q A;  2DXY A;  5AE4 A;  4MIJ A;  4HW8 A;  3T1B A;  3M3F A;  4MJO A;  1MG1 A;  4H8J A;  1FW0 A;  1IXI A;  3RPL A;  4UAC A;  5DW8 A;  4LP2 B;  3B50 A;  4QF9 A;  2DOJ A;  3RPW A;  2F36 A;  1Y3N A;  4U23 A;  4FED A;  4FIM A;  1N0T A;  1UTH B;  4ESX A;  2O51 A;  3A3U A;  5I58 B;  4OWD A;  1USY E;  1CNQ A;  4DIG A;  1LFH A;  5B70 A;  5J16 A;  4ZDM A;  2Y5L A;  2B4M A;  3S2V A;  1MXZ A;  3F11 A;  3LSF B;  1MY0 A;  3FAS A;  4NF5 B;  3LSW A;  3RNN A;  2I58 A;  4XF5 A;  5ESY A;  3H06 B;  4P3L A;  2ZNS A;  2UVJ A;  3HST A;  2HAU A;  3KBZ A;  1LBB A;  1AIV A;  4RPN A;  4L17 A;  3G3H A;  2VPN A;  2OPE A;  4HE1 A;  1PBP A;  1RKM A;  1Y4C A;  3U8Q A;  1Y20 A;  5DT6 A;  2F3D A;  1BIY A;  3PGF A;  3IO4 A;  5I2N B;  5IAI A;  2ONS A;  2OJT A;  3LBS A;  1P1Q A;  3UA8 A;  3N6T A;  1VR5 A;  1P99 A;  1IEJ A;  3OO8 A;  4H6D A;  1F9B A;  3RT6 B;  4PP0 A;  4GWS A;  4OEN A;  5CBR A;  3VVF A;  1MQI A;  3ZKK A;  3D4G A;  5CMK A;  1UTH A;  1DPP A;  4QFP A;  2Y7K A;  4FBP A;  4NF8 A;  1B0L A;  1HSJ A;  3VVE A;  3BBR A;  1B05 A;  4MHF A;  4X48 A;  1FTL A;  1JW5 A;  2O7I A;  5A5X B;  3R26 A;  1FBP A;  5T3J A;  3SEU A;  4PQJ A;  2THI A;  4DCY A;  1DCU A;  3RUM A;  1DK4 A;  2Z23 A;  1IIW A;  1GTK A;  4RXL A;  3ZKL A;  4JVC A;  1BKA A;  2KQZ A;  1TXF A;  3PPP A;  4I40 A;  3FJ7 A;  3ILU B;  3OEL A;  5I2K B;  4Z7E A;  4R2F A;  3T66 A;  3I5O A;  4N91 A;  4JSD A;  4G8M A;  1YCJ A;  1B4Z A;  3VXB A;  4KCD A;  4GX3 A;  1B3F A;  3T9V A;  4U1Z A;  3K4U A;  1POY 1;  1NNF A;  3UGW A;  3S9E A;  2Q2C A;  5I57 B;  1FTK A;  3OEN A;  1D9V A;  3CRB A;  2XWK A;  2DSF A;  1URD A;  1JP4 A;  3H6V A;  3QYT A;  3HV1 A;  4IO4 A;  1NNP A;  3O66 A;  1EYJ A;  2D21 A;  4KQP A;  4MX6 A;  4NN3 A;  4P1E A;  3MYU A;  3FXR A;  2F6G A;  1DTG A;  3FV2 A;  5DTB A;  3PUZ E;  4QFL A;  4F22 A;  2H5Y A;  5A5X A;  2X26 A;  4KFQ A;  1B3E A;  4FJP A;  3PMV A;  4QBA A;  4GVO A;  3C9H A;  1DOT A;  2OK2 A;  3IO6 A;  2Y7I A;  1Z7M E;  5L9S A;  4HCY A;  5K2Y A;  4WXJ A;  1Y3P A;  1JVX A;  4DXB A;  4Q30 B;  4GFR A;  4OZ9 A;  4GIZ A;  5I2K A;  3QXM A;  1B3L A;  5DYH A;  1FQB A;  3M3L A;  3O97 A;  5KCJ A;  4F2Q A;  5I7I A;  1VSO A;  2QVV A;  4YB7 A;  3G3J A;  1M5F A;  3K1N A;  4F1Y A;  5I57 A;  4WED A;  2G29 A;  1QKA A;  1ZIU A;  3FVG A;  1NV3 A;  4IY6 A;  1KA1 A;  4F3P A;  4OVQ A;  3HCQ A;  3N26 A;  4YKP A;  2I49 A;  1A8F A;  1H43 A;  1IXH A;  1B7Z A;  1LBV A;  4M1V A;  1S9T A;  3U94 A;  4P1L A;  4Q0C A;  2REJ A;  5CBS A;  1N3W A;  2Q74 A;  1JVY A;  4PFW A;  1N7W A;  1I69 A;  4N15 A;  2XX8 A;  3N5L A;  5KZT A;  4LZ8 A;  5EYF A;  2A5T B;  1XVY A;  3KZG A;  3TTR A;  2DDK A;  2XXP A;  2XXY A;  4XKQ A;  2RC7 A;  3BIH A;  2QL3 A;  2I3W A;  2DWJ A;  2XA5 A;  4KYS A;  3PUX E;  4OXV A;  4TLM B;  1FQD A;  1MS7 A;  1IUD A;  1II5 A;  3FVN A;  4F19 A;  1LBY A;  1H44 A;  4P56 A;  1MXX A;  3K01 A;  4PAI A;  1N04 A;  3TFL A;  2P0S A;  2F97 A;  3EF7 A;  3B6W A;  4G61 A;  2V4C A;  2ZNT A;  1H3D A;  1D9Y A;  2VHA A;  4JWO A;  4YMA A;  1EZ9 A;  1PB9 A;  2H25 A;  2O1L A;  1A8E A;  1TWY A;  4Q5T A;  1FPE A;  3C33 A;  4DCX A;  4N8Y A;  1WDN A;  1I6A A;  3V89 B;  2O6A A;  4GD5 A;  2XXQ A;  3G3G A;  2NXO A;  3IAZ A;  1EYK A;  2WYK A;  1BLF A;  4BDO A;  5JTY B;  4N13 A;  3KJ7 A;  2XD2 A;  3Q27 A;  1T0K A;  1M5B A;  4ZZA A;  2E1S A;  1OVB A;  3KSX A;  5HBC A;  2NOO A;  2PT2 A;  2WX9 A;  3T9U A;  4NWD A;  2ZZW A;  4POW A;  4PFY A;  3VLV A;  1SQY A;  4IY5 A;  4EQB A;  4GWY A;  4OVS A;  4OET A;  4MAG A;  1SDX A;  2GH9 A;  1OVT A;  2VPO A;  4JBZ A;  3TTL A;  5AA4 A;  3DP4 A;  4H1X A;  2QPQ A;  1SI0 A;  3PUY E;  3K6W A;  1URG A;  3KG2 A;  3K02 A;  1MH4 A;  3D4C A;  2RF1 A;  4NGU A;  2FHY A;  1B52 A;  4HE0 A;  4O7I A;  2XHD A;  4PAF A;  1XC1 A;  1FTM A;  3QIM A;  3Q26 A;  3KBR A;  4WEP A;  1OQG A;  4GWZ A;  4LUB A;  4E0W A;  2OWS A;  3G7W A;  1G0H A;  3MVY A;  4UAB A;  4GX6 A;  5JTY A;  1OQH A;  1EZO A;  1IMC A;  1YXI A;  3PPN A;  1MDP 1;  4GRK A;  1INP A;  1NV1 A;  4U1O A;  3DP8 A;  3ZS6 A;  1R6Z A;  4PFI A;  5CM6 A;  3MUQ A;  1US5 A;  3O2A A;  1RDX A;  2F3B A;  1SW5 A;  3I3V A;  3VLU A;  3QMF A;  2XX9 A;  1M5D A;  1B2H A;  2DWI A;  1D9Q A;  1P1N A;  5L9O A;  2DE2 A;  2OCU A;  3SZP A;  1IMB A;  4LON B;  5I3S A;  3K6X A;  2F78 A;  1WOD A;  4OMB A;  3FVO A;  3IJX B;  1FPF A;  1JEU A;  5DVF A;  1B46 A;  4GXA A;  1LBC A;  4NED A;  4GOT A;  4OFO A;  2ZZV A;  4XKP A;  3IR1 A;  1LLS A;  3FXU A;  1SYI A;  2XXT A;  2HHM A;  3LUZ A;  4MCO A;  4G8N A;  4THI A;  4EF2 A;  1FBC A;  3OMB A;  3FIR A;  4PF6 A;  3FGS A;  1D3K A;  5KDT A;  1QGX A;  1B5J A;  2Y7R A;  1NV6 A;  4HS7 A;  5TPA A;  4G8H A;  4MNI A;  2ABH A;  2BJI A;  1DTZ A;  1JW4 A;  5I59 B;  4I9D A;  4EF1 A;  1MM7 A;  1UQW A;  3MZ9 A;  4F3B A;  1IME A;  3S9N C;  3U65 A;  4GF8 A;  3C34 A;  4YIC A;  1NNT A;  1M5C A;  4KXP A;  2XXU A;  1GGG A;  3H7M A;  5EQ7 A;  5HM4 B;  2Q89 A;  2V3U A;  3L6H A;  3TKD A;  1LGB C;  2DP8 A;  2M8C A;  3ROJ A;  1Y9U A;  1PB7 A;  5CMM A;  4PGP A;  3FVK A;  4G68 A;  4HE2 A;  1MXY A;  3PD9 A;  1NV5 A;  4JSO A;  4N4U A;  3QSL A;  3SEV A;  2B3B A;  3K1M A;  2PMS A;  4PCD A;  1ZJL A;  3Q28 A;  3ISP A;  1LAH E;  5EYH A;  4LZ7 A;  5DEX A;  2WBB A;  2DS9 A;  1XI6 A;  2RIN A;  2RCA A;  1HSL A;  3RTF B;  1B58 A;  4XKN A;  4I1D A;  3KOS A;  4OVP A;  1NH8 A;  1LB8 A;  3MP8 A;  4RK2 A;  1WVJ A;  2YPN A;  3W9V A;  1KA0 A;  4MNP A;  2VD3 A;  4NF4 B;  3USD A;  2QFL A;  4IB2 A;  4XTC Q;  3KSJ A;  4MMP A;  3R7X A;  4X1B A;  1JNF A;  4G4P A;  3Q29 A;  4QFK A;  4P8B A;  2ZYM A;  5TU0 A;  4R6K A;  1ELJ A;  3I6V A;  3B6T A;  4PGN A;  2I6E A;  2DXR A;  5H8Q B;  3W15 C;  2ZYN A;  3IB0 A;  2UYF A;  5I58 A;  1IXC A;  3IFC A;  4RYA A;  3U1O A;  3IFA A;  4P11 A;  1P1W A;  3ECR A;  4IGR A;  2G93 A;  1POT A;  1A99 A;  3SDF A;  1EYI A;  2CMO A;  2AYS A;  1VE4 A;  1NV2 A;  4NF5 A;  3MJN A;  5L8D A;  1AH5 A;  1XOC A;  1B1H A;  4ELR A;  3OOA A;  4OAN A;  2PFY A;  4EUO A;  5AA2 B;  4DZ1 A;  1Q1K A;  5EQA A;  2B4L A;  4LAT A;  3ILT B;  2UVH A;  4NF4 A;  3MPK A;  4QSD A;  4PAK A;  4QSC A;  2DYX A;  4NTL A;  4E0X A;  4N6D A;  5I2N A;  2GFE A;  4N07 A;  2WEF A;  2XD3 A;  4GBW A;  4R74 A;  4OES A;  1R9Q A;  4OFL A;  3EQ1 A;  1RDZ A;  3KC0 A;  3RQT A;  3R6U A;  3EHT A;  4F31 B;  4YB6 A;  3E79 A;  5AA1 A;  5EHS A;  2KLF A;  1YTV A;  4N8G A;  1MDQ A;  4JDF A;  5H8Q A;  4OVJ A;  4DI3 D;  2HZL A;  4PBQ A;  1G0I A;  1MH3 A;  3GLB A;  2NWJ A;  3DLN A;  4ECF A;  5ISU A;  1ZLQ A;  2Z8F A;  4LQ2 A;  1A55 A;  3K6V A;  3EPE A;  2ZXT A;  4NQ8 A;  2CZK A;  1O64 A;  4PDD A;  3MWB A;  1USY H;  1A40 A;  1B32 A;  4JVI A;  3THI A;  3FJM A;  2Q88 A;  4YKJ A;  3DEL B;  1LCT A;  3K0V A;  4F39 A;  4MLV A;  4YAH X;  4YKI A;  1FJ6 A;  2GRV A;  3SES A;  3CHG A;  3OXN A;  4OFJ A;  3IB1 A;  2YLN A;  3HHF A;  3T96 B;  1TFA A;  4IO5 A;  1EZP A;  3HN0 A;  3GYY A;  2LAO A;  4F29 A;  4NMY A;  3CIJ A;  2HQ0 A;  5FBP A;  1MQD A;  4P47 A;  4IO7 A;  4FAT A;  3VV5 A;  1B40 A;  1B6H A;  1B3H A;  1A7L A;  3TAJ A;  2QS4 A;  1SYH A;  1QUJ A;  4ND9 A;  5ELV A;  4KYD A;  1NV7 A;  1YPN A;  2OLB A;  5ICT A;  4U21 A;  4R6Y A;  2AL5 A;  4RNS A;  3MST A;  5JK4 A;  2HZK A;  4JWX A;  4HCW A;  3MW0 A;  4NE4 A;  4ZEB A;  3LC8 A;  5AA3 A;  1MXV A;  1SPI A;  4I3E A;  4GL0 A;  1S50 A;  2F8D A;  3S9M C;  1FQE A;  1B4H A;  3OO7 A;  1NV0 A;  2X7P A;  2XX7 A;  4KR5 A;  1MM6 A;  3LUY A;  1MY4 A;  2XXX A;  3VVD A;  1N76 A;  4MBP A;  5F7V A;  2XXR A;  1QJM A;  3UOR A;  3BKI B;  3TTM A;  3QK6 A;  4YU0 A;  1QUK A;  1ATG A;  1FBH A;  2OWZ A;  2V93 A;  5ET5 A;  1K9Z A;  3T9H B;  3TUS A;  4P0G A;  1PDA A;  4DI4 B;  2OPD A;  4DE8 A;  5I56 B;  2R71 A;  5ICQ A;  3U92 A;  2ZMB A;  2ALU A;  2HCA A;  3TTN A;  5IZ1 A;  2OBG A;  3IOV A;  2HXW A;  3RLF E;  4ESW A;  2RKM A;  4RJZ A;  3U72 A;  2O1M A;  3H6U A;  3H3G A;  1YAE A;  1UTB B;  2DVZ A;  3SET A;  4IGT A;  4I8C A;  4NF6 B;  2QS3 A;  5H8H B;  2I0B A;  2PCR A;  4GLI A;  3SER A;  1JET A;  3LR1 A;  3QAX A;  1LBX A;  5IKB A;  4NHB A;  5H8N B;  2XXW A;  3OSQ A;  3TQW A;  1IMA A;  2PVU A;  2HPG A;  3M3K A;  4PTK A;  5BWJ A;  4EQ7 A;  3A29 A;  3TYH A;  2YJP A;  4AS4 A;  1Y4T A;  1LBZ A;  5TP9 B;  2I3V A;  3NOH A;  5BUU A;  1B5H A;  3V8X B;  1N3X A;  1TT1 A;  4R6H A;  1B0H A;  4AQ4 A;  4ZZE A;  4PET A;  3ZSF A;  2A5T A;  4OVT A;  5L9M A;  2WBD A;  2F34 A;  4H65 A;  1MPD A;  1XHY A;  4BLA A;  4GWU A;  3MPL A;  2H9B A;  4IR8 A;  2ZYO A;  3K2D A;  1NH7 A;  4NF0 A;  4O3A A;  5JEI A;  2ONK E;  3G3F A;  3RY3 A;  1RDY A;  3TEL A;  5I56 A;  3FAT A;  4NG7 A;  4MNC A;  3JYR A;  5K2X A;  3T9X B;  3C4M A;  3CVG A;  1URS A;  1B3G A;  1SI1 A;  4ISU A;  2QJE A;  2UVG A;  5CMC A;  1UTB A;  1O7T A;  1NUW A;  1RYX A;  2Z8E A;  1LAG E;  1UIV A;  1CB6 A;  3O6H A;  2Q8J A;  3OEK A;  2WKY A;  4MEV A;  3CSG A;  3FUZ A;  3N6U A;  3TQL A;  4IO3 A;  1S7Y A;  2QRY A;  4QXD A;  2P2A A;  5TP9 A;  2PBW A;  2DWH A;  1FPD A;  4XXU A;  4ZED A;  5IZZ A;  3L6G A;  2ANJ A;  2AIX A;  3CG3 A;  2R8T A;  4PDH A;  3TTK A;  4P9K A;  3K1P A;  3MP6 A;  3SKP A;  4G77 A;  3T0J A;  4YMB A;  5F24 A;  5M2V A;  3HO7 A;  3VXC A;  4DXC A;  4JWY A;  1MPB A;  4OEU A;  4JB7 A;  3V5A A;  1FPJ A;  3C36 A;  2UXA A;  1AL3 A;  1YYZ A;  3O6G A;  1M5E A;  1EH3 A;  1H45 A;  3QUF A;  5CMB A;  5FHO A;  3PPQ A;  3KOT A;  5EQ9 A;  4NWC A;  2HAV A;  3MBP A; 
#chains in the Genus database with same CATH homology
 5IZ3 A;  3RPL B;  4I3Y A;  3RYD A;  4HCY A;  4P8B A;  4JVD A;  5IGA A;  2DE3 A;  4PGN A;  2CZH A;  5I7I A;  3IFC A;  4PC9 A;  4PFB A;  3IFA A;  2QVV A;  2ZZX A;  2P3V A;  1EYI A;  2CEY A;  1NV2 A;  5ET6 A;  1NV3 A;  1FBE A;  3E78 A;  4YZZ A;  2CZI A;  1KA1 A;  4OAN A;  2XWV A;  2PFY A;  1VDW A;  4GWX A;  4OVQ A;  5A5L A;  3PTY A;  5EQA A;  2B4L A;  4PAK A;  4N6K A;  3B8B A;  2MKZ A;  1KZ8 A;  1LBV A;  4M1V A;  1FBD A;  4N6D A;  4P1L A;  2WEF A;  1FBG A;  4GBW A;  2VT5 A;  2Q74 A;  2FIE A;  4N15 A;  1RDZ A;  3KC0 A;  3FXB A;  1IMD A;  2DDK A;  3E79 A;  3BIH A;  1Q9D A;  4HXV A;  4N8G A;  2XA5 A;  2V3Q A;  2OX3 A;  4DI3 D;  2HZL A;  4PBQ A;  1G0I A;  4NAP A;  4F19 A;  1LBY A;  4P56 A;  5LDZ A;  1DBZ A;  2CEX A;  4X9T A;  4NQ8 A;  2CZK A;  4PAI A;  2XWO A;  1FSA A;  4PDD A;  4JVI A;  2Q8M A;  1FPB A;  2QVU A;  3FBP A;  4G61 A;  2V4C A;  1NI9 A;  1FJ6 A;  2WYP A;  4O94 A;  3CHG A;  4NX1 A;  2GQ1 A;  4X04 A;  2Q9T A;  1FPE A;  5EYG A;  1FPI A;  5I5P A;  5IM2 A;  3GYY A;  4N8Y A;  5J1D A;  1LBW A;  1FJ9 A;  5FBP A;  4F1U A;  1BK4 A;  3W9W A;  4P47 A;  2L5V A;  1EYK A;  2WYK A;  5ET7 A;  4N17 A;  3BIG A;  4OVR A;  1NV7 A;  1FPG A;  3MST A;  5JK4 A;  2HZK A;  4HCW A;  2WX9 A;  1FBF A;  2ZZW A;  2JJK A;  2Y5K A;  4O8M A;  1NUY A;  1SPI A;  4I3E A;  1YZ0 A;  2F5X A;  4GWY A;  1NUX A;  4OVS A;  4MAG A;  4MIJ A;  4GBV A;  1NV0 A;  2VPO A;  3T1B A;  4H45 A;  4MJO A;  4LN5 A;  1FTA A;  2QPQ A;  3RPL A;  5DW8 A;  4NGU A;  2FHY A;  4HE0 A;  4O7I A;  1FBH A;  2OWZ A;  5ET5 A;  3B50 A;  1K9Z A;  4PAF A;  4GWZ A;  4DI4 B;  1G0H A;  4UAB A;  1CNQ A;  4GX6 A;  4GWW A;  2FBP A;  1NUZ A;  5J16 A;  1IMC A;  5IZ1 A;  1YXI A;  2Y5L A;  2B4M A;  1INP A;  1NV1 A;  4H46 A;  4PFI A;  5CM6 A;  4XF5 A;  5ESY A;  2DVZ A;  4P3L A;  1RDX A;  2F3B A;  2PFZ A;  2PCR A;  3KBZ A;  4XEQ A;  3QMF A;  1LBX A;  4NHB A;  2VPN A;  4HE1 A;  1D9Q A;  2DE2 A;  1AWB A;  3SZP A;  1FRP A;  1IMB A;  1IMA A;  2HPG A;  5I3S A;  4PTK A;  2F3D A;  3A29 A;  4AS4 A;  1LBZ A;  4GX4 A;  1FPF A;  3NOH A;  1FPK A;  2ZZV A;  4PET A;  1NV4 A;  4OVT A;  4GWS A;  2WBD A;  4GWU A;  2HHM A;  3LUZ A;  4IR8 A;  4PBH A;  4NF0 A;  4OA4 A;  4MCO A;  1FBC A;  3D1R A;  4PF6 A;  1RDY A;  1QGX A;  4FBP A;  1NV6 A;  2P3N A;  4NG7 A;  4MNC A;  4MNI A;  2BJI A;  4MHF A;  1IME A;  3U65 A;  4O7M A;  1FBP A;  5T3J A;  4YIC A;  4KXP A;  1DCU A;  5EQ7 A;  5IZ3 B;  1NUW A;  4F1V A;  5EQ8 A;  2DE4 A;  1DK4 A;  4PF8 A;  4PFR A;  4PE3 A;  3ROJ A;  3LV0 A;  4JVC A;  4PGP A;  2KQZ A;  4MEV A;  4I40 A;  4F18 A;  4HE2 A;  3HFU A;  4QXD A;  3EKI A;  1NV5 A;  4N91 A;  1FPD A;  4N4U A;  5IZZ A;  2FVZ A;  4GX3 A;  4PCD A;  3ISP A;  2R8T A;  1IMF A;  5EYH A;  4PDH A;  2WBB A;  4P9K A;  5LTC A;  1XI6 A;  2HXR A;  3T0J A;  2XWK A;  5ET8 A;  5F24 A;  1JP4 A;  2KR0 A;  4OVP A;  2XWI A;  2XXK A;  2QVR A;  4N81 A;  1EYJ A;  4NN3 A;  4MX6 A;  4P1E A;  3MYU A;  3W9V A;  1LEV A;  4XFE A;  1FPJ A;  1KA0 A;  2FIX A;  4MNP A;  1YYZ A;  3KC1 A;  2QFL A;  1FPL A;  1K9Y A;  5EQ9 A;  4AS5 A;  4X8R A;  4MMP A;  4QBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...