2FIRT

Crystal structure of dfpr-viia/stf
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
205
structure length
191
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structures of p-Aminobenzamidine- and Benzamidine-VIIa/Soluble Tissue Factor: Unpredicted conformation of the 192-193 peptide bond and mapping of Ca2+, Mg2+, Na+ and Zn2+ sites in factor VIIa
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Coagulation factor VII Light chain
total genus 41
structure length 191
sequence length 205
ec nomenclature
pdb deposition date 2005-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2firT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2firT02
1HSAB 1H3VA 3W0WB 4V1DA 2AQ2A 1A9EB 1MCDA 5FDYA 2P5WB 4PS4H 4LCIL 2A9NL 1MLBB 5HVGB 4MJIE 1ZMYA 4P2RD 1J11A 1MIEH 1NUNB 3C5ZC 2V5MA 3A67L 3MYJA 3SPVA 4UOW0 1MJJA 1TETH 5BRZE 2VXUL 1A5FL 2P5EE 3PV6B 4LDOB 1RZKL 4J1UB 1UH4A 1FFNA 3STZA 5JQ6H 4YJZL 3VI4E 4TSCH 4R2GD 4LSDA 1RZJH 1M6OA 2Q8AL 1WIOA 1YUHA 1ZK9A 1AE6L 5EU6B 4HDIA 5ETUA 2LTQB 4CJ1A 5E70A 4ZS7L 1SM3L 1CT8A 5E0QA 1U95A 1EXUB 3VXOA 1B2WH 5HDQH 1M7IA 1A6UH 3MOBL 4NQDA 4OI9A 4CU8A 1NMBL 4BFBD 3AS1A 3GI9L 4JY6A 3ULVF 1VKXA 4CL7A 2WIMA 1FPTL 3DIFB 3BH9A 3WNMA 4L3EB 2EICA 4ZSOE 3PWPA 5C0FB 4OGXL 2EDNA 4RNRB 4JRYE 1TJIL 3TGXA 1FGVH 5IROA 5FYKD 2MHAA 5I8EA 3PGFL 3ALPA 3I9GL 4U31A 3GSNL 1GAFL 3DETD 2VERN 4NNYA 5JUEL 5I1IH 1LGVA 3KNBA 3MTRA 1MCRA 4JRWA 3RZCC 2YSSB 1JRHH 1S7XB 3VH8G 5I0DA 4WFEE 5MENA 1S7SA 1W0WA 2VQUA 1N5YH 2UVFA 3RL1B 4MMZC 5C8JB 2GJZB 1F8TL 1AGDB 5CIPB 3P4LA 3KLHD 5GS2H 2BMKA 5DEZA 5F1OB 1SEBA 3FFCD 2FJHB 5IP4A 3GSUA 4Q9CA 1ZHLA 5HYSA 3QPQC 4GKNB 1J87A 1P1ZB 2DLHA 2CLVA 5I1EL 4U6TA 1I1AA 5LXGH 3EDFA 3BEVB 2LU7A 4XH2B 3MRFA 2R4SH 3CFEA 5IG7A 4Q9QL 2JB6A 3UYOD 3GZKA 3EHBD 5D6DA 5ABDE 5L2KE 2AI0L 1EFXD 3TBTB 2ZCLL 3QHFH 1KXVC 1H15B 4O58H 3IDJA 1T1ZB 4DWHA 5GGUA 4YDIL 3QEHA 4DZ8A 3K7UA 3OKKB 5EBLB 5CEXB 1RZJL 1X5FA 4H1LH 4ELKB 1HHJB 1SMAA 3MO1A 4XBGA 4YXKH 1KJVB 4DZBA 4JY4A 5B38B 3F12B 1M7XA 3C5JB 3UDWA 1IMHC 1R5VA 5GRWA 1AKJB 3KGRA 2Z31A 5C0BD 3PIQB 2VQTA 4P9HL 3SDCB 1AHWB 4ZMAT 5L2KA 5IQ9A 3P2TA 1G7LA 3F5WA 3O2VH 1CL7L 2VZSA 5DMIL 2VZ1A 1QLEL 1A7OL 5HYFA 5CKGA 4Y7MA 5EWIL 1K9TA 3FN0H 3HG1D 1KCRL 4TQEH 5HPMA 3PWVB 1NCDH 1M71B 3IRPX 3MRIA 2FDBP 5IB2A 2GSGA 2HT2C 2HLAA 5D96C 3QFJE 4PY8I 3MMEA 1FJ1B 3GI8H 4KZEH 2PCPA 1TQBC 1RULL 4YK4C 1MRDH 3OHXB 5INDA 1NPUA 3FOLA 4A6YB 5SWSA 4E42B 5EOTA 1E4XL 1IGFH 4JHAH 1KIUA 4TRPH 1JF6A 1NGQH 2X9YA 1U92B 1W72L 3VXQB 3SGJC 3AM8C 2ERJC 3TN0B 2JJSA 3RQ3A 4P23A 3MREB 4GAYB 3LN4A 3OAZH 1JWUB 5CLTA 4H25A 2VOTA 4M1DL 1EV2E 1G6RA 5IUSA 2YHGA 1AP2B 4G6AD 5INCB 5EBGA 4PRBB 4NYLA 1UM5H 3HI6L 3H9SA 3LHPH 1BD2D 5MEND 2C4FU 1BF8A 3RPIA 2HT2D 1PZUB 2I07B 4TYUA 2AKRB 2R4RH 2EECA 1CGTA 3RTQC 3ULUD 2E27L 5J12C 4KWUA 5IB5B 4RWYL 3G5VB 5EIQA 4OF6A 4NO2A 2FYYB 1FRGL 4OLYH 2GTWA 4MNQB 3UJTH 1T80A 3IVKB 1N59A 4U6XA 3QFJD 2A38A 5IESL 2J1KA 1ZT7A 1IC4H 4OCRL 4WJ5A 5TF1H 3OAYK 5JOPD 1QLRB 1JUFA 4U6YA 3VI3F 4QTHA 1OPGH 3RY6A 1HINL 1EUUA 4I8DA 4Z0BH 3ZDYE 1KEGL 3PWPD 4HK0B 5HJ3B 5JMOC 4Y4FD 2HMID 5DJYB 2HFFA 4JZNA 4JPWL 5DD5H 4ZTPL 5DMKB 4WU5B 3P4NA 4K7PL 2OZ4H 2AJXH 2VXTL 1SQ2N 3JXAA 3EFDL 4EI5D 2BNRB 5I2IA 3U46B 3V5KB 3BD3A 4MDIA 2HFEA 2W59A 3H7BA 5FO8A 5MHSD 2NXYD 3MRHA 5E99L 3B8YA 4L1HA 4L8CB 3BPNB 1NAMH 1WQVT 3QXDA 2VDKL 5L0QC 5DSCA 3NCJL 1CXHA 5T5NG 4XXCA 4NP4H 3NCYP 1XGPA 1T3FB 1WFTA 3QG7L 4JJ5B 4P5TC 4HS3B 3SDXF 3F7VA 3HZMB 4GMSL 5ISZD 4XVTH 5E6IB 4ZFFA 5C0AA 2IFFL 2MCPL 3LMJL 1HH9A 1NMCB 4Y5YC 5I6XC 5E56A 2AEPH 3IJYB 2FZ3B 4H1LG 3V0VB 2F5AL 4LHUD 5J6GA 3C8HA 4OUOA 4PJIA 5DJAA 5IOPB 4DCQA 5HYIA 4OI8A 1I9JH 4TULL 4GFTB 2EYSA 2VDKH 4IIQA 3V6BR 3G04A 3DVIA 2OBGA 3VRIA 2P5EA 4QHKI 1JPGB 1BQSA 5MP6H 5DQ9B 3QG7H 3W9DB 2R0WH 2XZCL 4GMSH 2DWDB 4ZUSB 1LE9A 1E6JH 4CNIB 4XP6H 4PJ7B 2X6MA 2W0FA 1MPAH 5FM4A 1IC7L 4FMKA 5TE7H 4JFYA 3RIFF 3QHZH 1IGTB 2XWJA 1SJVA 2DYPB 5JOFB 3KAAA 3C5SA 4J3SA 4DKFL 5F7UA 3TNMA 4H5SA 1T7WA 3OBAA 3FO1B 3ZSSA 1BOGB 5D1QB 1ZHKA 3TBWA 5A2IH 1G9NH 3RIAK 3VFRA 5J12B 3NTCL 3BPCB 3OJDA 4JGMA 2DOCA 5E8OB 5L9DL 3TO4D 4JM2C 3QO1A 4Z7WE 4ODBD 1JHLL 1WBXA 3WS3B 2D7TH 4ZO9A 1E6JL 3ZHKA 2QL1A 5IVOA 5KOVC 4WHYG 1X44A 4DQOH 1ZVSB 1G7PA 2UY6A 1C5CL 2B4CH 3PGDB 3CSYB 1U8IB 1S7VA 4HF5L 4I0CC 5HD8C 5GSRA 3TO4C 4JM4H 3LQZA 4NUGL 2HTLC 4R3SB 2G9HB 1JGLH 3SKOA 1DUZB 2P5ED 4ZO7A 1QLFA 2VN7A 2DLTA 4RA3A 1OARL 5DLML 3MLTA 2VISA 3T09A 4MJID 5F97E 1MCOH 1WAAA 1U93B 1KSRA 5HYJA 3I50L 3ZDXE 4XNUH 3RVXC 1PSKL 5CD3A 3GSVB 2HTLD 3ARDC 3RUGF 3FRPG 1U3HA 1RUKH 1NGXA 1A7QL 3GSXB 1A1MB 1CE1L 1G7JB 3GJFH 2W0PA 3KVQA 3V5HA 4G42A 2Y23A 5KN5B 4G9FD 2X7LB 4QKXB 4JN2A 1IQDB 1EK3A 4N5UA 3EYVB 5EC2A 5C0BB 3SDCD 1S5IL 1Q38A 2IBZX 4AEHL 4DGIH 4F7PB 5EO1B 2QHRL 3CMGA 2J5LC 1LEKB 3RWIA 1GVIA 1SJHB 4KY1L 1FL6B 4AY0A 4U6VL 4XPAH 4XCFL 1CLZL 5BVPL 9CGTA 2NCMA 3WJJC 3C5ZA 3HG1B 4QHKJ 2O5YH 5I1JL 2VAAA 2F54E 4KK5D 3IFLH 4Z5RB 3BPLB 4YFDB 3AB0B 4XP4L 3NAAL 1NFDA 2NY6C 1XF2A 1RUKL 4N5ED 3L3OB 4QF1B 3CFJB 1YA5A 3UTSE 3QT2A 4KK9D 4NNPH 3GJFK 2VLJE 2OM5A 3LRGA 1RZJC 3VH8B 3DV4B 4OSUL 1ACYH 4YAQA 3TPKA 3MV9D 1KLUA 2PYEA 3HPJA 3QULA 3SGKC 1U8OA 3TEUA 4MB4A 2DQCH 1SY6H 4ERSH 3VFOB 2GT9B 1IL1B 1XCQA 2D7QA 2N7AA 1ZA3B 5D2LB 4X5LA 4Z7WA 5BOPA 4L4TB 5I1DA 4QHMB 3T0XA 3WFBH 4LSRH 5E2TH 5FDWB 1RJLA 4O2CA 2I5YH 1CIUA 4NO5A 1X5IA 1B4JH 4MQSB 3JV5A 4GBXA 5MERA 3LQAC 4YFEA 5CEZL 2R0KL 1KV3A 4RWHA 3L3KA 1UYWH 4PJ9A 3RZCB 4CVWA 3ZE2F 5I8OH 1XAUA 4JDZA 2BVQB 1FNFA 2HVKB 2QADD 4XNYL 1UWGL 4Y88A 3TH2T 4XPFH 1JV5B 2XG4A 4KROD 1S7WA 4LRIA 3N1GC 5FYLE 5E2TL 4RMSA 1DVFA 2Q76A 3OMZA 3WFHA 3BKJH 2OR7A 4JQXA 1BJMA 4JREC 3FHQA 5JIPA 1A6WL 3IGAB 3ILPA 5AYQA 3MJ9H 1CLZH 3SJVD 2H9GA 3E0GA 3F58L 4LCYA 5EC1A 1LEGB 5DJCB 2P46B 2F54A 4PJHB 1NMCC 2BVPB 3QO0A 2OTWA 1NCCH 5ICXA 1AJ7H 4PBXA 5EBMA 1DSFH 1T21A 4XPFL 1TZHA 2YWZA 4JVWA 1EERB 1ORSB 5J06A 4F80A 5C09B 4NNPL 1NLDL 3IDMB 4K94H 1FFRA 1NCNA 4KGJA 1XF5A 1X5ZA 2Z91A 2Y06L 4HPOH 5C0RL 4IRJA 1U3HC 4P2RA 4NM4L 4L4VA 4B7LA 4Q6YA 1FIEA 1L7IL 1TFHA 4JDVB 4P3CL 5DUBB 5IF0A 3Q48A 3HCVA 4QWWC 5GIRA 3BQUB 3WLWC 3S97C 3L3GA 5IM7B 3AXLB 3HR6A 4FQJL 2AXHA 2UV3A 3FB8A 4RISL 1HSBB 3W0WD 4PLOB 2G2RB 2WWKO 1QA9B 1DBMH 3QYCA 4PRNA 4EI6A 4OCWL 1QVOA 2ZSVA 4OCYL 3GM8A 5CEZH 3QH3A 1CD9B 4JO1H 5CHNB 3TJHD 1K4CB 1OD7A 4AH2B 5ESQA 2F54D 5C0RH 3KS0H 4C4KT 4U1JA 3M8OL 3V4PH 2I9TA 1B4RA 1CK0L 3MGTB 5C07B 4HKZB 4G7YL 4JFFE 3E3QE 2VXUH 4Y0GA 1NDGA 1XIWB 4MAYC 1UWGH 3MGAA 5IBLD 2NXZD 4FTVD 4HWBA 5EH1A 3RTQB 4D9QE 3PL6C 3LB6D 1X4YA 4LCCB 2HKHH 4XI5C 1FVDA 2OR8A 2QV2A 1SBBA 2JELH 4KI5D 3IAPA 1A7PH 4JO3L 3TF7C 1B2WL 5TDOA 3LIZL 1CG9A 3FO0H 3WHE0 4HGWA 4M7ZC 4OCYH 1JNNL 2B0SH 5LJYH 2HJLA 3CH1B 2CMRL 3VXTB 4MWFB 3M8OH 5C7XH 3GUTA 2ZUQC 1UEYA 5I66B 4LHQB 3GMOA 3CVHL 4XCYB 2R2EA 1QACA 5D71H 1DDHB 1KLFA 2DBJA 2DQTH 1BFSA 2VIRA 4JZOA 5GGRB 4G6MH 1YQVL 1NFDE 3SQOL 2C1PA 4MA1B 4LEOB 4ZPTA 5DD3H 1P5UA 1C7TA 3VG9C 3SJVA 4AT6A 3ULVE 3F7YB 2Q8BL 3X13B 4G8FB 2JELL 4YEFA 3NFNA 2X70A 3WO4C 2UWEA 4GBXD 4DAGL 3EOTH 5JXAH 2XPGB 1AIFA 4MA8L 1JMZA 1OF2B 1M05A 5AG8A 3QRGH 1BLNA 3VD7A 4HHAB 2GITB 2V5RA 4JLRA 4K2UL 1KN4H 1NCDL 1BZ7B 5CBAB 5HI3D 4S1RL 2F53E 4IHOA 5EZJA 5EA0H 5IHUH 2A77L 2LVEA 3WXVH 1DVFD 5EULV 4QO1A 4AEEA 1FNAA 2QQQA 4QY8B 3ARUA 3VXME 3KYNB 4YLQT 3BIKB 4R7DA 5L8LB 1MCLA 3MCLH 1G0DA 1BZ9B 4TN9A 3KLAB 4OGAC 4Z7VB 4NZTL 3BD4A 1A4KB 1F4XL 3FZUC 3O9WC 5IEHA 1Q1JL 4NRZB 2CK0L 5GZOD 3FN3A 3CXHJ 3DURA 4UDUB 5FO7A 5GGTL 3VE0B 1BIIB 1P7KA 4Q6IC 5B38G 1H9VA 4LBEB 2WINB 1JGUH 4NO0B 4HS8L 1MJJB 2R1YA 3PV6A 5JMRA 1XGYL 4J1UA 1FFNB 4QCIA 5GS0C 1NAKL 3UBXA 4CN1A 1HDMB 2WBWB 1JNNH 1YUHB 4L5FH 3RBSA 2G5BA 5EU6A 2ICWA 4Y5VA 5B3NA 3N50A 1U58B 4NN6B 2DQFA 4JFDE 4H0IA 32C2B 1LK2A 1CFQB 4LKCA 1ZANL 1RHHB 1IBGL 4KFZC 2W9DH 3UPRA 2XNAA 3OKDA 3P4MA 4RBPK 1Z5LB 2B4CC 3RY5A 4OF8A 4JY6B 3A6BL 3HNSL 3BH9B 4NUJB 2GCYA 1FNGA 4WEBH 3R8BB 5C0FA 5BXFA 5D8JL 4Y4KA 3OKYA 2MHAB 2V9RA 3BAEL 5T1MA 3OF6A 5I8EB 5ACZA 1ED3B 1IGYA 1E28A 2MTPA 4JANA 1XCTB 3UTTA 5L2JB 2AEQH 1PG7X 3WHXA 4G3YL 1LK3H 4ZPVA 4NKOB 3JUZA 1R3HA 2VE6B 3PWPE 5T3XH 1JF1A 2Z8WC 1QSEA 3LZFH 1GJIA 1F45A 5MENB 2Q6WA 5FHBH 3ILQC 3U6RA 3OKMA 3WFZA 4HLJA 3WBDA 4TNWF 4P5KB 5BO1L 1NSNL 2V9QA 1YDPA 4QNPF 4X80H 1O5DT 3PP4L 4AEIL 1YECH 2C4XA 1SEBB 3JTTA 3MBED 4LLDB 4NKMA 1EA9C 1QZ1A 4QYOA 3TFKC 4FS0A 4GW4A 1OL0A 3WFEH 3X17A 4C4KO 1JNJA 3L7FB 5EZOH 1KJ3H 3FN9A 3UAJC 1H3PH 1JNLL 2D0FA 1MCKA 1Q1JH 3QQ3A 4OCRH 3GB7A 4HC1H 1AXTH 3QXAB 3TBYB 2WWKT 4NO0D 1L7TH 4XPTL 5I18L 4YXHH 2MMXA 4KXZI 1YEIL 3MYZA 1JHTB 4U1GB 1RZ8A 3H9HB 3QEQB 3BOVA 3RU8H 1T1ZA 5F1IA 1NSNH 4P99A 3G9AB 4DZ8B 2W92A 1KACB 1FAKT 4OKVA 2DQIH 4XBGB 5DD6A 3DX7A 4X6DF 1J8KA 2FWOB 3DO7A 4U1SB 3C5JA 4BFIA 4NC0B 5KANI 4QRRA 3U7AA 4ETQA 1AHWA 4HKXA 2JCCE 3B9KC 3RWGA 4DJMA 1K5NA 5GRUH 4MCZB 4OFIA 4YXHL 2APVA 4WUUD 4XXDA 2EZ0D 2WV3A 3QCTH 1YJDH 2JE8A 2ICES 5D8JH 3RVWC 5H37H 2J6EA 3TIDA 5LBSL 3TJEL 4N1HB 5JW5A 3WJLC 4J3VA 3BP7B 3OAZK 4MCYA 2V7HB 3D69B 2EC8A 1R0AL 1RUQH 2PTTB 1I8LC 2VH5H 2WUCH 4LLVB 4G3YH 2O61A 3GMRA 5SX5H 4Z9KB 1MCFA 3H42L 1OLLA 5DURB 3N85L 3OGCA 4CVZA 1QEWB 3AREC 4UU9B 3NH7H 3FRUB 3FCTA 3ZLQC 2MPAL 1FE8L 1Y6NR 3BKCL 3MLYL 5DFVD 2FHBA 4CADB 4XVUD 3DMMC 5T1LB 4OZIB 4YHPA 4FHBD 4DKDC 4XP6L 2E9WA 4PUBH 3WUWB 1OVZA 3X12B 5JXEC 3BZFA 4PJDB 2I07A 3UZQA 4IOFD 4HPYL 4HULB 4RMVA 1F42A 3VGFA 2AJZA 2AJSL 5BCAA 4JO4H 3BGAA 2VDPH 3DXAB 3L5WB 4M5ZH 2GQHA 3MLXL 3ULVL 1DBAL 3BWAB 3GSQB 4U7KA 1JZ3A 2RJMA 3RU8L 1N59B 1MCWM 1UXSA 3V8CA 1CFTB 3MNVA 2YBRA 5E2UL 5HYQA 4U2YA 1OAYH 2RQ8A 1KB5H 1EDQA 3LDBB 5EUKB 3MRGB 4GH7B 2R0LL 4Z95H 5HHMD 4S2SA 2C3WA 1X4XA 2GKIA 4LPUA 1I8IB 3GDBA 1MJ8H 1A7RH 3IKCA 1MCPH 2BFVH 4HPYH 5JDSB 2JB5L 2CIKB 2A2QT 3GBNL 3I6KA 1HNFA 1ONQA 3ISWA 4L9LB 3RVTD 4M5YH 4P5MB 4BSVA 4O51B 5IFHL 3VXSA 2JJTC 3QUXB 4FQLH 4YHOL 5DZLA 4XNUL 4IMKC 4LVHB 4ZUTB 4MDJB 5BMFH 1AGFA 4LLWB 4KROB 1XGPB 2EDEA 5FF6A 1JTTA 2HVJB 2VQ1B 1FH5L 3QEQE 1MWAH 2CKBB 4PJHF 4HS3A 3QZWB 5C0EA 3G5XB 4PGCB 5I9QC 3DX9A 2NNAA 4P5TA 3S7GA 2BFVL 2GK0B 4OV5B 3P30L 3S37H 3UROR 4PY7A 3RNKB 3S34L 5DJAB 3TA3D 1BPVA 3L95B 5IIEB 3A6CH 1G6RH 3EOAB 2CIIA 4L29B 4YBHA 3FO2A 5DR5L 4X8JA 2B1AL 3DVNB 3H9SE 3IFLL 4YHYC 1CXKA 5K9JH 3I3EA 3LKQA 4IIQB 2CLRB 1X3DA 1LNUA 1JPGA 2AXFB 4GXVL 3WCYA 2YA1A 1FCGA 1NCWL 1S7UA 3P9LB 1BEYH 1N7MH 4A2MA 1RU9H 3NGBC 3SBWA 4KTEH 5DGQA 1NC2B 4FXGA 3MV9B 3MNZA 4O9HL 1CQYA 4J8RB 1T22B 4M6NH 2P43B 1JI2A 2ZSWB 4M3KB 1SJEB 1Q8MA 5F7YC 1NFIA 1SY6L 3S9DB 5F1KC 4WUUE 1VERA 1G1CA 1U2CA 4GSDH 4ZUUA 1CFSB 3GMPA 1FN4A 3QEUA 5D2LF 1WZKA 3QQ9D 1JIBA 2CRIA 5HHQA 4NGHH 3GSRA 2F5BL 4FABL 4CW1A 4NT6B 5JR1L 5IHZB 1B0RB 3VXUB 2DI9A 4MVBC 4X0KB 3F8UB 3QI9B 3KPTA 1S7VB 4R8WL 5DHVA 1FBIH 1GZQA 3W9EB 4CN4A 5HDLA 4R3SA 3PWNA 5E8DH 1TJGH 2C3VB 1QRND 2WANA 5LQBH 4HJJL 4I18B 5J13B 3MOQA 4MAUH 4FQIH 4OZGB 3ARFC 2PKDA 3VFNA 4APQD 3HZKA 1LP9A 3QIWD 5C2BH 4PJBE 3O41A 3L3HA 2P5WD 3KLHC 2XOTA 3C2AL 3LKRA 1D9KA 4ORGB 3CUPB 3GSXA 4PG9B 1JGDB 2VXSH 4YBLC 5DRXB 5DUPL 3SQBA 5JR1H 5DJXB 1QTYT 5CZXD 2C9AA 1RUMH 2AABH 1F4YH 2GSIA 4WTZA 5GSVB 5EC2B 5F96L 1S9WB 5HVWA 4ODWB 3C08H 1MCJA 5GGSB 1OOAA 4CMHB 1BMGA 4FQIL 5KTEH 1U8MA 3T0BA 3CZFB 1P5VA 4HGMA 5I71B 4LNVA 3HR5B 5K59E 1NLDH 5J11B 2P8MA 4ZAKD 3BZEB 4NJ9L 1KEML 3C6LD 1REIA 3U4AA 1D5XB 4X5WA 4M9OA 4RMQA 3ULUE 3QFDB 3MUZ1 5B8CB 3OKLA 4WUUA 1DR9A 4EDXA 1P53A 2F74A 4HEME 3Q6GL 2PO6C 3OX8A 2DS4A 4ZOBA 3MJ7B 3OV6A 3MBXL 2OI9C 4ZO8A 3VFOA 4MJ2A 2BY0A 4N8CL 4QHUA 5BQ7A 3TBVB 1NCAL 5DD3L 4G9DB 4OLWH 3WUZA 3RWEA 5J1AB 5H37G 5DEGA 1VPOH 4TPRH 2PO6D 1MI5A 3W39B 1FO0B 3KXFA 3A6OA 1A1OB 2D2OA 2AEIT 1IAIH 3T1WA 5JXAL 3C6LC 3H3PL 2BVUA 3G6AB 4KVNH 3GMLB 3DOSA 5E00A 4ZYKA 3BMWA 5MEQB 3CMOL 3SE8L 1LILA 3HS0A 4G8GD 4GRLB 2J8HA 3W11D 4Y1AA 2NY7H 1NAMA 1U8QB 3CX2A 4M9PA 4YX2L 1G84A 3DMMA 3BDYL 1N0XL 2V7NA 1MFBL 3C2AH 2GYSA 2BVQA 1INDH 3MROB 3SKJH 1OGTB 1OQOA 1A7PL 5TGBA 3VXMD 4B5EA 4CVXA 2AK4A 2FB4H 3RWCB 4EI5B 3NZ8B 3AREA 3MLZL 4QHNB 3W2DH 5I1GL 3WXVL 1K4DA 1QD0A 2M2DA 3TH4T 3VGAC 2L7JA 4TOYL 3MRRB 2P5WA 2EIZB 3DSFL 1PX4A 5FB8B 3PQYE 3TT3L 3JWDL 1KXTB 4PRPE 3E6FB 3WLBB 4TUOA 1YEDA 4LRNH 4F7CA 5DJCA 2X89D 4PJHA 1IKNA 1UB6B 4NRYB 4FFYL 1W0VB 2NXYC 3BKML 4PB0L 2ZPKH 2FNBA 4HS8H 4JFDD 3QXWA 2NXYB 4HXAL 5DJ8B 5EBWA 5ACLA 3EDDA 5C09A 4RX4D 4CMMA 1EXUA 4FFVD 3WNOA 5HVHC 2NZIA 2IC2A 5IHBA 1VFAA 2I26N 1AC0A 4N0YL 3V7MA 1C1EH 4IRSD 5DZNA 4EUPG 1CDJA 1WT5C 5TQ2L 2P7TA 2G75A 3VGAB 3MODH 4M02A 4RNRA 4E41D 2QSQA 4WTXA 4FQXD 3ARED 4DVRL 1DVFC 25C8L 4P2QB 2VL5A 4EI5C 1MCQA 1QRKA 1I85A 5F9JB 4U33A 4OLVH 5E8PB 3SDAC 3CCHA 1QA9A 4GXUN 4L8SB 3VA2C 4HFWB 4YHZH 3Q5OA 3H3PH 1NLBH 2J88L 1R3KB 2VDRH 1NCBH 2CRMA 5CHNA 4ONOA 2VYRE 4DUWA 4GBXC 4JAMA 5SWSE 3DTXA 4NQSA 1B6UA 5E1AB 4PG2C 2XTJE 1AGCA 3SKJL 4GKZA 1MVUB 1I3GH 1ZVHA 4DVRH 2EDKA 4LASL 4BM7A 3MUGA 1JP5A 1YECL 4LCCA 4WRLA 1I9IL 3JV0A 3QCVL 3BHBB 5IVZA 3SGKA 1H3PL 1EJOH 3OKEB 3KWWB 1AY1H 1YMMB 3JWNC 5FHAL 1U8JB 2BVYA 2L7UA 2FBJL 1VGEH 4HWBH 2D7MA 3IDJB 3OQ3B 3VXTA 5DD0L 5E7FA 5GGUB 3H2WA 1L0XA 4OCMC 2VLKD 5CP3A 5KANG 5B8CC 1RURL 3ULVC 4XCYA 1YEKL 5CEXA 1GL4B 1WT5A 3SO3C 2PXYC 3BSZH 5GS0H 4F57L 1DFBL 5AYUH 4PJEF 4ZPTB 3X14A 2VLRB 4C54A 3WIHH 3O3UN 4PJEA 3X13A 3HI1A 1RAMA 3T2NH 1MHEB 1CLOL 4FQXC 4KJYA 4YWGH 1HQRA 3GSWB 4XHJC 4UAOC 1OP3H 1MVFA 5CGMA 5MEOA 3QSKB 1OF2A 2BCKB 2F53D 3ZDYF 3BXNA 5DD0H 4HHAA 4M6ML 1CD1A 3SJVE 4UILH 1I3RB 4LCWD 4Y5XA 3QIWB 1W8OA 3ROOA 5ELIA 1MQ8A 1BZ7A 1ORQB 3MFFA 5INDB 4HV8B 4M7LT 5DJ6B 5EZJB 2NYYD 3D48R 4XP9L 2A6KA 1Q9WA 2C7UB 4O02L 3KJ6L 5IW3A 4R6UA 2FR4B 3IFOB 2CLZA 5J13C 4KZDL 3VJ6B 4IDJL 1ZSDB 1T04B 3EUUA 3ULVD 3HC3H 2ZG1A 4Z0XA 4HCRL 4PV9B 4PJ8B 4RGMC 3QDJA 3U2SA 2NYYC 4NRZA 2D03L 1H0DA 4E41E 2V2XA 5HHVH 3EYSL 1ZS8A 4RGOL 2J8UA 5INCA 1T1XA 4UILL 2X89A 3H9SB 5DMGC 3VE0A 4DGYL 1GIGH 2ADIA 3GK8L 5CBEA 5FCUH 5IW6B 1C16A 1I9IH 2F8OA 3IF1A 2DN7A 2WINA 4KTDL 1ZHBA 1V7MH 5F8QC 3OF6D 3UO1L 5I1KL 1Z6JT 2P5WE 3G6JA 2G5BB 3IVKA 5IKCA 5EFIA 1U58A 4JGJA 1JL8A 2DQFB 4U6XB 2B20A 1I1YA 3NIGF 3SN6N 3RI5F 4V1DE 1PEWA 1NANH 4FTVE 4HK0A 5HJ3A 1ZLSL 3NFSH 1J8HD 1DFBH 2NTFA 5AYUL 4ZUWA 1TQCC 5DRZB 2GCYB 1FNGB 4OBSA 1A8JH 4M8VA 3F6IA 3P4NB 2APXA 2OR9H 3BGFC 3UTSD 2FSEB 5IJVB 1BOYA 3T0ED 2X4TA 4JHBA 4MLSA 3PHSA 4LMQE 5KVDL 5FO8B 4JANB 4F9PA 2WUBL 5HI4C 2DQEH 2Q7YA 3O6FB 5FIEA 1N6QL 1ZVYA 5I8CB 4LCWE 4OZHB 4M6MH 4NKOA 1MF2L 1R3HB 4UDTA 1GGCL 4WEMB 5GRZA 4N0FA 3OKMB 3GHBL 1BFOB 5CP3H 3VW3L 5JZ7C 3QQ4B 5I9QB 3D85B 1JHKL 4GRMA 2O26U 1FH5H 3C6SB 3MJ8A 3B9VA 4UT7H 3JTTB 3K4AA 1JVKA 4LLDA 2OR9L 1JI1A 3TESA 3EYOA 1IZJA 1BBDL 2EIEA 2VLJB 3IJSB 2BY1A 4J6RL 4KK5C 4LCWA 3GIZH 2VXQL 5DC0A 4ZOEA 2IG2H 2DQEL 4XTRD 5IOPA 3QUXC 4L3CA 3D87B 3MRCA 3SCMD 1C5DA 1E4WL 4BQCA 3QXAA 3ZYIA 3V52H 3ARGC 5JPMB 4L9LC 4YDVB 3WIFA 4Z7NF 5K9KB 1INQB 2P5EB 1FVCA 4RGNC 4P4KC 4P4KB 1OAZL 4UZGA 5F1IB 2YXFA 5CEYB 2DWDA 4JZJC 5IQ7H 4MXWL 2ITDB 3JVGC 3ROLA 4GXVH 3PGCB 1T5WA 3EO1A 4U1IB 4TNWK 3MXWH 4FZ8H 4UNVA 5J8OA 3UTZB 2E9JA 4KTEL 4KI5C 1AI1L 1OB1B 2Z35A 4BFIB 5TF0A 3RBGA 3LN9A 3X3GL 2D31B 3O2DL 4XC3L 2AS5M 2BSTB 4FQLL 1T5XB 4HKXB 1SYSB 5I73B 1CGSH 3AS3A 1PG7H 3KPOB 3CLEL 5CMAB 1Z0MA 3S36L 4XBPB 1WCQA 1TVBA 4LHJB 2R0KH 2FEEI 1YN7A 3U36B 1F5WA 3F62A 1F4HA 1QFOA 4PJAB 1T0NA 1OP3K 2EYRA 5IMOB 1MCSA 4QRQA 3U9PH 3WS3A 4KJPD 2ZJSL 2NY1C 4NKIH 4NRXB 2IFGA 4R4NC 1UXWA 2AV1B 1A5FH 2F5BH 1Y6KR 4NM8H 3QXTA 4NWUH 1OGAB 4CDGC 5TPWH 5HHME 3MXWL 4AIOA 1KNOB 3SBWC 1AI1H 2PXYA 5HTSA 1MF2H 1ZT4A 2FX9L 3GMRB 4CAGA 2EE6A 2VNCA 3QPQD 1PGRB 3T8XA 1DQQB 3I75A 2YD1A 4LRIC 4PBVC 3CDFA 1U93A 4IOIB 3EYUL 3KPRB 5ANME 1CVSC 3NIFE 4N68A 5DYOA 2D9CA 4KQ3L 3UBXG 1CL7H 4R7NA 4PJ8D 4NKDA 2CR3A 3QUKB 2A83A 4MNGA 3SKMA 3LEXA 4Y2DC 3RFZC 3MSPA 2OL3H 3P9WB 3ULUF 2IG2L 1U2HA 3QWRA 2AJZB 1BQHG 2M26A 4YUEH 4OQ1A 1BVKA 4G6FD 3BP5B 3QG6B 1RULH 3UTQA 4U6HB 1J1XL 3K8LA 5D7LE 1ZAGA 4UV7H 1VADB 1OAZH 4Y4HB 3B3IB 1AQDB 1UXSB 4LF3B 5HYQB 4G8EB 5FM5O 1F13A 3O11A 4NQEA 4K7PY 3IDYC 1ZHNA 2DL2A 4I0KA 4IRZH 5EUKA 2VWEE 4MD4B 5C0ND 2DQJL 3CFJA 2MCG1 2W9EL 4OJFH 2RCSH 2CDGA 4MXQC 1J0KA 4RISH 2Y6SD 1I8KB 1U8HA 4M61A 5EUOB 2Q20A 4X9FA 1K85A 3LHPL 4U3CA 4P5MA 5CGYC 5I17B 2PYEB 3HPJB 2HYMA 1YC8A 5T5FH 3MCKA 4U7MA 4OTXH 4F9LA 3QFJB 3U9PL 1FFOB 2PTUA 3VGEA 4F37K 4MDJA 1ES0A 2J3SA 3QHFL 3WJJA 2ED8A 2X4PB 3DX6A 4LU5H 1C08B 2VQ1A 4OQTA 3CVIL 3WDHA 2CKBA 1AXIB 3I2CH 1U3JA 3L3IB 5KSBF 3QDGD 2YMXL 1RUML 3FB5A 1Z2KA 4HKJB 3L3KB 3UYRH 3BRDA 4PY7B 4EOWL 5CJ5A 1C5BL 3P0YL 3R06B 4N8PA 1A3LH 2AXGA 4GG6E 4LCIH 4DW2H 4L29A 3PF2A 4X8JB 3MRLA 5SWSD 3B83A 1F4WH 3ARBD 5C0CA 5C7XL 4JFZH 3WKMH 3FOMB 4HSQA 5MHSE 4BELD 5J9PB 2Y6SC 2Q76B 5HGGS 5I1HL 1NGWA 1FSKB 4DGVL 4ZDHA 4ZXBB 1G7QA 1QFUL 1UGNA 1JN6B 3RX8A 5A1AA 2OS7A 1S9XA 3TO4A 3GI8L 2Q8AH 2AGJL 1NC2A 2DJSA 2LAAA 3SGEH 3HI5H 1YNLH 2DD8H 3HLAB 3LEYL 2CR6A 3VWJC 4J8RA 2CH8A 5AUMA 3DSFH 3DV6B 2BVTA 1P84J 5EC1B 4RFEA 4Z77B 1SJEA 2IFFH 1QRNA 3M17B 1A6UL 4Y19A 4U0QB 5D72L 4FG6D 4FQ1H 3D6GA 2F19H 1XF3B 3QDMB 1WBYA 4X83A 5JTWA 3WKML 1ORSA 1UCTA 4UV4H 4CKVX 5I1HH 4P2QE 2FJGA 3IFPB 3CD4A 2RFXA 4F7MA 1SY6A 3BEWB 1DEDA 2E27H 1DBBL 2IANE 4G6AC 1A1NA 3MGOA 1Z9SA 4OTXL 2BSED 3PWNB 3BQUA 3VGDA 5JW4N 5FKAA 1E6OL 4I4WB 5L2KD 2H2SC 2CK0H 1N3NB 5HGHA 3T0AA 3VFNB 5JOEA 3JBG7 25C8H 2BOBB 1CFBA 1FC2D 1BWWA 1TENA 3BN9D 1CLCA 1HHGB 2P48B 3MV7A 4FMFA 4YBQC 4YHZL 2YD8A 4X9HA 5AWNL 2FRGP 4YHKL 5LCVH 2F8VA 5E5MA 2UZXB 2W60B 1JFQL 4FNLH 5I0ZA 1C5CH 3F7QA 2B4CL 3QJFB 4JKPH 3UBXI 1BAFH 4YPGA 2XACC 5CILH 5E2VL 1DBKH 4Y2DA 3VFUA 3CVHA 1QPXA 3THMH 5BZDB 1RFDH 2WBJC 2YR3A 2ARJQ 5KSBE 5TDOB 2CJUH 3WSQH 4TSBL 3VXRE 3LEYH 2HT4D 2Y07H 2EDFA 5GJSH 3ZKQD 3BP4A 5KJRH 3CLFL 3LMJH 1EHAA 4G6KH 2PETA 3GUTB 4PP2A 5E6ID 5JHLL 3HZVA 1MH5A 4Y4HD 4D0CA 3SY0A 1BD2E 5I74B 3LH2L 4NJAL 5DXWA 2R8SH 4XCCL 2WWMC 4KVCL 3QIUA 4PREA 5DMIH 2GFBA 3BVNB 5TDPB 1VCAA 5DRNA 3K1DA 2Q87A 3REVA 1FC1A 1QSVA 1GYAA 1K8IA 2VB5A 3F7YA 1F97A 2IAND 4LAQL 2EO1A 4X6BB 4U6VH 1E27A 4G9DA 2BNUB 3PL6B 4F15B 3VXMB 4OCSH 1G7HA 3MACH 3V2AR 4U3HA 2BDNH 1KBGH 2ZCKH 4NZJA 4NQXB 4P9ML 1F90H 2RGSA 3TYGH 3OPZH 4G8IB 1M05B 4YWGL 2X4QB 5BRZD 4HJGA 3G6AA 4NQTA 4H26B 1AQKH 3I6GA 4ZFOB 1AGEA 3GRWH 3ESVF 5MEQA 3O6LL 2X05A 4XPTH 4WFED 3D0VB 3FQRA 1NAMB 3J7HA 3HAEA 4Z8FH 4MJ5A 2VWEC 4OCXH 2R23A 2OX5A 1INEH 1DTUA 1S7QB 5KG9B 4M03A 4PGDA 1TITA 1OAUH 1JPTL 1KN2L 4PRAA 2VAJA 2XV6B 4JO2L 2FBOJ 3NZ8A 4JFDB 4WGVB 5B4MD 4JDTH 3QUML 4YHKH 5C0BE 3B4NA 4OQTL 2ICEB 3OXSB 3OR6A 1A4KA 3HC0B 4WI6A 4XMKH 4WWKC 3OPZL 4K9EC 5I8KL 2JIXD 4JRYD 2G5RA 1S8DA 4WW2C 2EIZA 1OAXL 5J11C 4AIZA 4YC2B 2VR4A 4GG8B 5TQ0L 4ISVB 4XWGL 3KPLB 3MR9A 4FQ2H 4LPWA 2VMFA 4NNXA 3DRQB 4M48H 1TCRA 1UB6A 3BPOC 4QCIB 3ARDD 2VABB 3U1SL 2VZ3A 5IEKA 4Y5VB 1MHPH 5DJ8A 1A3RL 5DMGD 1BBJB 1RIVL 2J8UE 3OZ9L 4YHNA 1CDGA 2KPNA 5FUOH 2AK1H 4R4FL 2G60L 2WW8A 2DBLL 4F58L 3FJTA 4K94C 4KJQC 1O7SA 2FD6L 3FMGL 4KKCC 4QRUA 5JIIA 5HGAA 2EDQA 2QHRH 3SDAD 4NUJA 2HFTA 2VDLH 3ARPA 3NH7L 5DJZB 5DURD 5CJOL 5C09E 3ARFB 5KVGL 4XCFH 4XP9H 2CKNA 2CDEA 1KELH 3K80A 1ED3A 1WLHA 3S98A 1P2CB 1XCTA 2FECI 4XVTL 4KKAC 4MSWB 4DFHA 1MNUL 3VFPA 3BN3B 4L8SA 4HFWA 1UADC 1IFHH 1TXKA 3DNKA 1L4IA 1QSEB 4HMCA 1J05B 3MRJA 4NHCL 4Z7NE 4YFLF 3ZKNC 3FTGA 1YDPB 3ALWA 2Z4QB 3ARSA 4TULH 5FCUL 3DTXB 4NQSB 5T1DH 3MRBA 3T3ME 1LO3L 3M45A 5EIIB 2HAZA 1N64H 4GW4B 4JDTL 5MP6L 1NC2D 4PJAF 3ES6B 4M6OH 4YO0A 1MRCL 4BUHA 2NY4D 4JCMA 1J8HB 4HMDA 3U4BL 3OKEA 3QUZB 1E4KA 3NGBB 1RZ8B 3BW9B 4N9OB 4UUJA 5F9OH 1X6LA 5IW1B 1XR9B 4Q2ZA 1EGJL 3D18B 1HEZB 1DEEB 4XPBL 5GJTL 2BHUA 2NY6B 1LMKA 2FWOA 4OF7A 1CK0H 1D5IH 1A3RH 4FQHA 4LP4A 3X14B 4XNYH 3BP6B 3T1FA 4QRRB 2XRAH 3HPLB 4OLZH 1J0JA 2SEBA 4S11A 2X4UA 2I27N 1CGXA 2UY7A 3HI1B 1MRCH 2FIKB 3RWGB 1MHEA 4KJYB 1UVQA 3GSWA 1RUAL 2J5LB 2ED7A 1Y0LB 4I9WE 2YC1B 4KHTH 4UQ2A 4HUNB 4XXDB 3E2HC 3WEXA 3FAXA 3X11A 3L5HA 4JFFD 3NN8B 5HHOA 3L7EA 5HHNA 4PS4L 3S35L 1J5OL 3RAJL 1A7BA 3IT8D 2EXWD 3PHQA 3BP7A 3UJJH 4F9LC 1ORQA 4UTAH 1YEJL 3D69A 1ZGLP 2PR4L 3B9AA 2K3TA 1V8HA 5F7EH 4LLVA 4XTRC 3BDXA 4PTUB 4JQXC 2C7UA 1HXMA 4U1HA 2W38A 5D1XA 4TSCL 3OGCB 4PJCE 4X8XA 1SVZA 4BKLA 4Z0XB 2FIRT 2DQGH 4HUUA 3HRPA 4ZNCD 4M6NL 4LEXH 5T1DL 1A9EA 4M7LH 1QYGL 3CIQA 1KPRB 4P3CH 5C0GB 4WU7A 4AM0A 3LDBC 3BZFB 2I25N 5DVKA 4JM2B 2B1HL 3IF1B 4NFBA 1UA6H 4PJCA 1MAMH 3TPUB 4B7IA 1XFPA 4OGXH 4PPTA 4NGHL 3L5WA 5D9SA 3VXNB 1M6OB 5D7SH 1OSZA 3G6JB 4X7CC 4X98A 4ZFGL 4P2OB 1M1SA 3CPLA 5H2BB 1DJSA 5EFIB 4WW1A 2R29H 3MRPB 3WL9B 4J2XA 3NVQA 4LOUC 3S5LA 5DDHB 35C8H 1FBIL 4H0HB 2XWTB 4Y8DC 4MB3A 3MA9H 4XNXL 4RAUA 1J0YA 1J88A 4G7YH 3SDAA 4NZTH 1X5YA 4MXVF 5I76A 4JRXE 2OL3B 2HJKA 4X9BA 4UOJA 1ZLVH 5D2NE 2W9EH 4OJFL 2CIKA 4LSQL 1ND0A 2I5YL 3I6KB 4P4KD 3IYLW 5E1HB 2DQHH 4AQOA 4PJFA 1WAAF 3H0TB 3C60A 3OB0K 5F70A 3L3JA 4LSSL 5GRJH 4PIRF 2E3VA 1CGYA 1XGYH 4I3SL 4D0DA 4YBQD 1YEHL 1PG7W 4OT1L 1J8HE 3TO2A 4UDTB 5LXGL 4DN4L 3T2PA 3CXDH 3FQWA 4WV1C 4ZAKA 1BFOA 4YE4L 5HHXL 3RL1A 5GRXG 2W9DL 4N0UB 5CIPA 3D85A 2APFA 4D94A 4O4YH 4YQXH 1LO0L 2E7CA 4P5TB 5HHOD 3GSUB 4GAFB 1ZHLB 4JN1L 4GKNA 4WGWB 5DO2D 5CSGA 1J1XH 5JORA 3HAEG 3L95A 43CAA 4PYGA 1I1AB 2CKBH 2CIIB 1CXEA 5EOQL 5IFJA 5J89A 4OT1H 4QNPE 2DM3A 4ZOAA 3RA7L 2DQJH 1F4WL 4P4KA 2RCSL 1S7UB 1V05A 3QJHB 2IF7A 1PKQE 3MRQB 1TJIH 2VXVH 2ITDA 4I3GA 4S1RH 1DSFL 4L8DB 4LP5A 4APQA 5F7HA 2XY2A 5DMJB 3ET9F 4GRWH 1OB1A 1T20B 4XNMA 3BJ91 1TVHB 1PVHA 2Z31B 5DVLA 1HHKA 5IQ9B 1L0YA 1NJ9B 4EIGB 1G7LB 3F5WB 1RV6X 2NY5C 1WV7T 5CMAA 1CFSA 1CICC 1RD6A 3GMPB 5D72H 3RKDC 4W81A 4P57A 1YN7B 3U36A 5ID1A 2Z8SA 5LGHH 2HT3D 5D93B 5HGDA 3U82B 1HHHB 4OD3H 4X9IA 2YMXH 3PWVA 2NY7L 1ADQA 1T0NB 2Y72A 3CFDA 4U1LB 5IMOA 4YX2H 4M1DH 5MI0C 4YZFE 4QHLB 3FT2A 1NUGA 1AKJD 4F7TB 4XX1E 5IHZA 4ZOCA 2DI8A 2QKIA 3P77B 5D7JA 5LAXB 3MMEB 1RI8A 1A6AB 1ZEAL 4X0KA 5DJ0A 2GJ6E 1ZGLM 5A3IC 2IPTL 1OGAA 3OHXA 3PQYB 1K8DB 3BZ4A 3MLZH 3W2DL 1YEHH 1JPSL 3ARBB 5SWSB 4F9PC 1ODAA 1ZT4B 3TN0C 3C87A 4IS6A 1Y6MR 4R0LC 1YMHA 2X2YA 2FCBA 4MJ6A 4UT6H 3HZKB 1YEEH 1AR1C 4CUCA 3WNLA 1KB5A 2RHEA 3O41B 4MB5A 4TUKL 1TLKA 1XGRB 1WZLA 1MFNA 4OZHF 1JWUA 2PYED 3MA7A 5DO2C 1WIUA 1GRWA 1JGLL 5B3JF 4R7NB 3U0WH 4ORGA 3FFDA 4DUVA 2Z9TA 4NN5B 3TBSB 4NKQB 1UKSA 2DD8L 1MCWW 3DI3B 3AY4C 2R2HB 4JPWH 3RWJA 1RZKC 1TMCB 1KYOK 1KFAL 4K7PH 3QDMD 2B0SL 2OZ4L 3BP5A 4UIKH 2XTJD 5GGSA 3WV0A 1WWAX 4S1SH 1S9KC 4FN0A 5K9QI 1YNTB 5GGQL 2KQMA 1MFDL 1RIHH 2EDHA 5CCKL 1ITCA 2DQTL 4K8RC 3FKUS 3V6FB 5C0DB 2KUTA 1ZHNB 4KY1H 5K33A 4PJXB 2EZ0C 4NP4L 3PP4H 5DS8A 4J3OC 3RKPA 2X5PA 3WFCL 1R3JB 1UCBL 1CICD 2HRLA 2V5SA 5DMKA 1VSCA 4OLVL 3OKLB 3KYMB 1A6TB 5KJRL 1I8KA 1U8HB 4M61B 4A2LA 2C1OA 5KZCD 1A9BA 3V6OE 1NGQL 2XKUA 3OX8B 4BH8A 2ZCHL 5GS0D 6CGTA 1WTLA 4HUXB 3ARTA 5DD1H 5ITFA 4HBQA 3VRLE 4OSUH 5DSCB 2KQNA 4JM2F 1ES0B 4DN3H 4OD1H 1R3LA 5DQDH 1DANU 2YUXA 2B8OT 1FZJA 1T3FA 1FO0A 4LASH 3L3IA 3I6LE 3LSOA 4XCNA 1JPSH 4PRDA 1S5HA 1U6AL 5E2WH 1DE4B 1HH9B 3WO4B 1EO7A 4FQQA 1YEFH 3IJYA 1K2DA 1MJ8L 4G6JH 3OKOB 4EUPB 3HS0B 2X4SA 1JYXA 5J6GB 2B5IB 2IMMA 2VUYA 4PRPD 1L6XA 4S0TD 1MSPA 4C57C 2JCCF 4LSTL 2BRRH 3MROA 2BVOA 4HFUH 5C0CB 5IR1B 2JJSC 3V4UL 4CVXB 5DVNA 2FO4A 2X40A 2RB8A 3FOMA 4QHNA 2IBZY 3VRIB 3K8MA 1WFUA 2Y07L 4P2QD 3ECBA 4ZDHB 5H8DA 2JK5B 3W9DA 1I9RH 4IM8A 4RMUA 4CNIA 5GXBB 2A0LD 3FFCB 4ODVH 3HLAA 1FYTB 1W0YT 5IK3A 3AGVA 2A9NH 1T03H 3T2NL 4F3FA 3WLBA 3VCLB 4JFYB 5MEPB 4XAWH 2XWJB 4F7CB 4R26H 4Y19B 4PGBA 2MJWA 3C5SB 4WWKD 3UAJD 2LTQC 2NY5L 4JR9L 4H5SB 2L0DA 1FE8H 1T2XA 3A6BH 1ZHKB 2FLBT 5J1SC 4LARH 3WMSA 2ZG2A 1XZ0B 2WP3O 3D39D 4XMPL 4Y16D 5FYKE 2CGRL 2UVEA 4HXBL 2NXZB 2DLEA 3UDWC 4K71B 5ESAB 2ZUXA 1MWAA 1ZVSA 3WN5C 2XN9B 4JEGB 3CSYA 1X5GA 4L9DA 3EJZD 1UM4H 3BT2H 4O9HH 5JPNA 5EU7E 2XZZA 2BVEA 3ARWA 4P2QA 5I75B 2PW1B 4LCUA 5ALCH 2NY5H 4JR9H 4NM4H 3BQUC 3ZE0F 1KIRA 1V3KA 3CC5B 5F9JA 1A21A 1HCVA 2BOBA 4JGUA 4GRWE 3CCHB 2V5YA 5C0JA 5I1IL 5CD3B 1N8ZA 3QAZB 4JCLA 4XMPH 1GC1H 5GHWL 5IBTH 2QHLA 3WFEL 3NCYS 5EO0A 1I7RA 1EPFA 2E6JA 4X4XA 3MXVH 1IFHL 2VKWA 1MPAL 3ZT7A 3FQUB 4W4OA 1HYRC 3FQXB 4FABH 5T3ZD 1EMTL 3DUUB 1OM3L 4M93C 5E5MB 2BRRL 4DKFH 5E95B 2NY2D 3CK0L 5SX5K 3FQTB 3ZSTA 1IQWH 1SJHA 4XPGL 4S10A 2MOVA 1CS6A 5DK2A 1FL6A 4YHOH 3BDBA 2ZOKA 5ALCL 5CLWA 3AROA 3AS2A 1UKTA 3O6KL 5I1EH 3IAGC 3ZKMD 3LRSA 5L9DH 3J8F7 3HB3D 3HE6C 3L5JA 4YHML 4I0PA 2AK1L 3LV3A 4R4FH 2MSPA 2DBLH 1YMMA 4H0GA 1AGBA 3RI5K 1U8JA 3RWFA 3BP4B 4N8VA 2VSDA 3KS0J 3QCUH 1IEHA 2BJML 3HZVB 1EO5A 5ALBH 3G5ZA 2IQAB 3MLUH 3O8XA 5KVGH 5JW3L 4Y16B 2OTUB 3O6FD 5GPRA 2DQDL 3KPQA 4I3RH 3VFVA 1VFUA 5JHDE 5ENWB 8FABA 5C3TA 4HUWB 4LVOC 4XPBH 1L6ZA 1N6VA 4JKLA 5LBSH 3TJEH 1IL1A 1PSKH 3WDIA 4KMQA 1MFEL 4X6BA 5EOCH 4QHMA 15C8H 3EYFB 3VXMA 3VWKA 5F1NB 4ALAH 4JFED 1FORL 4WCYL 4QEGA 5KSAB 2E8YA 2ZUYA 3QEQD 1PY4A 2BCKA 4XVSL 5E8EA 3FN0L 1FL3B 5TFSL 4UINL 4AG4L 4OIIL 1RZGA 2BERA 2YPKA 3REWB 5MERB 3CFBA 1CD1B 4W4OC 5I1CH 4ODHL 3QA3B 4Y5XB 3ZTNH 2OP4L 1ZGLB 2DQUH 2V17H 4GQ9H 1U3HD 3FT3B 3JWOC 1N64L 1T0MA 4KJQD 3V52L 5BVPH 5BV7H 4H8WC 4QLRA 2PO6A 2QR0B 4D9RE 2FATH 4UTAL 4QOKE 3G08A 3WDJA 3EJYD 4X9GA 3ZZ1A 4PRAB 4TRPL 2CLZB 2Y5TA 1S7WB 3P40A 4JFDA 4Z7UA 15C8L 1W72H 1ZSDA 2R1XA 2HH0H 2D3VA 3U2SB 2VDML 4LGSB 1H0DB 3FQNB 1R24A 1KJMA 4NC2B 5F7WC 5JUEH 1VPOL 4TPRL 4R8WH 5FGCB 5I1CL 4ODHH 4GG8A 4GXUM 1XGUB 4IBLT 5CBEB 5IW6A 2PW2B 3O6KH 3L9RA 4PJGE 3KPSA 3STZB 1CFVL 2A1WH 3DSNA 4C56A 2VABA 4EN3C 3PXJA 4U1MA 1UA6L 5EBMB 5AZ2H 2DTMH 5IKCB 1TZHB 4KKNA 1RHFA 2XFXA 3ULUL 1IC4L 3VXOB 3MJGX 4G80A 4RAHA 5KVEL 3TNNB 1CXFA 5A3ID 4OCWH 4NN5C 2VDMH 4EZMA 1X5KA 3NFPB 1TCMA 4F7EB 4Z0BL 4P2RB 3MC0A 2NTFB 1GPOH 1VKXB 3C09C 4L3EA 3UJJL 5DUBA 1QR4A 1UG9A 5IF0B 2YRPA 3WD5H 1NGPL 5GIRB 2DYPD 5EOCL 2X4TB 4NC1C 4R0LB 2ZP0T 4OZIF 1HH6B 3D39E 3VXRD 4JFFB 3SEPA 2YD3A 3O6FA 4KRPD 3IAQA 1JZ7A 3TWCH 5SWQB 4R96A 1UWXK 1QVOB 2ZSVB 4N0CD 4BUGA 2K7PA 1QYGH 3QIBD 3QH3B 4LVNC 4HXAH 5IJKA 1W0WB 3SDXA 3JWDC 1IJ9A 3F58H 1T83C 3QQ4A 3O2VL 4C56D 1AGDA 2I9TB 2BMKB 1D3CA 1LVEA 2O93L 3U7YH 3LZFL 2EDOA 4KJWD 2FJHA 1I1FA 4XBEL 4N8CH 3JSSA 5HYSB 5D7SL 1IKFH 1YQVH 5FECA 5CJQH 5C70A 4FOMA 2JCCA 1F6AB 4U4BA 2R29L 3BI9X 1PLGH 1EFQA 3B2VL 1HN1A 3CFEB 4WIQA 3ZL4H 2QLVB 1WCBA 3QIUC 1L9NA 3U0TA 4NQCA 3NCEB 3DXAD 4MWFA 5IW1A 4XRCA 4X7TA 2XZCH 4M7KH 3HMWH 3QRFM 1DEEA 1Q9LB 3HE7B 4ELKA 4Z7QE 1T5WB 1D6VH 1NH6A 2MNUA 4DZBB 3T4AA 1ZTXL 5K9QG 3F12A 5E6YA 4LSVL 5E08L 2IANB 3L3DB 3D3VE 5IVXA 2Z35B 1INDL 2CO6B 5GRJL 5C6TH 3T4YB 1R5VB 3U7WL 3LPGA 4KC3B 3RDTB 3IKKA 2BSTA 2SEBB 5CJQL 5L2KB 4AYFA 4G8FA 2FIKA 3DGGB 3MQIA 4OI7A 3V79C 2F53B 2UWEB 1HI6A 3S35X 1DCLA 4XBPA 1KB9J 2IH3B 4Z7VE 5F7FA 3EYQD 4LNRB 1KTRL 5HY9A 3MV11 1D7FA 4XT1C 5I1LB 4D9LH 1RVFH 5HHOB 5IB2B 5B3JE 3L7EB 4P46A 4WV1B 1CZ8H 3IXAB 5FYJL 3RDTC 1BD2A 1JWSA 5TF1L 4AMKH 5I30L 3LN5A 1FJ1A 1LO2L 4YC2C 1HINH 4DUXA 5C92A 5CZVH 3UCRA 4I2XE 1EEZA 4BQ9A 2VXSL 5DUPH 1IZKA 4UQ3A 5GS0L 5EU3B 3S37X 1T1YB 2P8LA 2AGJH 2E7LA 4PYHA 5F3HB 5TH2A 5C6WH 3TN0A 2PNDA 3S4SB 2X44D 3LN4B 2ZKHL 2WUCL 5D6DC 5EZIH 1ZANH 4PLJD 5GGTA 2FX8H 4NKDB 1J0IA 2VDOH 3INUL 5C0GA 2DL9A 4NYLB 3LEXB 1IAOA 4R4BA 2RAMA 1BQLL 5C08E 2DWEB 3RPIB 4NQDE 1JE6A 4LLUA 4BQBA 2HG5B 5JQHC 1EAPA 4C58B 3UBXB 5D9SB 2PYEE 2CUMA 2FYYA 1FLTX 2HT4C 2GTWB 3K74B 4U6HA 2MCPH 2XXCB 2ICWB 3ABZA 2VLKE 4F15C 4PJBF 2CUHA 2F58H 1ZT7B 2YA2A 3MRPA 4P2OD 3WL9A 4LVNB 5CGTA 1U9KA 4WW2F 5FYJE 4YGVB 5I16A 4KKLD 1FZMB 1LO5B 4XGZA 3OR7A 5ISZA 2K7QA 4OF5A 4BQ6A 1HOCB 1T2QL 2H2PD 5FO9B 5I76B 3U79A 5J1TC 3GMQA 5DFWH 2YZ8A 5HVFB 4G7VH 4LPYA 4YH6A 2XQYG 3IU3A 5I2IB 3H3BC 3H0TA 5ACZB 5AZEH 1LQSR 3L3JB 4X7FC 3PNWB 1A6ZA 4UIMA 1J10A 5IGXH 3C09B 5E6ZA 1IT9L 4L8CA 2VDNL 3TV3H 4IRJC 1TQBB 4J4PD 4KKCD 1JF1B 2AJUH 2R15A 4PB9L 4KK8C 4ZAKB 1W72B 3QNXB 5HXMA 4PJFE 2Y7QA 2BSSA 3DECA 5F44A 5IB1B 4HC1A 2DKMA 4OD1L 2UYLA 1NCUA 3BSZL 4EDWL 1QBLH 3RVWD 3W0WE 2ITCB 2AJYL 2MFNA 2Z8RA 2KZWA 4OZHE 3VGGA 1XR8A 4L8BA 4RCAA 4KK8D 2FZ3A 2VDQL 1AHWC 1U6AH 3ZO0A 2FHFA 4NBXB 2OXGA 4X4MA 5HDBF 5BV7C 4PJIB 43CAB 1OAKH 5L7XH 3QQ3B 3FFCE 2AXGB 1S9YB 2HKFL 3MRLB 1FAIH 4EBQH 2EYSB 2CQVA 3LH2H 4NJAH 2R8SL 3P30H 4QXGL 4FQPA 3DHJA 4HFUL 4ZXBA 1WFNA 5DQ9A 5EORL 3WFCH 4WEBL 4WO4D 4OLUH 2JJVA 4ZQKB 5HHOE 2V2TA 2NY6D 1ETZA 4OFYD 1XGQA 2Y36L 1S9XB 2BXZA 3E3QC 3V6ZB 4GS7B 5CWSB 3DUHA 5HDQL 4APQB 4RQQB 1LP9F 2RR3A 3DX7B 1XH3A 4ZNEE 4LFHG 2W0FB 4TSAH 3DV6A 4UBDD 3BWUC 1QRNB 3M17A 3HFML 2W65A 4M3JA 5JOFA 2AJ3B 4P9MH 1T03L 2B2XL 1Y18A 1FV1A 5IB4A 3TNMB 3A0OA 4HIHB 2EKJA 1BOGA 4DVBA 3PQYD 1S5IH 4PG2A 1AQKL 4P57B 5KSAC 1OY3B 3BPCA 3OJDB 1KIPB 1E4WH 1IM9D 4HWUA 3QO1B 1U3ZA 2BK8A 4E5XA 3MLYH 5JO5A 3FT2B 1F58L 3QR2A 1OTSD 2QKIB 1QBBA 5AZEL 3IB4A 3RIFK 1V7ML 2X1XR 4I5BB 5DJ0B 2XZQL 4O2FA 2PTTA 3O81A 3QISA 4JFHE 5GSRB 3VXPA 2R9HC 4Y16C 5DC4B 5FKAB 2PF6A 4CGTA 1BP3B 1D5MB 1FSKC 1L7TL 4OZGF 5I8KH 4CVZB 4FQJH 3GHEH 2CDFB 4Q9RH 2X1WL 2DM7A 1J1OH 3GSVA 4XWGH 2FECL 1S9VA 4MNHA 5E2UH 1G6VK 3EJZC 4ZUVA 4KV5F 1HHGA 4OF3A 5DUMH 3HE6B 5T1LA 2GEEA 3ELAT 4MA3B 2P44B 4S1DC 4KI5E 4ENEC 3BH8B 4L4VE 2IAMA 1JWMB 1IQDA 4Y5VC 3RWJB 3FO9B 2W60A 2VSCA 5FHAH 3CDCA 4NWUL 3CX5J 4RX4A 4PR5B 5EORH 3MNVB 4R97C 3S96A 1F6FB 2VLME 5T3XD 3NACH 3QUYA 3CJJA 2FX7L 2DI7A 2AVGA 3EYUH 3NPSC 3L3OA 4QF1A 4TSAL 3JV6A 1QSEE 4WFFE 1I8IA 5FYLD 4MD5B 4JZJA 3R1GH 3SY0B 3KYMA 5F71A 3AC0A 4JG1H 3RNQB 3A67H 4TQEL 1NUFA 5TDPA 1RZKH 4NJ9H 4G6ML 4NWTH 1VESA 3I02A 3O3DA 3SQOH 1NEZA 3QIBC 1I1RA 2GT9A 4PGJA 5ADOL 4Z7WB 4MGXA 2NXZC 3TYFA 4ZUTA 3M1BA 1WC7B 3EO9L 1RJLB 5IBTL 2X4RA 2QSCH 3GM0A 5E9DB 3H9YA 1R3LB 3IDXL 3P11H 1N6UA 3WE6B 3TVMB 3CSPA 3MNWA 1M4KA 3QZWA 5J6HB 4S1QL 3LSOB 3DX9B 1S5HB 1Q0XL 4N5EC 5I1AA 3GI9H 2EIDA 4JHZA 5JHDA 4JO4L 4M62H 4MJIB 2ADJB 4BZ2L 3MLVL 5BJTA 4U7SA 3MLXH 4FQQB 1XF1A 4ZFOA 3X3GH 1IC5L 2EH8H 4IJ3C 4K7PX 2WZPD 3OKOA 1K3IA 2NY4C 5ANMB 1QRNE 3VFSB 3LKPB 3HNTL 4DKEL 5IIEA 2PYFA 1S7QA 2CUIA 1JBJA 4MJ4A 3FO2B 5DMYA 3B2UD 3MLPA 2EDLA 3HUJB 3ARFD 3EO9H 3QZWG 3EGSB 4I13B 3RY4A 4WWID 1Q94B 4Y8AA 1TNMA 3HC0A 3FONB 5IBLC 2EXYD 4Z76B 3VGHA 4FXGB 2NY0B 3CVIH 3TA3B 3MNZB 4AIZB 3IGAA 3EJYC 1FYTA 2WBJB 4Y2OA 5T1LD 2B5IC 4ISVA 4PRHE 2AQ3A 4LCYB 2BXYA 4ACPA 5KS9E 2NY1B 3DRQA 4PGBB 1A4JA 4Y5YA 5CGYD 3AMLA 4WNQA 4G9FE 2UZYB 1FN4B 2BNQE 4KV5E 1T6WA 4ALAL 5DEFA 4LRNL 1T89C 3TH3T 4DW2L 3NIFF 3BO8A 1KCKA 1NBQA 1IM9A 2EXWC 5F9WB 1XF5B 2HKHL 4HJ0D 2AI0H 3BKMH 5HYJE 4HCRA 1T66C 1AO7B 3PHOA 1FLRH 3RZCD 1B0RA 3OWEA 5ESAA 3HE6D 5TE6L 3VXUA 2AJVL 3H9SD 4X6EA 2OK0L 1G1YA 2OP4H 5HGAB 4E41A 4WW2A 3S34H 1DUYA 2XQBH 3QI9A 4XP1L 4F2MB 1CDIA 3O9WD 1NBVH 3MLSH 2R2BB 5ADOH 1F4YL 5SV4A 3ARFA 2CDEB 4K9EL 4I18A 4HUVB 3GHBH 1H5BB 3EFFB 2B7DT 3QNYA 3P11L 5A2JH 3AXLA 4MSWA 4J23A 4N9GA 5C0JB 2YK1L 5ECJE 5FA3A 4BZ2H 3MLVH 4HWZB 5EO0B 3MRJB 3H6JA 3LEVH 1UZ6F 3FZUD 1KIQB 4OD2A 4PP1C 1X4ZA 1IM3A 5H35A 2OK0H 5T3ZH 5BO1H 2QQNL 4ZD3L 1B3JA 5GSVA 3HC4H 3ZT5A 1JZ6A 5F9DC 2Y25A 4ODWA 5DK2B 2Y1VA 3PDOB 1P4BH 2ZOKB 1A7NH 2EH7H 2H32H 3CZFA 4K3JH 3QXUA 3U0PB 4LU5L 3VWJB 3QHZL 3LV3B 1MJ7L 1FL5B 1QSFE 2XXMB 3LD8B 3O6FC 5EN2B 3QUZA 4ELME 4MLIA 3BW9A 3C60C 4JHWL 4XHJD 2OMNA 4X6CB 2E8ZA 4NN7B 5ADPH 3QFDA 2VZTA 5GS1B 4LSSH 4X5XB 1QHPA 2BY3A 1U8NB 3BGFB 3CLEH 3GMOB 3D18A 2R2EB 1PAMA 2IQAA 3ARBC 2OTUA 3L5XL 4GT7A 4W4NA 4WFGD 4PJ5B 3D2UA 2C1PB 5DHYA 5B39A 3T1FB 5EWIH 4QHUB 1GGTA 3BDYH 3KLDA 3PJSB 5MI0B 2X70B 5C6TL 1FLRL 4R4ND 3RWEB 3VWKB 5D93C 3VFWA 5TE4H 1Y0LA 4UQ2B 1MI5B 3KXFB 4I2XB 1FL3A 2GUOA 3QWOA 4JKMA 3P3YA 4R90H 1BLNB 3RZWA 3IU4L 1CU4H 3QA3A 3O0RH 1EO8H 2Z31C 1KCSL 5E00B 4KU1A 3OJMB 1DBJH 1QQDB 5J56B 1WTGT 4HBCH 4GRLA 1T0MB 5KTEL 1V7NL 5BS0B 1U8QA 3O45A 12E8L 2VH5L 4QXTA 2QR0A 3WO3B 1JYNA 1Z0NA 1J12A 3G08B 5FYLH 5D1XB 3NABL 4Z7UB 4YHLH 3KYNA 4F8QA 2VL4A 3ZL4L 3UC0L 4HUUB 1MUJB 4J3TA 3MRRA 4PJIE 1R24B 3NMEA 2GJ6A 4G8GE 2R56H 1EGJA 2NLJB 3DURB 5EZIL 3IU4H 3WUWG 1CU4L 3O0RL 1KLGA 4ZFOL 4JRXB 4N0YH 5KAQF 4TUOB 3HKFA 1FHGA 3L9RB 1OHQA 2A9ML 3U7WH 4RRPG 5HHVL 2UUDK 2V2WB 4NRYA 3TT1L 1HDMA 1X5XA 3BIBX 4C56B 3KDMB 2HFGL 3MLWL 3V0WH 4X98B 2H2SD 4HWEL 5I15L 1JZ5A 3UTTD 3CPLB 5H2BA 3EIFA 3VWKC 2VLRE 2GHWB 3QUMB 5EBWB 1LK2B 4LKCB 4CMMB 1PKQA 4IMLA 4G80B 1OAUL 5EZOL 3FAWA 3S5LB 2XWBA 1QPPA 4ZTPH 3L5XH 1FFPB 1IGCL 5J7CC 4OQTH 2MKWA 1NKOA 1CN4A 1A14L 4KRPC 4MZ2A 5AAWA 5IMLB 1A7RL 3O2DA 1VFBB 1MCPL 3AAZB 5CZVL 1XGTB 3LAFA 1BX2A 1MY5A 3KPPB 3U9UA 2J8UF 1BQHB 4PJFB 3KHOA 3C60B 1KTLB 1IGYB 4JFFA 2XTJB 1F11A 5I1GH 1RFDL 4IOFC 3WSQL 4U05A 4QTIL 3VG0L 2YKLH 4OCLC 4KJWC 1R3KA 5L8KB 5F7NC 5IV2B 4N0UA 4JFQA 1ZT1A 4UTBL 1FNEA 1AGCB 1MCBA 1RURH 4BA8A 3GMNA 2VLLA 3BD5A 3MFGB 4EDWH 3MRMB 4P48A 1TZGH 1CXIA 3L7FA 1WBZB 5BZWA 4QRPB 2QEJA 4F57H 5FECB 2X1QA 1SEQL 2A74A 5L6YL 2VDQH 5MENE 3BHBA 2BC4A 4KUZL 3RVVC 3GB7B 2QTEA 5ERWB 1NMAH 3VG0H 3R0MA 2ATKA 3TIEA 3VWJD 1CLOH 4J6RH 1NCCL 5A2FA 3EBAA 5GRVL 4WI3A 5IHLB 3U0TB 4FQ1L 3IJHB 1T2QH 1RIUH 2EO9A 3QJHA 2A6JB 3T2OA 3H3KA 1UACL 1BEYL 1N7ML 1MCIA 2F15A 2CSPA 3ARGB 1IEBB 4OKVB 4L8DA 3I84A 4FTVB 4K94L 1MCNA 5SWZB 3T4AB 1CFNA 4U1SA 2X41A 3SE4A 2YWYA 5ID0A 3HMXH 5IVNA 3RDTA 3DI2B 3BESR 4NQCE 3WFDL 1T6VN 2BRQA 2F53A 1CR9H 1OTUC 3SGDI 2O5YL 1VB9A 2IH3A 2OXHA 3SGEI 5ITBL 4KZDH 5ID1B 1D5ZA 4I48A 5HY9B 2OJEA 4UBDC 5I1LA 3TM6A 1FNSL 3CFDB 3TIDB 2GW5A 4QHLA 4F7TA 2YS4A 3QIWA 1KB5L 3QP3A 1XT5A 5D7JB 5L88L 4MCYB 3UPAA 4U3XA 1YNKL 1MFCH 1QNZH 4JO1L 2A6IA 2NTSP 5D6CA 3QCVH 3ARBA 5C0CD 5C07E 4RFOL 3TZVA 2O61B 2YKLL 1EEZB 4WWKA 2X09A 2ATPB 4NKIL 3PWUB 3CXHK 3HRZA 5I1KH 3IFOA 4Y4KC 1CIDA 4Y19E 3QPXH 1QEWA 3C2SA 2FLRT 1CLYL 1XGRA 4PJ8A 3QUZC 1IEAA 4RBPH 3CU7A 4WI5A 5HD8D 3GKWL 2V2XB 4F8TA 3K2UH 2YXMA 3FFDB 1ZLVK 5GRVK 4OZIA 1OLZA 1DQML 1BAFL 1T1XB 4IRJD 3TBSA 3WXWH 1RUPH 4R4BB 4IJ3B 4Y19D 5DUML 5L6YH 1KELL 1DQJA 3QUZD 4LLUB 4OB5L 4LPCA 4PD4K 4MXQD 1EAPB 1VACA 1MHHA 4LLQA 5GJSL 5HHPA 2X9XA 1EEYB 1YYML 4G6KL 3EO0B 4ENED 1IE5A 3RX7A 3ZKMC 4FFZH 5I16B 5C0DA 3V6FA 2W07A 1OTSC 4YHIB 4BZ1H 5DFVC 4ZUWB 4UT9L 1KCUL 4RGMB 3O6ML 1U0QA 4RGND 4FZEL 3GMQB 2P24A 1HWGB 4XNQA 2FSEA 5IJVA 4OCSL 1ONQB 3CFKA 1DQLH 1NCWH 3KPSE 4L9LA 2ADFL 3DX8A 1GC1L 5GHWH 3RGVD 2ZUSA 2GAZA 1X7QA 5ITBH 3PNWA 4X4ZA 4AJ0A 2XQYK 1KN4L 1I7TA 4WHDA 3GGWA 2OQJB 5ITFB 2XA3A 4R97B 3PGFH 3SKNA 3QIWC 2YRZA 3Q0HA 4CMHC 1FZJB 1WEJH 2YD9A 3MV8B 5DHXB 4BZ1L 3G5XA 4PRDB 5GJTH 5JLZB 4EN3A 1BHGA 2ITCA 2DIBA 1DE4A 3AY4A 3UO1H 3SKUD 4F37F 5D5MA 3EYOB 4LIQE 5FV1L 5FGCE 3DARA 1H8SA 1S3KL 1C12B 3DRTB 3TLRA 1EAJA 1I4FB 2BJMH 5IR1A 1ZXQA 3EZJB 2FO4B 5J4MA 3BKYL 4YDVA 4D3CH 4HJJH 1FFQA 4M48L 2DDQH 5EU5A 1I7ZA 1KENH 3SDYH 2DLGA 3P9LA 2V2TB 1UB5B 3O3BA 5CUSL 5CEYA 3JZ7A 4CRPA 1KJ2L 1F2QA 3ROLB 2ICCA 4X6FB 3MV9A 3FFCA 5E8NB 4KHXH 2M8XA 2ZJSH 3JWDH 1T22A 2X4NB 3VCLA 3IFNH 1N4XL 3T0EC 2AJ3A 1B0GB 1BIHA 5IB4B 4GKSB 1SYSA 2FX9H 4JN1H 2R0ZH 1TVBB 3ARYA 1YQ2A 1EJ6A 1XZ0A 5HHQB 5EOQH 3GSRB 4JY5H 4CW1B 4QRQB 2DAVA 2XA8H 3VU2A 5JXEA 1XMWA 3UTOA 2VLRD 1UXWB 1PQZB 2FATL 1JCKA 4I77H 4JFPA 2DMBA 4BSJA 2XN9A 2XZAH 4H8WL 2NW2B 5D71L 3CU1A 5DHVB 3MUJA 3MODL 3KXFE 5ILTH 2BNQA 4HG4K 5JPNB 1R5WB 4X80L 5I74C 1JGEB 1LP9B 2HN7A 4N0UE 3WYRA 3VI3E 1EZVX 4D8PA 4YHYB 4GO6B 1KC5H 2YUVA 5F8RC 4CJ0A 1S9VB 1KGCE 2FEEL 4MNHB 2I9LB 4N0CC 1CYGA 1LWRA 4XX1G 3QUKA 3HE6A 4HGKC 1JGDA 3NCFB 4MNGB 4X4ME 1CCZA 2DJUA 2X10A 4N1EA 4B0MM 4LSQH 3FQXA 4Y4FB 1SBSL 4KDTA 2GSIB 5D7KD 3V8OA 1CGSL 1KPUB 3IXTA 3ARXA 2WWMD 3QG6A 1I3GL 3LKNA 3HC4L 3PXHA 4PR5A 1BGXH 4NSKB 1VADA 4HLZH 1KENL 2VLJD 4TNVK 2UUDH 5CJXC 1WZ1H 1ACZA 1YYLL 1P4BL 3O11B 4MA7H 3SDXE 4RMTA 3MCLL 4G43A 4KRNA 4XB8A 3P4OB 1QFWM 3F7RA 4MD4A 4HUKB 5CP7A 2D7OA 3UZVB 3JWOH 4O4YL 2XRAL 4S0SD 1EH9A 4N8VB 4Z7UF 5TE6H 1RK1A 1N2RB 5A16B 2N1KA 3TCXA 3LPFA 5JQ6L 5B8CA 2CDGB 2XI9A 1D6EB 3QCTL 1MRDL 4JPKL 4Y16A 3HUJF 1MI5E 1TTUA 3GNML 4NHUA 5ENWA 4YDKH 1IGFL 3MRNB 3WN5A 4FFWC 1ITBB 1T1WB 4X4YA 3W11C 5B39G 4MQXD 4HIEA 2H32B 4QRTA 4LAJH 1FFOA 1CDUA 1A3LL 3TYFB 3GMMA 3ZDZF 4HIIA 3UTSA 3C6LB 1C08A 5C0IB 2BNRD 3OAUL 4NBZB 5KSAA 1YPZB 4WHYH 4XBEH 1JJUA 4ZSOB 2O5ZH 3MZTA 5M94B 3FB5B 2H8PA 4PV8B 4PRID 2ADJA 4N90E 3GMLA 1ZGLA 3OKNA 4OZGE 3FT3A 2DQGL 4CN6A 2ZUVA 1RK0B 3LKPA 2NX5B 4Y1AB 2YPLE 3R06A 1AC6A 2ESVE 3DMMB 1WICA 5BS0D 5EZLB 2PO6B 2HT3C 3GJFB 3UJTL 4HBCL 2R69H 5DJDA 2OSLB 4KAQH 3BISA 1FDLL 1EEUA 2AEQL 3GRWL 4WFHD 5C0AE 2D7PA 3RWCA 2EE2A 4EI5A 5HGBA 5KZCB 3PWJA 4NO3B 4ZXBC 1NGWB 4AZ8A 1Q94A 1DBAH 2IQ9H 4KRPB 1KJMB 1ZEAH 3I3BA 2E7HA 5C0AD 1YY9C 1OAYL 5FB8A 1T0PB 1NAKH 3MRDB 4GRLD 4MQXC 1BGXL 4QT5B 5CFHA 5AUMB 2R0WL 4DGYH 5CJXA 5I71C 1YEDB 4RFEB 2ILLA 1A4JB 4OZ4A 1W0VA 1QSFA 4WNQB 2IWGA 2A9MH 2IADB 1AXTL 1IAKA 4FQ2L 3RGVA 2Z0BA 4HWEH 5I15H 3TNNA 4YXKL 2FJGB 3IFPA 4HUMB 4YBLB 4R90L 5IMMB 3BEWA 3CX5K 1HIMH 2ZUUA 4BJLA 4X6EB 1I8MA 2H6PB 3D3VA 4O2EA 5IVXE 1I9RL 2BNQD 1A1NB 4P9HH 3MRKB 3HE7C 3P0YH 1J9CT 1AR2A 3RWDB 2G75B 3K81A 3NCMA 3VWKD 2WNGA 2P8PA 2FBJH 1OWRM 1VGEL 4I4WA 4I18C 1GXEA 1A7OH 3EFFA 5T3XL 3ZE1E 3STBA 5DK0A 4J3UA 1P7QA 3T3MF 2IGFH 3WIIL 4YQXL 3TCLA 5SWQA 3MBEB 2XN9E 5C6PB 5ISZE 5TDNA 4GG6A 1JTOA 1UCBH 4HAFA 5LG1A 5E24E 3DBXA 3RUGA 5DI8A 1P6AB 3PDDA 1HIML 2BOCB 1FP5A 3VA6A 3VW3H 2HRPL 4WDIB 3KPMA 4HS6A 3QDGB 1SVCP 4NDMA 4KAQL 4GKZB 1MVUA 2C26A 4G6FB 5LGJA 2EKSB 4GRWF 2NPLX 3BUYB 3MUGB 1VGKB 1MLCA 1AD9B 5DF0A 4YPGB 5E94B 1NC4A 3O3AA 3Q6FB 1DQTA 3EOBB 5DTFA 4Y2DB 1DLFH 5BOZG 1HE7A 5BZDA 1FNHA 2JCCB 4J4PA 1OSPL 2ICWI 1Q9KB 5CD5C 1P6FA 3KWWA 5D1ZB 1WK0A 5FKPB 4NQCB 4RAVA 1JZ4A 4X5XA 3IDUA 1QFWI 5GS1C 2VITA 1MH5B 4D0CB 5IT2H 4C83A 1FRGH 4OLYL 3IDNA 4HCRH 4IIQC 5CIPH 1Q9LA 4OLXH 3BVNA 3LD8C 3RKDD 2AJSH 2IANA 1KTDA 3EYSH 4J4PC 3FB6B 2VLRA 4LSTH 1Q72L 4MZ3A 1RJCA 3LOWA 4PJEB 1MCOL 4L3ED 2AEWA 1HI6B 5T1KA 5FYJU 1OP9A 4L3AA 3VD3A 4A6YL 4LNRA 4NQXA 1X9QA 1CICA 2X4QA 2GUOB 2XT1B 3QWOB 4OFYA 1DLHA 4M4PA 4AK1A 1R0AH 1LO4H 2X1PA 1MRFL 4UTBH 3IXAA 1GGYA 1I3RA 4UOW1 3H42H 5E2JA 5C08B 3L6FB 3LN5B 1QQDA 3GSNB 3QCUL 4LLYA 5E2VH 5BS0A 3GBNH 3K2MC 4HWNA 3QIBA 3O45B 1WF5A 3STLB 2HWZL 2R23B 1TIUA 1MFCL 2DQDH 4LLMB 4PGDB 5EU3A 5IFHH 1IGIH 1CF8L 1T1YA 1CBVH 2FR4A 3D25B 2GJJA 1EFXB 1EBPA 2X4OA 3VJ6A 1T04A 4BZYA 4JFEB 1QO3A 4HH9A 2ORBH 4M8QA 3S4SA 3OXSA 3ZYOA 4WVRA 1KFAH 3W0WA 5JHLH 1I3UA 5EU6D 1IGJB 3QUYC 4H20H 2J8UB 4PJFF 3RY6C 2COQA 2NLJA 2XTLA 1T66D 1IAOB 1KLGB 2ADIB 2DWEA 3KPLA 3MR9B 4OIIH 2WK2A 4GLRI 1G9ML 1ZHBB 3MZGB 3KYOB 3S37L 2V2WA 3LS4L 3NIDF 1T4KA 4OBRA 2N56A 2E6PA 4UT7L 4RMWA 2R0LH 1F90L 4WENB 1HXYB 3QUMA 4YXLL 1I1YB 4YHNB 4JPVH 1AD0B 1SMOA 1MCCA 3AVEA 5D7JD 3CFCH 1M7IB 3PG2A 5JDJA 1KUMA 3OR7B 4HEPG 4QRUB 5DD1L 1N5AA 4FFZL 5DRZA 4LK4A 1E0OB 3AM8A 3O4LE 1RJZB 5DQDL 1IAIL 1MIML 5KAQG 3MA9L 4XNXH 3K4ZA 3QUMH 4ZO6A 5DQJA 1TQCB 4OFPA 1JHLH 4NNYB 3VRJB 4GSDL 4M6OL 1MRFH 4WI4A 1S7XA 1DZBA 1ZLUK 1S78D 1S7SB 1NDMA 4NQUA 1BFTA 2HA1A 5IB1A 5C8JA 5F9OL 4I3SH 4TTGA 3VXRA 2UYLB 4OB5H 3ME0A 4PFEA 3A6CL 5J0BA 5GGVY 3U1SH 5EIIA 2JIXA 1KOAA 2VLLB 4LCWB 4MNGE 3ES6A 4U0RB 5KS9B 4HT1L 4WI7A 4ODSH 4YO0B 4DKAA 2JJTA 3FT4B 4L3CB 4QRPD 3QAZC 5F7MC 1C5DB 1TTFA 3MRFB 5C2BL 5ERWA 3R1GL 4WTWA 5IG7B 2FD6H 2JB6B 3FMGH 1FGNH 1P9MA 5K9KA 4PB0H 1FVCB 3C8DA 1QKZH 1H15A 4UT9H 4HW6A 4NOBA 1XR9A 5D1XC 5A2LH 5FGSA 1FO0L 5CAYB 2DDQL 3V6ZA 1IEBA 3NPSB 5CWSA 3SDYL 1HHJA 1AO7E 3MO1B 4FTVA 3OAYH 1XH3B 2Z93B 4OLEA 3RAJH 4HLZG 2QSCL 3DLQR 3V0AC 2D0HA 2EE9A 3C08L 1C1EL 4XP4H 3SDCA 1Y18B 4P2RE 1T5XA 3KPOA 1IKFL 3VMOA 4DVBB 1F8TH 2H3NA 1UVQB 4YUEL 4NZDA 1IAIM 1UC6A 2YC1A 4TVPL 4GUPB 5T5NF 2LQRA 3C5ZD 1KIPA 3B2VH 4Z7QF 2IJ0C 1FQ9C 3X11B 1JNHA 1M71A 2EYRB 1KEMH 5HHNB 4DKEH 5DVMA 1KYOJ 4NRXA 3HMXA 1FYTD 4I5BA 2UWEE 3B9EA 1NGYB 4B50A 3LS5H 2ZZUT 3IRZA 3QQ9C 3VXPB 3BMVA 1GGBL 5AG9A 4YDLC 2XY1A 2X9WA 2VN4A 5AZ2L 4L4TE 4K3EL 3VDBA 1HXMB 4QRSA 3T8XB 1PJ9A 3RPKA 4EN3D 1YEGH 5F93C 3E6HA 3ULSA 4PJ5D 2Q86B 3V7AE 4FG6C 1I8LA 5DYOB 4J3WA 2C5DC 4WHTA 4ZUVB 5T5FL 3PWLA 3ARZA 4MYWB 4K8RD 2MQ3A 3I3DA 3HZYA 4OV6F 4MA3A 4AM0B 2D4FA 5C9JB 4Q97A 2YD4A 2EIBA 3BH8A 1F4XH 2WQ8A 1RVFL 3BGMB 5IFAH 4U1KB 4HT1H 2YPVL 4ODSL 4YHMH 1WISA 1JWMA 3TPUA 2VUOA 3FO9A 3U0WL 2Q3ZA 4GAGH 3W81A 1MHHB 3G5VA 1BVKB 4LGPB 1T7XA 3VXNA 3BKJL 3UTQB 4EXKA 4MNQA 2FH8A 1CD8A 3U30C 4Y4HA 4EQ2A 1T7YA 2HTKC 1DBKL 5K9OA 2NY3B 4WJ5B 1ZA6B 1A6WH 5DDHA 4ODXA 5E9DE 4QTHB 5D7IA 1NMBH 4GW1B 1HWHB 4L8SC 4YHIA 1GGUA 1RPQA 3SDAB 1PFCA 3VD5A 5D70H 1P4LB 4MD5A 1E4XH 2HFFB 2K1MA 2E7MA 4PJGA 3TT3H 2AP2A 2JTDA 3MBXH 1AJ7L 4XNQB 2YPVH 1MFAL 4XB7A 1ADQL 4DGVH 4OM1L 1ND0B 5EU4A 3U46A 3V5KA 3EDKA 4MDIB 5I17A 1MEXH 1KGCD 1DN0B 2NY0D 1X7QB 2YOCA 5KW9H 2C3XA 1RY7B 3MRHB 3O4OB 4P4RB 5L8JB 4ZFZB 3EOYG 4KUCD 4D0DB 4NZRL 4OM0L 1KC5L 1UM5L 3QFJA 4M7LL 5BV7B 3P0GB 3TO2B 3M1BB 4Z18A 3OXRA 3UPCA 2XKSA 1RZFL 3FQWB 3N1QC 2GK2A 4P46C 1MJUL 2IEPA 4Y1AE 5K59F 2FGWH 3WE6A 2ZCHH 3TVMA 5AD0A 1KBGL 1PEZA 5HPOA 1Z9LA 1F3DH 3QEGL 2W9LA 3RHWK 5I1AB 3HC3L 3UTTE 3ZKSD 5C0AB 1R6VA 5HBBA 4G8GB 2VXVL 4DN3L 4HKJA 4H1LB 1W2KT 1KPVB 4P46D 4PRHB 1VHPA 1KG0B 4XXCC 1KCVL 1ZWIB 2NX5D 3GEWB 2PYFB 4DCQB 1A3QA 1C8PA 3UTPD 4LHUB 2NY0C 5IFJB 1SYVB 4C56E 2IPUG