The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
41
|
sequence length |
205
|
structure length |
191
|
Chain Sequence |
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
High Resolution Structures of p-Aminobenzamidine- and Benzamidine-VIIa/Soluble Tissue Factor: Unpredicted conformation of the 192-193 peptide bond and mapping of Ca2+, Mg2+, Na+ and Zn2+ sites in factor VIIa
pubmed doi rcsb |
molecule tags |
Hydrolase/hydrolase inhibitor
|
source organism |
Homo sapiens
|
molecule keywords |
Coagulation factor VII Light chain
|
total genus |
41
|
structure length |
191
|
sequence length |
205
|
ec nomenclature | |
pdb deposition date | 2005-12-30 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |