2FJ0A

Crystal structure of juvenile hormone esterase from manduca sexta, with otfp covalently attached
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
538
structure length
530
Chain Sequence
b'EEVVVRTESGWIRGLKRRAEGNKSYASFRGVPYAKQPLGELRFKELQPLEPWQDELDATQEGPVCQQTDVLYGRIMRPRGMSEACIHANIHVPYYALPRDGLPVLVFIHGGGFAFGSGDSDLHGPEYLVSKDVIVITFNYRLNVYGFLSLNSTSVPGNAGLRDMVTLLKWVQRNAHFFGGRPDDVTLMGQSAGAAATHILSLSKAADGLFRRAILMSGTSSSAFFTTNPVFAQYINKLFVTNIGITATDPEEIHQKLIEMPAEKLNEANRFLLEQFGLTTFFPVVESPINGVTTILDGDPEQLIAKGRGKHIPLIIGFTDAECEIFRRQFEQIDIVSKIKENPGILVPLSVLFSSAPDTVAEITKAMHEKYFKKSVDMEGYIELCTDSYFMYPAISLAIKRARSNGAPVYLYQFSFDGDYSVFREVNHLNFEGAGHIEDLTYVFRTNSMLGGHASFPPHDKDDHMKYWMTSFITNFMKYSNPVTDAKLWPEVRADNLRYQDIDTPDVYQNVKPHSEQRDMLDFFDSIYNW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Carboxylic ester hydrolase
molecule tags Hydrolase
source organism Manduca sexta
publication title Structural studies of a potent insect maturation inhibitor bound to the juvenile hormone esterase of Manduca sexta.
pubmed doi rcsb
total genus 171
structure length 530
sequence length 538
ec nomenclature ec 3.1.1.-:
pdb deposition date 2005-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fj0A01
2EEPA 3PDCA 4AN0A 2QRUA 4MEAA 4RNCA 4OYLA 4X6YA 5HF5A 2XQJA 4RGYA 3WK4A 1GQRA 2CMFA 3F98A 3DDUA 4AO7A 4DGQA 4EY6A 2Z5GA 4KE6A 4J03A 4UHBA 1N5MA 2OCLA 2IX9A 1CUGA 1K5PA 4FFWA 1TRHA 3WQHA 1R9MA 4KE8A 1QONA 4N8SA 2C5GA 3P2MA 4F21A 2OQVA 5AO9A 4DNPA 3O4GA 3R3XA 4BDTA 5K3FB 2BFNA 2WM2A 1CUWA 1UZAA 1E3QA 3RARA 4X92A 1Z68A 2XUDA 3GUUA 4QLOA 4OB7A 5DWDA 1GGVA 3AINA 3FCYA 4N8EA 4L0CA 3BF7A 3K6KA 2QMQA 2J3QA 4NVRA 5HF6A 3F9CA 1UK6A 4WDRA 4X00A 5FPPA 5CXXA 2CB9A 3WL5A 5AOBA 5JAHA 3H1AA 2HA5A 2HA4A 5E2IA 5ALOA 2WKWA 2CBGA 2LIPA 3PICA 1LBSA 1XFDA 3IUNA 4LXGA 4MWSA 1UFOA 1GKLA 4CI9A 1QIHA 1YB7A 5A62A 1R9NA 4AB1A 5ALHA 3PUHA 1E8DA 2WU3A 2XUFA 3G8YA 1CQWA 3I28A 5KWJA 4UFPA 3OM8A 1EVEA 4GW3A 5JALA 1ZD5A 3PE6A 2WG1A 2VAXA 1N5RA 5T4EA 4QDOA 4JNCA 1E66A 4DMCA 2G4LA 4KRXA 4P92A 1MX1A 2WIJA 5KBYA 3DLTA 1ORVA 4DM7A 2XMCA 4BZWA 2ZYHA 5IVIA 2HDWA 4C4YA 4QEKA 2PBLA 3I2KA 3G02A 1WPXA 2YASA 2Z8ZA 1Y7IA 2HA2A 4WCVA 5A7GA 5ESRA 5EHQA 1JJBA 4G4JA 4PF1A 3DS8A 3H2IA 3D2CA 5FP0A 5CH3A 1CVLA 1I6WA 3C8DA 3AUKA 3WZLA 5K3EA 2JIDA 4IH1A 3KD2A 5AKHA 4U2CA 4P9NA 2QVBA 3I6YA 1XZKA 4BC0A 2VJCA 3DEAA 3O9MA 4Q3KA 1QJ4A 1P0PA 1GZ7A 1ODTC 2RONA 1W76A 3G0IA 1HBJA 3HXKA 3WL8A 5K5EA 4PW0A 1P0MA 3WK6A 2PPLA 3OC0A 4E11A 5JD6A 2B4KA 3DOIA 2ZJ6A 2C7BA 3FYTA 3SC2A 3ZWQA 4OU4A 2WFMA 2XUOA 2PSFA 3DD5A 2XB6A 3STUA 2QT9A 2QTBA 2RHWA 4BRSA 1CEXA 1FSSA 3QBJA 4FLMA 1EK2A 1QTIA 4FNGA 5ALZA 2Z8XA 4EY8A 3VVMA 1LPSA 1LZLA 2X5XA 2WIKA 1MNAA 3V48A 4GI1A 1U65A 4UUQA 1QO7A 3FBWA 1YA8A 1LPNA 5IVHA 1LPBB 2XUPA 4M0MA 2CJPA 3AILA 3IURA 2ES4A 2OGSA 4AXBA 4IHAA 2K2QB 5AM5A 2W22A 2V96A 3BDVA 3IBTA 1LPOA 6YASA 4G9GA 4TGLA 1EDBA 4A23A 2FJ0A 2WIGA 4FBMA 5HF9A 1N1MA 2XDWA 3R41A 1B6GA 2IIVA 1MNQA 5LKAA 3CN7A 5AI4A 1ACLA 3X3HA 5DYYA 2JGLA 2BUBA 3QYJA 4BDSA 2OXEA 1X2BA 4TVKA 2HA6A 5DNVA 1TQHA 4BB0A 3KDAA 4OCZA 5AI9A 1MT3A 2V9ZA 5AKKA 3I2JA 3W06A 4XIIA 3I6MA 5ALLA 2WJ4A 4I19A 1XZJA 1S8OA 4WFIA 3S8YA 3HLKA 4HZGA 3I2HA 3C6BA 4KE9A 3BL8A 1W4LA 2QKYA 3IUJA 3RM3A 2OCIA 5AM4A 2XQIA 1LPPA 5C7YA 4UFOA 2XMBA 2VA9A 1VZ2A 1XKTA 2H7CA 4OUKX 1WPRA 3FOBA 5AH0A 2AJDA 2XUIA 1ZGBA 4PSUA 1U2EA 1CQZA 1UXOA 3LIIA 5LZ8A 5CMLA 1SC9A 2CKMA 2WTNA 5FLKA 4N5IX 1VZ3A 4P08A 2GYVA 4Y2SA 4EA6A 4EY4A 4IQ4A 4WFJA 4LXHA 3R40A 3TGLA 4KAAA 3W9BA 2I03A 5K3AA 3WKAA 2O7VA 4DMHA 5CH5A 1BN6A 4QDTA 5K3CA 3W05A 4ZXFA 1BEZA 1CUJA 4BVKA 3H2HA 1A8SA 3D59A 3E4DA 2QUBA 5F4ZA 1A8QA 1DT3A 1TCBA 4FLFA 2HRRA 1NX9A 4HAIA 1J07A 4MWTA 3STTA 3HSSA 1XRRA 2HRQA 1JU3A 2IITA 2HU8A 4J0CA 2HM7A 4MQMA 5ALMA 2QXTA 3JYHA 2PSHA 4V2IA 3WLAA 1NU8A 2JGMA 5KWIA 3DYVA 4Y2YA 4KAFA 3NOXA 1MPXA 3WMRA 5C81A 4RE6A 4EY5A 4RE5A 2I78A 2RHTA 5EGNA 4A16A 4Y7DA 1W75A 1F8UA 3AZOA 4XVCA 2XQKA 3B3QA 3I2FA 5JZSA 2WFLA 2DCMA 4QDZA 4Z49A 5BOVA 5AKEA 3AIKA 4B84A 4J7AA 5LKRA 3HACA 4B9AA 1DQYA 4KRYA 5LYYA 3KOOA 5K3FA 1XQYA 2H7XA 2XMRA 4UHEA 4LIPD 5IVKA 5AIBA 5ALJA 2WFZA 5ALSA 4RPCA 3O95A 2XUHA 3RKSA 4F60A 5HK9A 5CURA 3KSRA 5SYMA 1QTRA 5J3JA 5EFZA 1MO2A 3DQZA 1KU6A 2VQ6A 3D4LA 3U0VA 4FKBA 2ACKA 1YAHA 2VSQA 3N2ZB 3EQ9A 2QM0A 2DR0A 4ITVA 3VDXA 3ZLVA 5AICA 2WTMA 4CG1A 3WJ2A 4Y2PA 2ZJFA 1ZJ5A 4G5XA 4L72A 1BE0A 3ED1A 5ALXA 1VJ5A 2ZSIA 4D9JA 2C0QA 2CEKA 3A2LA 4J0DA 5JANA 2ACEA 2WQZA 5T4FA 2C5FA 5AK3A 4G9EA 4HXFB 3TRDA 2OGTA 2V98A 1C7IA 5K3BA 2HHAA 2WG2A 3V1LA 1L7QA 4IO0A 2H1IA 2RI6A 3QPDA 1H22A 4ZREA 3OURA 3W04A 1CUDA 5ALUA 2GYUA 4AMZA 4BTLA 1IZ7A 1EB8A 2I3ZA 4X90A 1ZI9A 2FUKA 5ALRA 4X97A 2YH2A 3I2IA 4KYVA 5JD4A 5AM1A 1UKCA 5CTAA 4C4ZA 3K2IA 1QIKA 4QLAA 4UBLA 1E8MA 4EB0A 1T4MA 4KE7A 1CUYA 4MQLA 3ZLUA 5ALYA 1WB6A 4XWGA 4DTCA 4J0GA 3WIBA 4WFKA 5FKJA 1Q0ZA 5CXUA 3C87A 3ZPXA 4B9EA 1CPYA 3BJMA 2JGEA 4BBZA 4AZ3A 1H2YA 2ZYSA 1UK8A 1OILA 1GPNA 3BIXA 1K63A 1AGYA 3E1GA 4FBLA 2WHRA 2DQZA 3WJ1A 5EHZA 1LPAB 3BWXA 1A7UA 1WB4A 4B83A 3NGMA 5DLPA 2I3DA 3FNBA 4WJLA 1ZI8A 1QO9A 3H19A 3M3DA 3STVA 5HZGA 3G7NA 1VA4A 2J4CA 4LYDA 4MYDA 1GT6A 3C45A 1MAAA 3ICWA 3WK9A 1LBTA 2O2IA 3NUZA 3IUQA 4PO3X 1AC5A 3EBLA 4HTAA 5EIEA 1W1IA 4G8DA 5AKZA 5I9IA 5K3DA 3ILSA 2AJLI 3GELA 1CRLA 4ARAA 5HK8A 3PI6A 3CCCA 4W1SA 4LHEA 4UPDA 2FX5A 2B61A 4XJVA 1AKNA 3HZOA 5A6VA 1N8SA 3SX4A 4Y2VA 4WDQA 4AO6A 2EDCA 2HFJA 3GA7A 2WJ3A 2VT6A 1JU4A 4UHFA 4X71A 1IZ8A 1T2NA 1XRLA 3FLBA 5ALFA 2R8BA 3QH4A 2CUTA 3NWOA 3WWEA 5JIBA 5ISMA 2RGUA 2XQFA 4TPKA 3C8HA 3DNMA 3OPMA 5AKLA 1SCKA 1THGA 3D0KA 3WA6A 4BZZA 4ETWA 4K6HA 1CUFA 1VLQA 4K5QA 5DNUA 1CUUA 1HLGA 1FFDA 4ZI5A 1ISPA 4FWBA 1XLWA 2X76A 5AKYA 4FTWA 1IVYA 4N8DA 2JGJA 3I2GA 1JKMA 1XZAA 2HIHA 2D5LA 4Q05A 1MU0A 3V1MA 2DHCA 2JGFA 5AI5A 5JYCA 4QWMA 4GWLA 1LNSA 4CFSA 3H18A 2JEYA 1XZLA 2PSDA 1ODCA 4EY7A 2AJ8A 3QMVA 5A2GA 3WK8A 2VT7A 2CZQA 5BWCA 1ODSA 1GKKA 3DKKA 3RLIA 5LZ2A 1XZIA 4U2BA 2QJRA 1XLVA 3O4JA 1WM1A 4P93A 1VA5A 4DSZA 3ZV7A 4G8BA 3CN9A 1JJIA 1MTZA 2BGNA 3WIOA 1SCQA 4E15A 1QIEA 1WHSA 2ORYA 4QA9A 3WA7A 5SYNA 2OGZA 4UFNA 1XRPA 3ZI7A 3ESDA 1BROA 1HL7A 3I6ZA 1YA4A 4AQDA 5A71A 4BE9A 1UKAA 1LPMA 5A7FA 3PFBA 5JAPA 2XMGA 4J0HA 4DMKA 3WYDA 3H2JA 3O0DA 1LGYA 3C43A 1XROA 4C01A 2QOEA 3AFIA 2Q0XA 3VJKA 1ETHA 4Y2UA 4FDMA 4FFVA 5LZ5A 5FUMA 4W1RA 1GXSA 2JBWA 3QM1A 5JAUA 5KREA 2B9VA 1EB9A 4NMWA 3JWEA 5HFAA 2H7YA 3SK0A 4UBJA 4AN1A 5FPQA 2DFPA 4J0KA 2ZVDA 3WK7A 1QOZA 4ZV7A 3C6ZA 3ESBA 3ANTA 1BEEA 2Y6UA 4BYMA 3R3VA 2Z3WA 4M0FA 5CBKA 4PQEA 3CCBA 4CG2A 1TIBA 2P8SA 1ZD2P 3ZLTA 5JARA 1CR6A 4Y2TA 1FFAA 4C87A 1QFMA 3TEJA 2HL6A 3DL7A 3FLEA 2WHPB 4YPVA 5AOAA 3BE8A 4G8CA 1DTEA 4XX1A 2G5PA 5CT9A 4H7HA 2WSLA 3QMWA 3MUNA 5EIHA 2AJCA 2ZYIA 5C8VA 4B85A 4BP8A 1O6FA 1QIIA 2HU7A 4CCYA 2O2HA 2PVSA 2WU4A 4H7FA 3G0DA 1YAJA 3O9VA 1BN7A 4QE3A 4B7ZA 3DYIA 1CV2A 2WHPA 1TKRA 4Y2QA 1QIFA 1PJAA 5CW2A 3WKEA 2WLSA 4W1PA 2J3DA 1SFRA 2XLBA 2W6CX 4L3WA 1BRTA 4G1FA 1PFQA 3L1HA 1DQZA 3UMJA 4ZV9A 4ZWNA 5IKXA 4LYEA 3IUMA 2BGRA 4H18A 1JMKC 3HRHA 5DJ5A 5ALEA 1DT5A 2JEZA 3G9ZA 3A2MA 3KWJA 4CIAA 3Q8WA 1CUBA 3BDIA 4LXIA 1XQXA 4CIBA 3FLAA 1Q83A 2XMZA 1AMNA 1DWOA 4AO8A 2WHQA 3EF3A 5AOCA 3T4UA 2WIFA 2C58A 2WUGA 4JEIA 3EQ7A 5JADA 5JZBA 1EHYA 2WILA 5C8XA 1FFBA 2YYSA 4J0JA 1SCIA 1ZIYA 5CT6A 2EDAA 1R50A 1YSCA 3O4IA 3N0TA 4UHDA 2PUJA 2J4FA 3GROA 3WKCA 5AP9A 3PF9A 4H7KA 4C88A 4BAUA 1H23A 4BP9A 2WUDA 4H0CA 1XZDA 1ZIXA 1M33A 4GHWA 2VF2A 1H2WA 3C5WP 3D2BA 1CUVA 1UK9A 5JATA 1VOTA 3WWPA 4N5HX 5AK5A 2Y6VA 1GQSA 4GBGA 1YS1X 2VATA 5E4YA 4S0XA 3A70A 2RIPA 4AX4A 1CFJA 4C6HA 4HRYA 1CUXA 2BCEA 2QJWA 1FFCA 4Y2XA 5LP1A 3HYSA 3RK4A 5ALPA 4NS4A 3PUIA 2HA0A 4Q3LA 1THTA 4UHHA 2PU7A 5ALVA 3GFFA 5T4HA 2C0PA 3E0XA 4BRZA 4IH9A 1QIDA 1IUPA 3BJRA 5BV7A 4EUSA 1LLFA 5DTJA 1U4NA 3VKFA 3D3NA 1VE6A 5CT4A 4JYPA 1QIGA 2DSNA 3WKBA 2WUFA 2BUCA 3Q0TA 2XLCA 4W1QA 1CUIA 5T4BA 3F67A 1CUSA 1RP1A 1HQDA 1R4ZA 5HFNA 3UUFA 3IIIA 5I8PA 2VJDA 4OB6A 1JMYA 1XZHA 1UKBA 4MXDA 4BAGA 5D6OA 1AURA 3QZUA 3FVTA 2JF0A 1SOMA 1AZWA 3CXUA 1VE7A 4JYMA 4UHCA 4I3FA 5LZ4A 2XUGA 5AJHA 1AQLA 2XMSA 3D7RA 2WJ6A 4H7DA 1YS2X 4DYHA 4PSCA 1QLWA 3LLCA 2ECFA 3LCRA 3VXKA 4ROTA 1J06A 4EZIA 1EX9A 1FFEA 5JAOA 4NZZA 4AZ0A 4U2DA 4UBNA 3G0GA 2ZJ7A 5E4JA 4DIUA 5FDFA 5LZ9A 5AKGA 5AI0A 1YB6A 4Q1VA 4BCDA 2XUAA 2DHEA 5E4TA 3TJMA 5HF8A 5HKAA 1JJFA 4PSDA 1FJ2A 3HEAA 5HKBA 5IVDA 4BVJA 2OCGA 4OYYA 5EHXA 5I7UA 3H0CA 3LP5A 1ZI6A 4X93A 1VXOA 1QGED 4C4XA 4ARBA 3IDAA 2GZSA 1XZMA 1CUHA 4K6GA 5CRIA 1Y7HA 3EQ8A 1ZGCA 1CIJA 4GEGA 2XI4A 4FOLA 1BCRA 4OPMA 4GECA 4GXNA 5AHXA 3IULA 1ACJA 4DNFA 5AKXA 3O4HA 2HADA 3AZPA 2XMDA 4LKOA 4U2GA 1CUZA 1G66A 2QZPA 4GLBA 4BCBA 3JW8A 1XRNA 1EK1A 5IH7A 1AUOA 4PNZA 4H35A 3FCXA 5AKJA 1UWCA 1HKHA 1W6RA 1OXMA 3KWFA 3UUEA 1WHTA 1W52X 3BF8A 4EBBA 1A88A 1DWPA 5DYWA 1F6WA 4DSAA 3T52A 5BWBA 3L1IA 5ALQA 4DNOA 3QMMA 4KAJA 1CLEA 2HA7A 1UOPA 1CUAA 1XRQA 2VTVA 1EDDA 3K9BA 3LS2A 5ALWA 5HQ3A 1ZICA 1RYYA 4W63A 5D7BA 1P0IA 3KXPA 3C6XA 4QDUA 4O08A 4AMYA 2X8BA 3FYUA 2BUAA 4KEAA 1K6EA 4Y2JA 2XMQA 1KEZA 4IH4A 1BU8A 4G4GA 3G0CA 5FV4A 3WWOA 1Q0RA 3DCNA 4X3CA 1DX4A 3FVRA 1QIMA 1GPKA 1VXRA 3L1JA 3C6YA 4L9AA 1XLUA 1XKLA 7YASA 1CUEA 2WIDA 4UBOA 3WWDA 3VJMA 1IUNA 3MGAA 4E14A 1H2XA 3M81A 3F96A 3S2ZA 1LZKA 3MUOA 4J0IA 4BTVA 4M0EA 5FRDA 4MJ3A 5AI8A 1Y37A 3IVMA 1D07A 4BAZA 1XZCA 4DMFA 4F0JA 4JH0A 4B0OA 3R3YA 4X6XA 5D3KA 1J2EA 3OOSA 1MX5A 1O6GA 1A8UA 4OU5A 4U2FA 2R11A 1HDEA 2O2GA 4B6GA 1P0QA 2XE4A 1BCSA 3VISA 1TCCA 2B20A 4OB8A 4K2AA 1G5FA 3H17A 3FSGD 1C4XA 5HCUA 4B80A 4HVTA 3H2KA 4WY5A 3C5VA 3G9UA 2DHDA 2XUKA 2JGIA 1ZJ4A 4ZGBA 2QXUA 2Z3ZA 1J1IA 2OAEA 1EA5A 3G0BA 4HXEB 2V97A 2ZYRA 3H1BA 1QIJA 4CG3A 3A2NA 5CT8A 2AJBA 2FJPA 3DOHA 3HC7A 2OQIA 1MAHA 5CT5A 1UOOA 4YK7A 2BJHA 4WY8A 4U2EA 2VAVA 2GZRA 4X85A 3D2AA 2E3JA 3FAKA 3MVEA 3ESCA 4B81A 3W9UA 4ZRDA 4BC1A 3V1KA 3SWWA 5AK4A 1K4YA 3F8SA 1G4HA 2GBCA 1XZGA 2VJBA 1WB5A 4YASA 4Y2RA 5ALTA 1PV1A 4BE4A 2WUEA 3D5EA 4G4IA 1XRMA 3C70A 2D0DA 4HRXA 1R3DA 5EHNA 1OCEA 2XUJA 2HA3A 3G9TA 5DTIA 2PX6A 1XZEA 4INZA 2WFLB 3R3WA 4FMPA 5A7HA 4I4CA 3YASA 3OG9A 3H2GA 2ONCA 1G42A 4DNQA 4BVLA 3BXPA 3WKDA 2YXPX 2OCKA 2C4HA 1QZ3A 4BATA 1GPLA 5AK6A 4UBKA 4K6KA 4Q82A 1L7RA 4X91A 2HFKA 2PKYX 1E89A 3QPAA 3W2TA 1DU4A 2XT0A 3WL7A 4KR0A 5DYTA 2GBFA 2Y1KA 1U8EA 2RAUA 4DLNA 2GBGA 5ALNA 2PL5A 3IA2A 4Y9SA 4B82A 1XQVA 4QZVA 1MX9A 3DKRA 4H7EA 5JD5A 1TK3A 1JFRA 3GBSA 5YASA 5FXMA 1Q84A 1R88A 1DINA 2QR5A 3IB3A 4YX9A 3F97A 1YASA 1TAHA 4X94A 3AIOA 3WK5A 1K8QA 4MYSA 1X2EA 5H3HA 5AM0A 2O7RA 1QE3A 3B5EA 2XUQA 4EHBA 4JUIA 3HABA 1F0PA 3QVMA 5AM3A 1B41A 1R1DA 2PSEA 1H2ZA 3V1NA 1NU6A 1HPLA 3E3AA 3H04A 2OPHA 4BCCA 4X6UA 2H9YA 2BAGA 4F5ZA 1RWQA 5AIAA 4H77A 1EH5A 3U1TA 2PU5A 1IUOA 4PV7A 2AXEA 1ORWA 1USWA 3QPCA 4MEBA 2G63A 4QDXA 1WOMA 5ALDA 4C89A 2JGKA 3R3ZA 1UT6A 4X95A 5JASA 1JI3A 3STWA 4CCYB 5LIPA 5C8ZA 2HU5A 1JT2A 4B0PA 4W9RA 1KU0A 2OAGA 3EIOA 4FNMA 3ESAA 3QITA 4KJXA 1BS9A 3STYA 3WYNA 4UBMA 1ZD3A 3PFCA 1DX6A 2VJAA 5LZ7A 3HJUA 1YR2A 3V9AA 3WI7A 2PM8A 1WCYA 3HI4A 1AX9A 4E46A 1ZD4A 4QWWA 3WZMA 5CH8A 2BKLA 1XZFA 4Q34A 4QNNA 3FYUB 2OLEA 3AZQA 1XQWA 1CUCA 3AIMA 5HQ3B 2VEOA 3WWCA 1MN6A 2XQGA 1EDEA 1X70A 3B12A 2Y2VA 1EXWA 1XZBA 2Y2UA 4HXGA 2WG0A 4CCWA 1YCDA 2NW6A 1F0NA 4FHZA 3BIWA 1E5TA 1EVQA 3R3UA 2PUHA 4Q3OA 5FOQA 3LIPA 3G9XA 3OTQA 3M82A 3ANSA 1EI9A 5ALGA 3I1YA 3DL4A 3R0VA 2GYWA 2PSJA 4KACA 1E8NA 1TCAA 3A6ZA 3VJLA 1ZOIA 1IMJA 2GBIA 4J3JA 2ROQA 2UZ0A 3DJYA 5LLSA 5AKIA 1VKHA 2G5TA 1DWQA 4HS9A 5DNWA 3ICVA 5ALIA 4H7IA 3I1IA 1MJ5A 4A5SA 1L7AA 5EIAA 3FYUC 1QFSA 1EINA 2QUAA 5ALKA 3M83A 3WL6A 5D3ZA 1UOQA 3AJAA 5AM2A 4FLEA 3STXA 2OG1A 2DQYA 5JZ9A 1C7JA 3FSGA 4OD0A 3VVLA 3FWHA 3GZJA 4UBIA 4X7BA 5EI5A 4OSEA 4H7JA 4GDMA 2ZSHA 5AI6A 2QS9A 3PF8A 1UK7A
chains in the Genus database with same CATH superfamily
1G9SA 2PX8A 3MG9A 1ENYA 3PT5A 3LLMA 1QOQB 1K2VN 2VYNA 4F1JA 3GJ4A 3B2QA 5KB3A 1ICIA 5TPWA 4LPKA 1PR9A 2R6AA 3TYXA 2CHGA 3K3PA 3MAGA 1RXVA 1TGVA 2HNAA 2XQJA 2ZE7A 3WK4A 2O7NA 3DTVA 5FBHA 1DTWB 1S4QA 3DDNA 8OHMA 4A0QA 4B2LA 3BS4A 4WL0A 1E9AA 1J2TA 2A5GA 1A50B 2WJHA 3DDUA 4CLHA 1R8QA 4DC0A 2Z5GA 4UHBA 5CFPA 2Y9MB 5IH3A 5KEIA 3L6CA 2GCOA 4ESHA 1GTG1 1THMA 4DKJA 1QKIA 1F7VA 4QU0A 4D0LB 4JZKA 3WQHA 5LQKA 1XRSB 5CYFA 2K2WA 1R9MA 2P41A 3HCOA 3HA5A 4QBFA 2IS4A 1BS2A 3DZFA 3P2MA 4JXZA 2O52A 2IP2A 2LDXA 1JHXA 1I2ZA 1Z4NA 4RKEA 2CYCA 3MIZA 4YDSA 4OXKA 1FF9A 4M53A 3LBNA 1U1GA 4AM8A 2BFNA 3COPA 4RXUA 3REQA 2X1HA 4DV0B 1P3DA 4U7JA 1XDGA 2JJ1D 1EM8A 4LDPA 4F3KA 1F4PA 2FSVA 3U0BA 1J0AA 1GPMA 1KJ8A 4QUKA 4YRPA 2XUDA 4M83A 2RCNA 4LXYA 3RGGA 2O0MA 3PFFA 4W5WA 3A6PC 1Q44A 1S6YA 2N3ZA 2NADA 3IBCA 4NECA 5DWDA 1E1DA 4ONEA 1GGVA 1JEEA 3HUUA 3P9XA 5J23A 2HB6A 3FPLA 2OUKA 4L0CA 2CV0A 2FW9A 1E3EA 3BF7A 2QMUA 2QMQA 3K6KA 4H1HA 4UM7A 3U3KA 4OQEA 2RAPA 3Q6NA 2C8KA 3CH4B 4NVRA 5HF6A 3UMFA 5FWNA 1ZXLA 4WDRA 5F3RA 4A91A 1P7YA 1OAAA 1Z5UA 3EXEA 3LLSA 4QXPA 5CLIA 2VKQA 3BMCA 1OASA 1CZNA 1OVGA 5AOBA 2A8YA 2C1ZA 3TQTA 3DP9A 3IP8A 1HNZB 2OV8A 3HJRA 4ACBA 4QGFA 4WH0A 3SQMA 4M0UA 5F21A 5KYKA 2VTBA 1NG1A 5CITA 4C3OB 5ELXA 2I5PO 2XA1A 4HWRA 4NOKA 5COAA 3RS8A 4F4UA 4F4DA 1N6IA 2YJ5A 3HXLA 1QGUA 3LD9A 3O8LA 4KQJA 4L50A 3V2HA 2ID8A 4BO3A 5KTRA 4AQ7A 2DLDA 1X7YB 5LMZA 4ZQEA 5C37A 2D8AA 3DTNA 4NRDA 3PICA 3AU9A 4DCUA 1XFDA 4TXLA 1WCIA 5FQOA 3V4OA 3A4NA 1ABBA 2IS1A 1VL1A 4IRUB 4DG5A 2C8LA 1JVNA 4KHPB 2QG9A 2GN2A 3D5TA 4NU6A 3PEEA 4URZR 1TQ6A 4LXGA 5KYUB 4EYOA 4K3VA 4XLLA 3A58B 4A15A 2J1LA 3KKKA 4IIHA 4UVDA 1FVXA 2AMLA 4KP7A 1QYXA 4JT8A 5HA5A 4NBUA 3HWWA 1M1NA 5AHOA 3AYXB 3JWHA 4HQ6A 4C0XA 4PR0A 4BQQA 1GEEA 3CONA 1KK1A 1KRWA 4WNAA 1R18A 2WTUA 3GUVA 1NN0A 4WGGA 5C53B 2H31A 3JWJA 2F1HA 4G89A 5THKA 3JQ6A 2IV7A 1I5EA 4OJNA 3GCGA 1J2UA 2N1BA 1GPH1 2WD7A 3BWBA 5LLDA 1TPZA 2R1UA 4PX5A 4DWVA 2KB0A 3CNBA 1N5KA 3FTPA 1P9NA 2KI5A 3G8YA 1CQWA 3AEKA 1P29A 1JHMA 4FMDB 2I2FA 5KWJA 4N3AA 3NLLA 2LR0A 2YYAA 3OM8A 2PT7A 2W6MA 3HDVA 5JQGF 5CDHA 4Q03A 3WGOA 1GYQA 2HRBA 1ZM4A 2YHBA 3EQZA 3OJCA 4KQKA 4IIVA 4EECA 4HUQA 4UULA 3QWIA 3A1SA 2HHCA 1B76A 2JVKA 1RWMA 2V6BA 4C22A 1L2TA 1SXJA 4ETMA 1U4OA 3P8ZA 3H87A 1NVBA 4QDOA 5COBA 4MITA 4ZPJA 5DBFA 3OJFA 1E66A 3REOA 5K6TA 4LF7B 4FGSA 2BGLA 3RYIB 1KFCB 5KO2A 4Z7OB 2QN9A 2CK3A 3NIWA 4UCQA 2V45A 2NT4A 1KJNA 3I09A 1E0DA 4A0FA 2WIAA 5E7MA 1DCMA 3DLTA 4DLXA 1UF9A 3RG2A 3GJ3A 3NYRA 1FPQA 3L7LA 3PXAA 5I3CA 2RHGB 4X5OA 4C06A 1YZKA 1C80A 1NW5A 2WWIA 4K1LA 2HDWA 4O4HF 1V7QA 4PCUA 4TS4A 5IVIA 5A5GA 5C2JB 5CFRA 2JLWA 1W4ZA 3ZZ0A 4J4TA 2DBRA 1ZHOA 3G02A 1PEYA 2L17A 2QRJA 4R2LA 1Q50A 2Z43A 2J46A 1L5WA 4XWTA 1ES9A 1AKEA 3ITNA 4GVXA 4DSNA 5BSGA 1Y1PA 4P0TA 4G4JA 1ZWLA 2BF7A 4TTVA 3PHHA 1GV0A 1NJ8A 2VUSA 3L8DA 1OBHA 3NEPX 4L8FA 3H2IA 1V16B 3D2CA 5CDSA 2WSIA 3PUJA 4DY4A 5C18A 1U9ZA 1YUNA 1LRJA 4ECEA 3UJ8A 1Z5ZA 3M4ZA 4INOA 4Q4AA 4EPXA 4RTLA 1FOEB 1U0EA 1ZVKA 4NJEA 1P2GA 1E1QD 2ZUSA 3OZGA 4A2QA 4Z3KA 5KWSA 4O4LA 5I6DA 2YZNA 3L6BA 1HLPA 1ARZA 1RYZA 4PX2A 1UBEA 3LSYA 3TNYA 2A94A 4PE5B 4L2IB 2AW3A 3FTDA 1QHGA 1Y6FA 4Z4QA 2QVBA 2Z2JA 3I6YA 1LLUA 3QXJA 4BC0A 4FI3F 2C5AA 3RYHA 1DRJA 2C7GA 1UJ6A 5JWHA 3ZGXA 2ESRA 2KPOA 5C3UA 3RRJA 5U4XA 1I4TD 3SN6A 4YREA 1QJ4A 1GKYA 1QYWA 1J39A 4O2BF 1FJXA 3FCUB 1ODTC 1ZVMA 5JAZA 4KZPA 4OHRA 1W76A 2GO1A 5I7AA 4D9BA 4I99A 1VDMA 3WL8A 4YUYA 1EJ0A 1DBQA 3FMIA 4CM9A 1IHUA 3DUWA 5HIAA 1B42A 2CZCA 4NU0A 1V1MB 2ZBUA 2A9VA 5IAAA 5E38A 3GR6A 5GVSA 1S8AA 4E11A 3GDFA 1O8CA 3UB4A 1LTHR 2Y27A 3ZY6A 1T8SA 2B4KA 1FP4A 3LT1A 1BWSA 3FVWA 5ECGC 4MCAA 2BZSA 3A32A 4MUFA 3WGUA 4UOEA 1NASA 2ZUCA 2C7BA 4HZUB 3SKXA 4OU4A 4NONA 1JDNA 3V46A 1HT1E 1FFSA 1IB0A 1FQWA 1VHJA 3FSEA 5H4GA 1SELA 4L5YA 4G0VA 3DZJA 4H3VA 4C1BA 3SS7X 1T8TA 3REFA 2ZETA 4U00A 3RSCA 3GT7A 1JILA 1YQ9A 3DD5A 3FKQA 5FYDA 2ZUTA 1JHQA 3ABIA 3SBOA 1E62A 2JHPA 4TN5A 3STUA 4ZYZA 3OBIA 2JLUA 4FJ2A 3WRVA 2OB1A 2EW2A 2QTBA 3GP8A 2O2SA 1XALA 3LRPA 4BRSA 3DKIA 1Y8QB 1Q0SA 4JU8A 1IZ9A 1VP3A 2ICAA 3QBJA 4FLMA 1M1ZA 3DEHA 5REQB 2M1ZA 1EK2A 2Z8XA 1J22A 3QY0A 3ZNPA 2UU9B 4XUDA 5LC1A 3I62A 1G2IA 4XDYA 2PUGA 1SCNE 2WIKA 2IGBA 2ZKIA 3N28A 1IG0A 1NY6A 1A95A 3RTCA 1RM3A 3G8AA 4F04A 3TDNA 4J16A 3C3WA 4Y9UA 2QM3A 2CHVA 1Q11A 1QO7A 4FGWA 1ONSA 2XA2A 1UCFA 1C0KA 3FBWA 5CVDA 4JIGA 1DAHA 1H5QA 4Q9JA 2AZXA 1UKZA 1T35A 4LHVA 3NM5A 4AI6A 4DPLA 5DN9A 5KYWB 5IVHA 1QU2A 3H1EA 3LHFA 1LPBB 2RARA 3E84A 1XCJA 2CLFB 2IBTA 3NKFA 2ONKA 4HPXB 3INYA 3R7DA 3ESRA 4PCLA 4M0MA 4E2YA 2G6BA 3HCBA 4S2UA 1VYTA 2J5RA 4F9GA 2WJGA 3AR9A 1LQ2A 4MYHA 1KQFA 3KOZA 1G5HA 3LDHA 7GPBA 4F8EA 5CB8A 1GRCA 2G36A 4MH0R 3WGLA 3V8NA 2K2QB 5DI3B 2E2WA 3MT8A 5AM5A 3MWJA 2R87A 4I4LA 3GJRA 3VR6D 2EFJA 3NDIA 3CLSC 1N32B 1CZUA 4OXXA 1KMNA 1ONPA 2ZRIA 3BL6A 3PJDA 3CBQA 3RRMA 1DMRA 4D3ZA 1I0LA 1PSWA 1O54A 1V0JA 2G82A 2OBBA 4M4SA 1TUBB 3TO5A 1GDHA 1LPOA 3WLPA 2NN3C 5DKFA 4FDAA 5ICSA 2OBNA 3QX9A 1JZTA 2AXQA 2HGZA 6YASA 1VI5A 4KITB 4I50A 4DT1A 5J2UF 1P6XA 3PUWA 2ZYWX 5DNDA 3LT0A 3TRKA 1OXVA 1E64A 2P6MA 1EDBA 4TZ6A 2C94A 4FYYA 1SBYA 4PFKA 3KQMA 2FJ0A 3G2QA 1SUDA 4MMYB 4I9UA 3UT6A 4D4JA 3DM5A 3VC1A 3I0MA 1XEWX 3B6ZA 2A86A 2J8ZA 5JJ5A 1NBHA 4JLWA 3CN7A 5I9TA 1SUIA 4Y9DA 2JAOA 3EZ7A 2P30A 4B75A 1LUAA 5NLLA 2A0WA 1N0IA 1WZUA 3DZIA 4KO8A 2VAMA 4TKUB 1ZGGA 3WRXC 1G5QA 1NJ6A 2QW8A 4XVQA 5KTNA 3DB2A 1I2MA 3HP4A 3QYJA 1ULBA 2ZI4A 4TS3A 3NETA 4DA7A 3AI2A 1YHYA 3A3KA 1T4CB 4QOEA 3RS2A 4Z53A 2C8VA 3DL0A 2G1PA 1TQHA 3S28A 2GZ1A 3BT7A 4I6JA 1TM3E 2VHEA 3LX4A 4ZFNA 3UGKA 2V9ZA 3I2JA 1DCFA 2AQ8A 2WYHA 2Z83A 4QGSA 5H8WA 2BLNA 3RFXA 3EVCA 3JALA 4BN4A 3AJ8A 1YHZA 2V8BA 1S8OA 2ZCVA 3KLOA 2BI8A 4XSVA 4Z86A 2IUUA 3HLKA 3TD2A 1L8AA 1K3TA 4GM4A 2PUFA 4W7SA 2QKYA 2CD7A 3QUQA 4FCTA 2Q1XA 2QTZA 2XQIA 1ABFA 3CO5A 1D6SA 5C7YA 3VX4A 3BA6A 1V4BA 1GL9B 4O5AA 3BHJA 4RTPA 2GGSA 3OETA 4RACA 2UYHA 2V65A 1VZ2A 3NHRA 4I5GA 4YPOA 3EEIA 1XKTA 1P9WA 4ID3A 1X1AA 3GLGE 5BQOA 3L8YA 4RVNA 2O3JA 5F64A 3T7DA 3FOBA 3WLEA 3CVJA 1V4NA 1XN1A 4FE3A 4NCNA 4K1XA 3DBHA 3OPVA 4ND4A 1IJBA 4NL4H 3RDPA 5JLAA 4KN9S 4TV9F 3UWSA 3FCOA 2H65A 1D6NA 4HAXA 4BLWA 2TRSB 3T3MB 3T5AA 4BMYA 2QQGA 1PR3A 5D5HA 1RJWA 3SHWA 3S1SA 1U8YA 4NBWA 1ZZGA 4W9NA 1ESNA 3QBEA 1TMKA 2P4EA 3EGOA 2B4TO 3N8DA 4GOJA 4D9NA 4JC4A 1EWYA 2O2EA 1KERA 1LJUA 1CRPA 4RSGA 1IOZA 1C50A 1QTNA 4OKIA 4XJSA 3UWOA 2ANCA 5B6IA 2D1TA 5AR1A 2GYVA 4CEHA 1VJCA 1FTQA 2EFDB 3LZCA 4FFSA 1DXOA 2IKSA 3LZ6A 2GETA 3OF3A 4EY4A 1OFTA 2OILA 2QD4A 1SD5A 4I7EA 1SUBA 4NQZA 1PUXA 3R40A 4CYMA 3TGLA 4KAAA 5A5EA 3W9BA 1DIAA 5K3AA 1V11A 4KG7A 3IXMA 1T6BY 3H5AA 5HKOA 1UPXA 3L8EA 4GIBA 3ZE6A 2CXRA 3PQEA 4BJ1A 1HZZA 1K5DA 1BN6A 4IDQA 3A4TA 5DLEA 2Y99A 4M9ZA 5BNFA 5I7EA 1V6CA 3G88A 2HSDA 1OR8A 1FP1D 5K3CA 3HU5A 2WVAA 3T6KA 1T24A 2X6TA 4ZXFA 1WKBA 4RX1A 2XDYA 2JLVA 3FHOA 1A8SA 1Y8CA 5HWSA 3D59A 2IYTA 1KI8A 2C07A 4Y0NA 4LFBB 3U5TA 4RZ2A 2G40A 3BC1A 4KIUA 3QEAZ 1G17A 2CFCA 2JS7A 1MABB 3H1FA 1EUCA 5F4ZA 1SZDA 2HBZA 2YUTA 3UC5A 1F1BA 3DHEA 4BGEA 3AUJB 1TZCA 5F2KA 2HRRA 1NRWA 3FGOA 4KBGA 2J0QA 1N6OA 3KAJA 4HAIA 1FSGA 2DUNA 2PAFA 1P9LA 2VHVA 2JHFA 4RD1A 1PVVA 3HDGA 4D8TA 3ONVA 5AVYA 2HU8A 2W7TA 5F35A 1FDIA 2HM7A 5FULA 3UQZA 1MMFB 2G9ZA 2ZAMA 1X8LA 3ISTA 1YBHA 3KXKA 4UMFA 1IFXA 3SHVA 1LSUA 5BN4A 2C7QA 4L0MA 5CVCA 3PC7A 1GCGA 1W5FA 1SPBS 1US8A 1VTKA 2PSHA 1N75A 2Q62A 3T3GA 2ZE8A 3C16C 1DKUA 3D9QX 3TTVA 4N12A 3ZIAD 5BQFA 5IS2A 4Z7NB 3HU3A 4Y2YA 1OSNA 1QDUA 3M4XA 4KAFA 3U61B 3WMRA 4CMCA 1RD4A 1W46A 3DNFA 2B69A 4Q7QA 5HR5A 4Q1BA 3VR3A 4RTQA 1EWVA 3GXBA 4JUDX 3NHFA 1W73A 2G07A 1JYEA 1SUFA 2BFWA 3GRCA 1DKPA 2GHIA 3L2OB 4HWPA 3F6PA 4LYYA 5EWJB 1JU9A 4NNPA 1A76A 1Z47A 2FEAA 1NHGA 4BHTA 2F59A 4PZZA 4JJZA 4DXAA 1F8UA 5J4YA 3D8UA 3PG5A 5KJCA 4D5GA 4IWNA 5EP2A 2ZTSA 3FNEA 1H69A 5JZSA 3ZZ1A 4QDZA 2H1SA 3UWMA 4BNDB 1Q95A 4R7ZA 5BOVA 5A4KA 1J0CA 3SYRA 1A9YA 2HI0A 4QATA 2EX4A 3SR3A 1Y1TA 2GK6A 2BF4A 2WU1A 1MTOA 2ZJYA 2IUYA 3HACA 2WJZB 2VH5R 1F7UA 1OZ0A 1IZ0A 3UK1A 3ANLA 3W3AA 3VKGA 3IDQA 1A71A 4Q93A 1M74A 5ESDA 4R1UA 3HFRA 3KTAB 5FUQA 5IFLA 4HNSA 1TA4A 1N0HA 1W88A 1V8OA 2H7XA 1QDLB 2XDQA 3M1LA 3EISA 3TZCA 5JY1A 1LX7A 2HRZA 1PZXA 2ZBPA 4A26A 1SOVA 5JMWA 1TC1A 4UHEA 2OORA 1G8FA 5SY6A 4B87A 1C3JA 4XH9B 5KQMA 4FSDA 4ME6A 2XCUA 1M73E 3VJKA 4B80A 3OEHA 3O2QB 2WFZA 3TRIA 3WY9A 1CJCA 5EWMB 2ENWA 1KTVA 5I8ZA 4EA7A 1OU4A 4P4LA 3TQHA 3V3TA 1AKYA 5SZJA 3RKSA 2PMFA 3T7JA 3UPUA 1PJLA 4NCJA 4RK0A 2YMQA 1E1MA 3KVVA 2HO5A 2QT1A 3CRVA 4XQEA 3DA8A 4I1PA 5JH7F 5KYXB 3PZRA 1YU6A 3N8NA 3SC4A 2HMUA 4MS1B 4CU5A 5J3JA 4I2VA 1M7GA 3VSEA 1LDGA 5EFZA 5U9CA 3KBOA 3UB2A 1GRNA 2VQ6A 4OLJA 2X0NA 3D4LA 3KR0A 3ST7A 4B71A 3PV0A 5I45A 1U0GA 4HQFA 4AY5A 1LQUA 3TL2A 1GZ3A 2HMYB 4K05A 1PX0A 5G1PA 3L0SA 5DM4A 1HTTA 3SHFA 1BE1A 1JJAA 2Z30A 1TUBA 3G2PA 2LXNA 2D7CA 3NTRA 1WCXA 3R0JA 4MUEA 1YAHA 1MVOA 4TLAA 3ZJ4A 2ZM5A 2FOIA 3L8GA 1IN7A 3VKWA 3W7AA 2P0YA 3DEIA 3P4YA 2EFCB 4LBWA 2WJAA 1C9DB 1E9FA 2OK7A 4QGAA 1LBHA 4IV0A 3CA8A 5D86A 4ZI7A 1D2NA 3EFEA 1L5ZA 5K4HA 2V7PA 3OT1A 5ESXA 5DSXA 3ANYB 4FHDA 1G5RA 3WGGA 3BMOB 4J8PA 1Z35A 4HC4A 4RAOA 5AICA 5G3ZA 2UZ1A 4IIYA 1MB0A 4MV4A 3I9FA 3OX2A 3EZ9A 2P78A 1CJVC 4ZO6A 1Y34E 5JCOA 4IIGA 2A7QA 2QV0A 1A4XA 2BFPA 4OHXA 2FP3A 1RT9A 4G86A 3MEQA 4JMLA 1EFLA 4IIXA 5C35A 1QH1B 2ODNA 3OZIA 4L72A 4Z9FA 1BE0A 1W2GA 2WTXA 2B92A 4F06A 2FPIB 3IHWA 3DMYA 4PG5A 4FP9A 2BMVA 2IKQA 3VO9A 5HDBB 2IYZA 3KWLA 1PT9A 4PIVA 4KN6A 4D9JA 2D3WA 2DMRA 3VBEA 5EJ4A 1PX2A 2PX3A 3FIJA 5TC4A 1LBIA 3BZUA 1CE8A 4ZAGA 2WINI 5DGXA 2HF8A 4KXLA 1EX1A 2ZUWA 3P2JA 3SJAA 4EF4A 5T4FA 4DDTA 5B4TA 5BNIA 5JANA 5E3JA 1C29B 1M0TA 3OSZA 4EFLA 4YJ2A 1N2SA 3TPCA 4YRGA 5TDHA 3QOXA 3GLVA 4IOKA 3O74A 3COJA 3MC1A 5JSFA 1U9CA 3E05A 4AJEA 3PYLA 4OX9B 4MWOA 5ERXA 1A7KA 2XTJA 3ZWVA 4PANA 4BNGA 2B5OA 2JK0A 2YOHA 2X3UA 2W93A 3ZW8A 2RI6A 3IKVA 4UQLA 1Q19A 2H1HA 1VLLA 2VF5X 4ZHSA 4HH0A 4ZREA 1ZM9A 3OIDA 4GKKB 2A5DA 3JV7A 2Q6LA 5JC1A 5IC6A 5CM9C 5JSZB 5JRZA 1ZXXA 3IEIA 2Y4OA 4KLZA 4DV6B 1ODFA 2QLFA 2VI5A 4G41A 2QL7A 2I3ZA 2HWYA 3U4QA 3LV8A 4LY0A 1ZI9A 4JLOA 1VPVA 2DR3A 3P9IA 2FUKA 2VJNA 2YQZA 4LRYA 5ALRA 2IU0A 2QAIA 2WZBA 1I9CA 3GFPA 4X97A 3ML1A 3MGCA 1NQ5A 3PTAA 2JLZA 2QDKA 3UJNA 1JB1A 4RVGA 1O6BA 1V35A 1QZUA 3OO1A 1OROA 4OMCA 4LHXA 3HP7A 2B4QA 1VIDA 3FUCA 1EUDB 1Y98A 2J3JA 2VZLA 3IH5A 3OTIA 4QLAA 1FX0A 3OC6A 1A8HA 1CY1A 2VDWB 4LWPA 4W5HA 4R2WA 1X38A 2DQKA 3U6KA 1NWCA 1GPUA 3MAAC 4EJSA 4S1TA 4LE0A 3OH8A 4TTRA 5TY0A 3WMFA 4DCNA 1AO0A 1QP0A 2QSUA 3C3KA 1QCZA 4XX0B 1M72A 3IE2A 1XLTA 2GXSA 2P3SA 1KZ9A 1E9DA 1QGZA 3EXFB 4X1YA 5ALYA 4XWGA 5FBWB 1C5KA 2QE6A 3QMPA 3SR0A 3VDMA 1PGNA 4N9WA 4WFKA 5KTPA 2B1IA 1O6ZA 5L3SA 5F1YA 3U31A 3WFJA 2J9GA 3C87A 3ZPXA 2IYWA 3WBKA 3FH0A 1QGAA 5KSPA 3ZIUA 2WT4A 3BWVA 3F6YA 5GWXA 4C7MA 1C4KA 4AZ3A 1YR9A 1H2YA 2W70A 4BX8A 4KVGA 2AFHB 2PT9A 4RCYA 3WMEA 5AESA 5DEOA 1GA4A 3WOHA 5DBGA 3BIXA 1A3CA 1K63A 2NIPA 4C30A 2B25A 1YB2A 2GF0A 3ZDCA 1WD7A 3DMRA 5HIJA 6GPBA 5IANA 2NU7B 3T9CA 3VDNB 5EA2A 3ZX5A 4TMXA 1C1HA 1LPAB 1RQ2A 1YDFA 4LJKA 3BWXA 4RD3A 1WB4A 3JWGA 3OAAD 3IP9A 2R1TB 4DV2B 2YMLA 5D87A 1E63A 2FPKA 2OBFA 2Z57A 3FNBA 1T0IA 2D74A 3U9SA 1SXPA 4K0RA 3AY3A 1G18A 4IOMA 2JHGA 4PXSA 3UJ3X 1TU3A 4KHZA 4QVIA 3WOVA 1KJJA 5LYJF 1J8QA 1VA4A 2C61A 2R68A 4LYDA 3BFJA 5EKUA 4BVFA 3FZEA 3WK9A 4DS3A 1K06A 5FOUA 3KIPA 3PPWA 5TMBA 4F6RB 4Q1CA 3IUQA 3LQ2A 3KRTA 4RL6A 3LI2A 4KTTE 5DXJA 1ZESA 1KDTA 1AC5A 2G5GX 3ILYA 5JCJD 1E2NA 1ZJWA 3K8OE 1XQ9A 3AVUA 3EBLA 4HTAA 1GZUA 4BLRA 3L8ZA 3ADDA 4KYIB 4NJEB 4FI3C 4G23A 4LJ6A 1JHDA 3ISVA 1UL1X 4G8DA 5AKZA 1E0AA 3CW2A 2PIAA 1YQUA 2HD4A 2V8OA 4TWJA 1M34E 2JHAA 3A1NA 2QD3A 3FOFC 1VJ1A 2AJLI 4QBGB 5A4DA 1EUQA 2AOVA 2PS9A 1Y9EA 1H2AS 3JQFA 1Q91A 1YVDA 4EJ6A 1EAMA 3U37A 5JXIA 1N8NA 1O5TA 1W34A 4CGZA 3CUTA 4LHEA 4NP6A 2GAAA 3RWMB 2JBAA 1PKXA 2W2PA 4YCBA 3W5SA 5KPDA 4FYVA 2Z58A 3B6KA 3UBTA 3NT2A 2XUZA 4IG4A 5ALKA 4I1YA 5JDIA 1ESCA 2B0JA 3HZOA 3S5JA 2DBYA 2P0AA 3WNCA 1NJGA 3S7TA 5LM3A 4RFLA 5IZCC 4YY3B 3ICEA 3Q1KA 3SX4A 5CB4F 4WERA 2WD9A 1D1PA 1M75A 1AIPA 2AMYA 4RIHA 5FFFA 3THWB 1X7WA 2ZSBA 3FI0A 3TSCA 1PQPA 4CLRA 3QX7A 4NCAA 1NLYA 1P31A 1PJBA 3GMTA 1R0CA 1DG3A 1NKVA 4KQ6A 4UHFA 1Y3BE 2BE7A 4OOEA 4PFQA 1MKYA 5C3MA 1SGWA 4QQNA 5C5EA 3I5MA 1XRLA 3EXHC 4M1KA 3EGWA 5HE9A 3RUPA 4TKVB 2R8BA 5ALFA 4UJ3A 2FPSA 5I4KA 4ZVLA 2CUTA 3NWOA 1RI2A 1G8MA 3QKUA 5AW9A 4LXUA 4UASA 2BW0A 3HM2A 4R41A 5CB4A 3DNMA 1XJ0A 1OOEA 5A6SA 2H57A 3HKCA 3QVGB 4AS1A 1Y1RA 1VYHA 5AKLA 1W6UA 3FNGA 4ZAVA 4BVAA 4DQLA 4P3KA 5EJ6A 2JLSA 1PE0A 4RQAA 4YRDA 4PN7A 4KWHA 1OTXA 2VDKB 3QFCA 1OFIA 4LN1A 1NURA 4JN6B 4MYUA 4P4SA 5DNUA 1E6EA 2R3SA 3BFPA 1D2GA 4MV7A 1M8JA 1FVHA 2FUEA 4K9KA 2WJPA 1KBQA 3AKCA 5C8YF 1Z6XA 2BSXA 5KZMB 4II3A 3WLJA 5K3OA 1R7RA 3EZYA 3DUFA 1N5DA 1CRZA 1OB2A 4Y6RA 1T3ZA 1L5LA 4XVRA 3REQB 3ECAA 3TEFA 4LJ7A 3JPWA 4WASA 5I51A 2WMNB 1RJFA 1K7XB 3GJQA 1IVYA 4CFYA 2PMWB 2JGJA 2GEKA 3OEWA 4K40A 3I2GA 3DE1X 2ISCA 1E0JA 1G9XA 2PKQP 2WUWE 3EVEA 3NXKA 4QUDA 3NHUA 2PR2A 2D5LA 2HOQA 1VB3A 2ECOA 3O8RA 4B73A 2I6XA 3GEHA 3MCZA 2DHCA 3GG9A 4KLNA 4Y6QA 2I3AA 2DWUA 4GQIA 1VHWA 1W4RA 4GWLA 1QJCA 4AXXA 1AO3A 4H3HB 3VDRA 3TLMA 1ETUA 1NUSA 1ZIPA 2J4DA 3KZMA 2QYTA 4Y6OA 1NN1A 3PLNA 1QNFA 1VCHA 4WLEA 1UXKA 2Q3LA 1YDWA 4F85A 4EY7A 4EJ2A 1IVSA 1G6KA 3DGEC 5DV9A 5FL7D 2GAFA 1QO0D 1NOIA 4A0HA 1EBBA 1T1SA 3WK8A 2CZQA 4U3JB 1AVTA 1GKKA 1H94A 4LWQA 3DKKA 2C4NA 3D6MA 4YACA 5DTEA 3RLIA 2OZVA 3OY2A 5JI3E 2RGYA 2PVCA 2XIJA 4WIAA 2OFOA 4ZRMA 3RVBA 4D4MA 4UCXA 5EJAA 2HJSA 4N0DA 1JQLB 4M0DA 3JWPA 1QVAA 2IYVA 2QLMA 4W7IA 1X1TA 1PSZA 3L6DA 1SWVA 4JAVC 1HSZA 4CTNA 1L5HB 2F7SA 2H51A 2OD2A 4IDDA 4JVMA 1SKAA 5DASA 5BW8A 3VPHA 1MRZA 1ORIA 1QGYA 5KI6A 1T8UA 1U7DA 3RS3A 4WQMA 3K35A 4G56A 1SCQA 2VK1A 1FTWA 2PLFA 2Q3MA 1Z6YA 3BD6A 2FGKA 3THWA 2FWBA 4GM1A 3WA7A 1O0BA 4HAOA 5J9FA 1HFKA 3QU5A 2XGMA 1XRPA 5ER6A 3U3MA 1M0WA 3TZ6A 3OOHA 3AW8A 3RQSA 3W5IA 1I80A 1TF2A 1VBNA 3C2QA 4Q9DA 2Z1DA 2BEUA 4WBNA 1Q12A 5C8DA 4J0FA 1TVEA 3BQ9A 3HRIA 5A7FA 1LPMA 3PFBA 5B3JA 3BZBA 3CT6A 3PRYA 4HDSB 4P38A 5IM4F 4FMBB 2KSQA 1M5TA 1ENOA 1HE8B 1L5SA 1C81A 4JI0B 4J3NA 5TMPA 4W7HA 1QSGA 5A4JA 5LD2B 5LP6A 4PG4A 3T1YB 1YR7A 4DQXA 1N57A 3QI2A 3LNTA 1COWD 2VQ3A 3UYKA 1SB9A 4MQ6A 4ALNA 1QWOA 1M2OA 4JENA 2H2AA 2VQSA 3ET4A 4GSKA 4RMGA 2XJ4A 4ZCLA 4IUBS 3CO0S 4TSKA 2ET6A 1R4AA 3U39A 1WCWA 3EH2A 1RTTA 1ZR2A 1DQRA 2LPMA 4QQFA 2WJJA 4J43A 4JXJA 2Z1NA 5GZ1A 2QVCA 3INGA 2PXCA 4ASUA 4XDHA 4Y2UA 5A2QA 1HTBA 3A6DA 2YZMA 3AERA 4FFVA 5LZ5A 3V7FA 4CKWA 1IXKA 3FGNA 1JKFA 5CDUA 4F2GA 2FZ5A 5AJYA 3SOPA 1RCUA 1NOKA 2IU6A 3QM1A 4ZI7F 5BUQA 5JAUA 4I0WB 3A26A 1ZINA 3WYBA 4LOKA 2NUAA 2VPZA 4NMWA 2OEPA 3DCYA 4J1TC 5HFAA 1Q1NA 3TAHA 2XZOA 4JV5B 1RQGA 2R2GA 3SQNA 5EZYB 4BNTA 4NR0A 2Q8PA 4G4SP 4CT5A 3OZVA 3QE2A 5FPQA 5H5JA 4J76A 4DHEA 3KJEA 4IZHA 1ENPA 1EQ2A 4Q9HA 4ZVNA 1U5BA 3O3NB 3UCXA 2CD9A 4MGEA 4M0KA 4DQDA 3CMMA 1RDFA 4BWFB 3Q5DA 3FZNA 4WZAE 2WF8A 1JXQA 1QOZA 3GD7A 4TUYB 4WTOA 1UBFA 2QMHA 2Y9PB 3EGVA 4A0SA 4WT7A 3FE2A 1Z33A 2GRUA 4QM7A 2C5SA 3R3VA 4LG1A 4D96A 2Z3WA 2VEDA 2YXLA 4G84A 4INPA 5AW1A 1MEOA 5JH7A 2ZSUA 1XT6A 1QMGA 3OJLA 2BBSA 3NATA 1D04A 5AQEA 5K6RA 2JCXA 4RV5A 1CZLA 1Q2XA 3JATA 1RWOA 2JJ2A 4Y2GA 3TBHA 5JTUA 3NV9A 1A5AB 2A4KA 4M1MA 2VHWA 3ZLTA 3PNOA 4C78A 2INGX 2P2SA 3EA5A 3UH0A 5IDQA 3HVIA 2HWWA 2Q4OA 2VTEA 4XR9A 4D0NA 1Z4PX 3AOEA 2NG1A 2XKKA 3MT9A 1P8AA 2YYZA 3OQVA 1VYUA 2J5QA 2HL6A 4ZD6A 3DL7A 2A14A 5CM2Z 4IHJB 2QP9X 3WGIA 1WZEA 4QGHA 4ZDWA 1QX4A 1L5QA 3DLIA 1M6EX 1KETA 1WZNA 3QKIA 3JZAA 5ANRB 2NNLD 3BE8A 1AGPA 3QIVA 4G8CA 1M2GA 4GR5A 2CEAA 3QUSA 3PXGA 1MJHA 1JP7A 1N8KA 1HUQA 5G0SA 3T12A 2BOVA 4E4TA 4IQGA 3O1LA 1FBNA 4PZYA 4O4JB 2F00A 4JKIA 3WP1B 5AVXA 1T0HB 2ODBA 3D6VA 3QYFA 2HN9A 1KVUA 1U02A 1XWIA 4RF5A 3V8VA 3U44B 4RL4A 3RFVA 5C8VA 4RVHA 2P9BA 4P8RA 2Y0EA 3JVVA 4J49A 2RGNC 2PX4A 3FBTA 4DUYB 3RV3A 2O2HA 1U9IC 1T4CA 1R66A 2XITA 3DBOB 4ZU6X 5D2CA 5CNMA 3O9VA 1XMJA 1TGYA 1E5DA 1JJ7A 4JUFA 1BO6A 3C1OA 1OJLA 5CPBA 2QG4A 4K87A 5TQ2B 4ZMRA 5AVTA 3R4CA 4WBNB 3FFWA 3A1EA 5L4NA 1DKMA 1W9HA 4C0WA 2WF5A 3KHSA 4MRRA 5H81A 5AW7A 1QIFA 1RWKA 1U9JA 5DK6A 1A9RA 1FTGA 1S3SA 1TLTA 2NU6A 4B3JA 2CFRA 2X3FA 4BBPA 4V24A 2JFPA 1SFRA 4I5FA 1ZUIA 4YFVA 5FADA 1K2WA 4NYMQ 1BRTA 4MA0A 2CXUA 2FMXA 2L19A 4AECA 1NDUA 5CGZA 4BO2A 4WOPA 5L7YA 1U2SA 4AY6A 3CWZA 3H11A 4EI8A 3OQ6A 1GPYA 1DELA 1I5OA 5JZMA 3ZGZA 3VDQA 2FMTA 3NOVA 3KEFA 4ZWNA 1V6AA 3A1WA 5CEJA 3R9XB 1J97A 2B0CA 1E9CA 1AG9A 2HQ1A 1K27A 2VDQB 4R3NA 5CHYA 2PWBA 4GGOA 1XNJA 4L6AA 3I45A 3FXAA 2IUTA 2O6LA 3C7CB 3ZHBA 2YC4C 4F92B 3MTDA 4CM9D 1G0NA 1Z74A 3PEYA 1D09A 1UJ2A 4QFDA 4NF2A 1KFJB 1FP4B 2PX2A 4EVQA 4B7XA 3SC6A 2Y1DA 3GPIA 1SWWA 3QXHA 2UVPB 4ZCPA 3RTBA 1DV2A 2BH2A 1K8ZB 4FFOA 3A2MA 2GCGA 1AHNA 1Y4ZA 4NNOA 3MHPA 5HZHA 1IWPB 2JJ2D 3Q40A 4O4IF 3K1AB 1X9IA 4O5OA 4UHKA 1RW4A 4MRNA 4MS4A 1CW2B 3L92A 1FNBA 1KFBB 2BEWA 2DY1A 1UDXA 2JAQA 2PH1A 2YZKA 2VJQA 2HX1A 4NY1A 5EP3A 4HYQA 1I7PA 4P32A 4QXAA 2NUAB 3GMDA 5EUBA 5I7WA 3NORA 3HB0A 1A2KC 3HYNA 2VG8A 5EJIA 1Q83A 4G63A 3SXUA 2X9LA 4C3ZA 4UZEA 1QR6A 4P33A 1SR8A 4BIMA 2EW8A 3ND6A 4I55B 3EF3A 1DEXA 1SBNE 4DA6A 4GFDA 1BYUA 1WDTA 5C51B 2O2XA 4NCKA 5E9WA 3S2YA 1W85A 6LDHA 4RV9A 2C58A 4F86A 4FPXA 1HYHA 1FYEA 2PYZA 2Z09A 3KEMA 3AVQA 5GGYA 1LNZA 3ZTYA 3QA3E 3PGJA 3R9KA 4Y1GA 4X84A 1RE1A 2V0NA 1FFBA 2BEVB 1HOXA 3EIFA 3VYTB 4CEJA 3AHCA 4WE3A 1QCDA 1I9GA 2GPBA 4TV9A 3I9MA 4DCOA 2VDUE 1Q1ZA 3B1VA 3L7DA 1I3OA 3OP1A 4RK4A 2VDOB 4TVBA 1BFUA 1YSCA 1MIOA 4MUMA 1BCRB 4ZOLF 4D3YA 5GINE 1JA1A 3UGQA 3TLYA 2VL7A 3C6MA 3PDUA 4J2TA 5D7NA 3W1VA 5DNYB 4JMPA 4JC5A 5J2UA 4OBWA 1I1OA 2YBDA 3KZKA 4NFSA 2I7TA 4DW8A 4RTRA 3L7YA 3ZWPA 4IQFA 3K2BA 3I5UA 4WVFA 2AG0A 4H7PA 2PUJA 4IRMA 2IELA 2Z95A 3CF4A 1BOFA 3HUFA 1K1EA 3GROA 3VJRA 3CIFA 2H4JA 3Q7SA 4RTOA 1E2KA 2E4YA 1G9TA 5AP9A 5EZ6B 4M89A 2Z5VA 4BAUA 4QQRA 1NM5A 2ZTMA 4F4IA 4M8LA 5K8VA 2OUIA 3KM0A 3D6AA 4GSYA 4URUR 4G5GA 3LQKA 3GV0A 3RWBA 1ZIXA 1JTFA 4GHWA 3IERA 3WGVA 5KOYA 1I6KA 1ZDMA 1KIFA 3P4XA 1EIWA 3HA7A 4BMSA 2HEGA 2X0FA 4QVKA 2ADOA 3LDGA 4LTMA 1Z2NX 2B5VA 1CUVA 4QFMA 5I9NA 1QC5A 4YRSA 1JNYA 3KYCA 4NV3A 1JKXA 2GXAA 1XMSA 2CCJA 2GLTA 1V3UA 4I5DA 4X24A 2CNLA 5AK5A 5DBIA 3LQQA 2AFIE 2A5YB 2DPGA 4EVRA 4RVOA 2OHXA 3WKBA 2IF0A 1GQSA 2XTAA 2OHOA 4CIVA 2PFKA 1IMOA 2HEIA 1JE1A 2P9GA 2EKPA 1UBKS 1M8FA 1YZLA 2V7BA 3A70A 3NHAA 3KOMA 4QGGA 5F77A 4AX4A 2IS2A 5FUXA 4OREX 1EHCA 3AP2A 2VNHA 5IEBA 1D2AA 2WTAA 4I4NA 1BJRE 2KJQA 4O4LB 3MTBA 4EBFA 4ZYLA 1CDOA 4ZN6A 2BCEA 2XCRB 2VPYA 3WDSA 4YJDA 2AHOA 2AFRA 4YAKA 1DP4A 1U28C 2F3TA 3HYSA 2HJWA 1JEAA 5JC8A 2TMYA 1WDLA 3HL0A 3NP7A 3ROZA 2EG5A 3BRWA 5ALPA 3PB3A 1CDDA 4NS4A 3WLTA 1PGPA 5KJEA 3K73O 1E18A 4I50F 5ER9A 2Q7OE 1H1TA 2V03A 1NRJB 4JOBA 3VKUA 4A92A 5IJZA 4KQ2A 1GL3A 4ND8A 3GFFA 2QBYB 1H85A 3E0XA 4G6ZA 1ECJA 1LRLA 1ZA2A 1IUPA 1G21E 4D8XA 3G17A 3Q3CA 3TOSA 1K0FA 2VWPA 2P7HA 5D6NA 3E9DA 1E69A 3L01A 1OIVA 3V4SA 3GOHA 5DTJA 4U1RA 3FW1A 4F7WA 4ZARA 3RVOA 3FWZA 4RTSA 4NAVA 1CVIA 2A9QA 4LWOA 1VE6A 3O3OB 4YAIA 2X7HA 1KPHA 4GOOD 4Q4HB 4KQ1A 2NO7A 5BN1A 4CLXA 2FMKA 5KYNA 5BRAA 4N7JA 3HLYA 3Q0TA 3QLVC 4BQPA 4I1UA 3AVYA 3N74A 3PWZA 5JW6A 2HXGA 2EXXA 2XYRA 4U7PB 5FHQA 4QBTA 3TLKA 3BK7A 3EPKA 4HQRA 3JD3A 3KL2A 4KFRA 3EIHA 3ND9A 3OCWA 3Q11A 1J7KA 2W2OA 5T4BA 3SM9A 4QICA 4ZCRA 5CDTA 1AKRA 4PLHA 3F67A 5CB0A 3QVOA 3BXHA 3DPIA 2IYAA 4KXFB 5CFQA 1R4ZA 3M1AA 5F51A 3Q8MA 1E61A 1U8TA 2P90A 2AZ4A 1WDKA 3LXMA 3UUFA 4FVTA 1TAUA 2BY4A 3HMQA 1L5NA 3SMQA 3X1XA 1Q57A 4KFSA 4O0MA 3A0UA 5I8PA 4EJFA 3K05A 5LA6A 4PO8A 1JQBA 3D3QA 3H3XA 1HZJA 4BQFA 4C29A 3NB0A 5BR8B 3DOUA 1EVKA 2F43A 3PNSA 2NSLA 1O2DA 2BE9A 2P1ZA 4FEEA 4KL8S 4PG8A 1KOGA 3LPDA 3I6QA 2VJLA 4OB6A 1OY1A 1QFZA 4KMOA 1A5SB 1GGNA 4WNYA 4BAGA 1S3FA 4AYWA 1SC1A 1DIBA 4N0QA 3DAFA 5FJJA 3FX2A 2CKDA 1AURA 1K8RA 1RTKA 2G28A 4JY7A 3ZWKA 1J5PA 2JF0A 1OXKB 3DCIA 2B9EA 2H4FA 1OBOA 2B7CA 4NMMA 1WRBA 1QB7A 1UAYA 4N3GA 3BQMB 5EESA 1VE7A 3P2IA 5GV8A 2WB4A 1DTWA 1N2XA 4ERNA 3AM1A 4CBVA 2CBXA 1J2YA 1EGVB 4PQRA 5LZ4A 3GO4A 1IN8A 3MINB 3IX7A 2GBPA 2FPUA 3QJGA 4DF3A 4ZJZA 1W96A 4ZZIA 5BR1A 1Z15A 1K88A 2ZRJA 3D7RA 3JQDA 2NU8A 4PTLA 4IIJA 3GFQA 3QEMA 3MBKA 3O21A 4GO1A 2DJIA 1MC4A 3T06B 1MDFA 5BORA 2FFQA 2F9FA 1S3IA 1D6MA 3OLWA 1LEHA 3DEZA 4P4GA 3VXKA 2JI8A 1UUFA 1SVWA 4UE6A 1GHTA 1HDOA 1N25A 3FJYA 4EA8A 5BOSB 1GQOA 4QYWA 1YS7A 4RY2A 2H92A 3PI7A 3RIHA 4CMGA 4DJFC 5BV2P 1FFEA 1OI2A 2G0TA 4LGVA 3OEYA 4O2BA 3K32A 4ZAFA 5C46F 1PJ8A 1B1CA 2RBKA 3BUSA 3ND7A 3HCDA 4A7PA 1CJUC 1E58A 2OV2A 5LFAA 4UPEA 3K7EA 1YB6A 4Q1VA 1ZD8A 4D9KA 2XUAA 5E4TA 1Y5NA 1GNQA 3KU4A 4M8IA 1JJFA 4H6PA 3R74A 3FYHA 4UREA 3FOCA 3QBDA 2YRFA 1ODJA 4NJMA 2R96A 3DVQX 3K72B 3KBBA 5BT9A 4CF6A 3R5TA 3T4EA 4X93A 4LZZA 1WW2A 4C4XA 4ARBA 1CD5A 3A9UA 1Z5PA 3L0YA 2ZRCA 3BDAA 2FUG1 1EG2A 221PA 4K6GA 4UNQA 3C3DA 5CRIA 4MRPA 1R4MB 2K6GA 1C1DA 4WEOA 1T9HA 1ZGCA 3RC7A 2XA9A 4K9PA 4Q3AA 1OXTA 1JI0A 3IAEA 1CIJA 1SBIA 5EPOA 4JI5B 4FOLA 2UUPA 1U9YA 1K8XB 4M38A 1T43A 4GECA 4GXNA 4MB0A 1WSBA 1HDYA 5AHXA 4K88A 4ZJPA 1JEYB 1XNGA 2A6PA 2X7XA 3DXYA 4OJTA 3J7AC 1XCGB 3WGQA 3R0QA 1VKZA 3IDFA 2VPQA 3T61A 2MR5A 3BGIA 4X63A 3IKTA 5F3WB 2FZGA 3G2KA 2VZ9A 3URKA 3WLLA 4NZPA 4AZTA 4JD5A 4U2GA 1CUZA 2WF7A 2Q6TA 2QZPA 4LCBA 3IUYA 4QTUB 1K7SN 3T7KA 1YTUA 3AGPA 5LA6F 2MSWA 1XRNA 3TNLA 4EX6A 4ZYWA 3KQSA 3P9PA 2LDBA 3QV2A 4HDOB 2HGSA 4OK3A 1PHPA 3GP5A 1YT5A 4DA4A 3BRWD 2KS6A 4GD3Q 4I81A 4V0NA 4EARA 4HFJA 4PFSA 1EUDA 1A8PA 4ZQBA 2IYEA 3FDFA 1DZIA 2H08A 3B2NA 2VDWA 3FCXA 3Q3GE 5EIWA 6PFKA 3BD8A 4FGLA 1EFPA 4JR1A 1WOYA 3HZRA 1SO8A 1OXMA 3EA4A 2XE7A 4P35A 4COKA 1S2DA 3ITKA 1EE2A 1EIZA 3IIKA 4GZMA 4ZHQA 2FAXA 1W52X 2BM0A 4R5HA 2GWRA 3VMMA 5FLXA 3A1UA 5TV2A 1KAMA 2ZPAA 3KZ1E 2PV7A 3L05A 3K4QA 4JLMA 3S4YA 3GIDA 5DHTA 3ZU5A 2IQIA 2JH9A 1XE3A 2VRWA 1H0KA 5BWBA 5ALQA 3DEKA 3HK2A 1LV8A 1Z5NA 1NVDA 3KJGA 2PMEA 4KAJA 4EGAA 5J4KA 2HA7A 2I99A 4QYIA 1GPDG 2XSZA 3EIWA 1MXHA 3KKZA 1UH5A 1VMKA 4WN3A 4YMIA 2LCQA 2Q7XA 2P35A 3LS2A 4IFIA 3ZZUA 2FSGA 3GK3A 4IEIA 2CGEA 3D3JA 1H3NA 1MOSA 3G8CA 1FLNA 3JQ8A 3JQAB 4K9SA 4W63A 5D7BA 3UKJA 1Q1QA 2MINA 1EA7A 4A8HA 1S8NA 3DT6A 4MDFA 1J56A 4F2PA 1PJ2A 2MSLA 3BBLA 2G17A 2XNHA 3HA3A 1FUIA 1EDOA 2XMQA 3S1AA 5ADUS 4JQCA 1KEZA 1GTMA 1YBAA 1ZC3A 3GDWA 2B1JA 1E3MA 4URVR 3PGXA 2X23A 3UFBA 4MRVA 3GGDA 3C74A 1AUXA 3NTQA 4QJBA 3IDOA 1LS6A 2AEEA 3AC0A 3TNDA 4E70A 3E7WA 1AKMA 5FPKA 1I3KA 2J9FB 3DCNA 2R6HA 2YWFA 1MJGM 1GL7A 3CYFA 4EYEA 2C9DA 2BGJA 2Z2KA 521PA 3X2FA 1J8VA 1BMTA 2BHSA 5E2BA 4XVUA 4AKHA 1DC5A 1ZQ9A 5CB6A 3D1LA 2BFCA 1FS4A 1FRQA 1GPKA 1XWWA 3PNPA 1VXRA 4HSGA 5G1NA 3L1JA 3S1LA 3W6PA 3BTOA 3ID6C 2G1KA 2ERCA 2ZTLA 1BFKA 2VRCD 2SKCA 4K26A 4OJMX 4P7KA 3WTBA 4DV5B 4UBOA 5DMHA 2Z4RA 4DLRA 1PR2A 2JIRA 3O4RA 3TMAA 2D1RA 3OT1B 2FGJA 4TWIA 3MGAA 3VJMA 4E14A 5AVZA 1WHTB 2P69A 3N59A 1BHJA 4KN8A 2R5WA 2CXSA 4XUCA 4CW7A 2J0SA 3S2ZA 3RR2A 2WAOA 1SKYB 4GXQA 1YULA 4J0IA 1ADYA 4JP3A 4AS2A 3AXSA 4YP7A 4BTVA 4M0EA 1D4OA 5FRDA 3ZHCA 5I4BA 4H9GA 4L73A 3IP6A 3IOMA 5B1DA 5DWVA 3ZHYA 2Q3CA 4LPSA 2C1XA 4OMUA 3I73A 3VU3A 2W2QA 4IV5A 1N0UA 4RF3A 1JAYA 3N3BC 4E1AA 4F0JA 4BNMA 1XAHA 2VWHA 3ANXA 1PZFA 3TZEA 4UDOA 2JFUA 2XB4A 2ATIA 3CLRD 3PNYA 3T0GA 2Q2QA 2VO1A 1KDOA 1MX5A 1ICEA 1NXQA 1O6GA 1A8UA 5CEFA 2DLNA 3QKRA 3V4ZA 4A8TA 5KVQA 5ARBA 3EFOA 1NQUA 5IYZA 2R11A 3SIWA 2IPXA 2GILA 1RZUA 1M2VB 3FJOA 4HNAA 4IDAA 4QQKA 3JQ9A 1YCHA 2CJFA 4B6GA 1RQNA 2VDLB 2CNKA 2NMVA 3LC1O 1PAUA 5H02A 2XE4A 4TTTS 4C4OA 5BW4A 1K98A 2G08A 4ZV4A 3IP1A 1FNSA 4UNNA 1BH2A 3VZCA 1NA5A 1KI9A 1H3EA 2B20A 2B82A 3ENQA 1YF3A 9MHTA 4D3FA 1CJBA 4WKGA 3VR6A 4K2AA 3NVMB 2I1QA 4X6LA 2YWDA 4G2NA 3N39C 3JARA 5CVTA 4ITRC 1G63A 2P6PA 3AOGA 2A2ZA 3IGFA 1Y6GA 1Y4DE 2VXCA 1VMDA 2CJYA 2XGGA 4HVTA 5AMXA 1OTYA 1YDHA 4LHSA 4WY5A 4DV1B 1SZPA 2D54A 3C5VA 2I3BA 3PNQA 4CM4A 3ORHA 5DWQA 5G53C 2Q5OA 1V95A 5BSTA 1FNMA 2JGIA 1GFSA 3DOCA 3PA6A 4XQ9A 5KOHB 1X9GA 1EA5A 4G1UC 1U8AA 5JNWA 2JA2A 2GD0A 4DIEA 3HKBA 3SSNA 3LY9A 4UMDA 4C88A 1AB6A 3C7DB 4KQ9A 4NPCA 1TVKB 4I66A 1RQRA 2D06A 2ADFA 3JRWA 1IN6A 1QPBA 1QFYA 1U7ZA 4AJHA 3V6MA 3I9KA 1JQJC 4C4PA 3P32A 1EZ4A 2EJVA 4QARA 3RG8A 1V1JA 5C7OO 2NX2A 3R9IA 3HO6A 3HCNA 2AJBA 2C2WA 4UDXX 4UOQA 3DOHA 3R3HA 4BLUA 5CT5A 1MAHA 4C05A 4E09A 3E18A 3PNLA 2FW1A 3EQ6A 3IA7A 2X9QA 3KFVA 3LE8A 1TL7C 3VI4B 3T3EA 3WYAA 2ZWOA 4U2EA 5CVVA 5IUJC 3WGKA 1M1YE 5J5AA 4TYYA 3D2AA 3F78A 3SY8A 2BM1A 3T5GA 2OVFA 4DJTA 4DWOA 1B6TA 4Z9XA 4DLLA 3IDSA 4NAUA 1NBEA 2GPNA 4YRBA 3JQEA 2D7JA 821PA 4KZKA 4R8SA 4CCSA 1M8PA 2OAP1 4HNVA 1C2TA 1V71A 5K0GA 3V1KA 3SWWA 3O94A 3JQGA 1GTL1 4QPZA 4Y1FA 1RRVA 4DABA 5BRJA 5CBPB 2P68A 1G4HA 2R8OA 2GBCA 4M88A 2OPBA 2Q4RA 2NXNA 1WB5A 5EJ2A 4JHXA 3EVZA 3R7NA 3T95A 4OHWA 1QXSA 4QREA 4ER5A 5ALTA 1UAGA 1PV1A 3GGJA 3GGGA 4JJ6A 4DOMA 1Z3IX 4XDGA 3SKYA 4F4JA 4N41A 2AWOA 4RH3A 5HRAA 4FFRA 3MQFA 5F73A 2PRSA 2FZCA 3GY0A 1M1YB 5CVEA 9ABPA 2PS3A 3H8WA 4UM9B 4JI1B 1NMZA 1U4SA 2CB0A 1R6AA 4N7MA 5CYOA 5CLLA 5T8KC 1X39A 2D8MA 5A9SB 1FDSA 4MULA 5KWEA 1M10A 5IZCA 3KB6A 2Q2NA 3T9DA 3G49A 2X14A 2NZWA 2WA1A 4XWWA 4LF4B 5JNSA 1VMIA 3AVXA 1OBCA 5DTIA 5FA5A 2HXYA 1GA6A 2BMFA 1T6NA 2QTCA 3AHHA 5EMLA 5MN5A 2O23A 1OWMA 2L82A 1ISRA 1AGRA 3C8UA 3IR6A 4I1IA 2QX6A 1VL5A 3BB4A 1Z9BA 2XD9A 3YASA 1DSSG 3AJRA 3UC9A 1FXSA 3H2GA 3KLNA 1JIQA 4D6XA 5BPHA 1I7DA 1O94C 4BVLA 1PJTA 2H2IA 1DFIA 1E6MA 3WKDA 3J81A 2YXPX 4U6SA 1FJGB 3H6HA 1N2IA 4J6FA 1KVRA 1NXOA 3EVNA 3A4MA 1QZ3A 4D25A 4YMHA 1M66A 3HNOA 4KPUA 3EGXA 1OUMA 3KKEA 5AK6A 1KEWA 2GPAA 5TPZA 8LDHA 4CKCB 4RZQA 1H2EA 1KK0A 1YI1A 2VAPA 2N9UA 1X1DA 2WZDA 4K6KA 4LHWA 1H9AA 3ORSA 1L7RA 2O8DB 1PDOA 1L7MA 4RZIA 2PKYX 3WAJA 4EB8A 3N2KB 3EWIA 2A9OA 2XT0A 3OCJA 1AHPA 4C14A 3KSZO 3Q7TA 1EFVA 2VPTA 1SXQA 1XA3A 1YRLA 1CXZA 1TU0A 2GBFA 4Q00A 3EG9A 1OLSB 1RPJA 2ZRQA 3C3XA 3L0OA 2R751 2RAUA 2BBWA 1RXEA 3IB6A 3KQYA 3AY6A 3HG7A 3EIXA 4AICA 3Q8LA 1S9DA 2P4SA 4GMDA 1B4DA 4POOA 1XPJA 3KDSE 3IA2A 1T6ZA 2O14A 5JNLA 2EWVA 1IXYA 3HJFA 2UUAB 2H07A 4B82A 3PQDA 3QTLA 1HDIA 3TH5A 1JIIA 3REGA 3NHLA 2K7FA 3EVBA 2F2TA 4EPYA 3WBJA 1X14A 2X4LA 2ZBQA 4RSMA 4ZALA 4EW2A 4XJXA 2ZTVA 3BRQA 3U3JA 1FVFA 1XF9A 3I3SR 3C24A 4RHXA 5TNXA 4B43A 3IJRA 1TK3A 1JFRA 4FB5A 4OIMA 4RA9A 5FXMA 1EFTA 2Q5LA 1E4EB 3PJEA 4LY3A 4RD0A 5KSOA 4DEYA 2V7TA 1KQNA 1KWKA 3LL7A 1YONA 2LTAA 2HWUA 3E70C 3IXQA 4IHQA 5BQ5A 4EP1A 1ISFA 5EYPB 5C4GB 1JDSA 2MSKA 5TX7A 2AFHE 1CQJA 3RREA 1H6CA 3K5PA 2FWRA 3AIOA 1SVIA 2C57A 2GO7A 3MJ4A 2RI1A 4PZCA 4AJNA 4YMVA 4ARCA 4HAZA 1PTKA 4OA5A 3AETA 4CM4B 1ZNZA 4Z8XA 4EL5A 3WK5A 3ZJ5A 1V39A 4IYJA 1JIKA 5KQGA 5G02A 4F71A 1ULHA 2AUTA 4HVAA 5AM0A 3OQIB 1BDBA 3LCUA 4UTXA 1Z08A 4YONB 1UM8A 3B5EA 2XUQA 2JNWA 2MWMA 2ZUBA 1GRRA 3MCVA 2QX7A 3FTEA 5EIBD 3DVRX 1T1IA 5F2OA 4B8ZA 3VNBA 1SBCA 5E0OA 3K0AB 1F0PA 4AJ4A 5LP6F 4C6TB 1CR2A 1GR1A 2YHIA 4OOFA 2YWRA 2X0EA 4E5DA 4G01B 3A9TA 1P8JA 2A3RA 3NH6A 1HPLA 5IM4A 1SURA 4NQRA 1T29A 4ZQGA 1JKIA 4LTNA 4L8GA 1U5CA 3ILHA 1LB1B 1NR1A 1XZQA 4X7PA 2QUKA 1Z17A 4TQGA 2BV3A 1F38A 2NUPA 3LLUA 3WLOA 4CMKA 4D9EA 1IOVA 1SEVA 3BFXA 1BDJA 1RWQA 3H4VA 3F4BA 4QM6A 2AE1A 4U5XA 5DGHA 5FT9A 1FDOA 1E2FA 3JYQA 3KHKA 4CM8B 1EH5A 2VHZA 4DCGA 2IA5A 2Q5CA 2BBOA 1GZDA 2PU5A 1IUOA 1Q3TA 4W99A 2W48A 5KTMA 4G85A 2NM0A 1E1LA 3VGPA 1ZWKA 4GUAA 2RDMA 1YVUA 3JD4A 3L7CA 4OQNA 4WGFA 4L6IA 4EMTA 2QMYA 2JD0A 2W58A 1DAEA 3IUEA 3MIIA 4CRWB 4MEBA 4L02A 4FE4A 1SUAA 4M1WA 3CNLA 3DMFA 3LGXA 1TVCA 4CR6A 4EDHA 1W2WB 4JI4B 4UAGA 4YLGA 3NHBA 4TVSA 3B85A 5K0LA 1ZR4A 4U0JA 1N7JA 1V47A 4O1MA 3E27A 4C89A 1EWQA 1W47A 5DBOA 1RPNA 3GHHA 3IBSA 4X95A 3WDMA 1S2IA 5JASA 1BOOA 4EVSA 2AHRA 2WC1A 4BU1A 4QG3A 2AK2A 4EHKA 2DJ5A 5C8ZA 1GVNB 2RG1A 2ASVA 1JT2A 3DFMA 1KU0A 5B2FA 4FNMA 3ESAA 3QITA 1Y8RB 1BS9A 1ZD3A 3PFCA 4QGBA 1YL6A 4QPJC 4DBZA 7MHTA 3QLUC 3IVAA 1IHYA 4A2CA 8ABPA 3T3OA 4LDJA 3V9AA 2E7ZA 2OQ2A 2PM8A 3CZAA 3OICA 1B0UA 4HAVA 1IY9A 2DM6A 3LM8A 1A7JA 4UEOA 5EKXA 1X1BA 1YFZA 1YZVA 4NYIR 2O3QA 2AFHA 1ZD4A 1PR5A 1SG0A 3MS4A 1Z8HA 1GJRA 1P7ZA 3PC8A 3VU9A 3S2GA 1NX6A 3AESA 3HBJA 2OP1A 3L0IB 4QNNA 3FYUB 4DR4B 3OZWA 3AWDA 2RKOA 5IXYA 4JOCA 3AZQA 5JUWA 2DH5A 4HP8A 4NATA 3RASA 4LGYA 4ARUA 4KXUA 1HEIA 4FR5A 3JQAA 3VC2A 4B6RA 3EPJA 4YCLA 1SBTA 2BD0A 2R79A 4MTLA 4OFBA 5HQ3B 2DTEA 1YACA 3ZXUB 4R2IA 4GX2A 1W36B 3WWZA 5EAIA 1A9QA 4JLDA 3F4LA 5C8YA 1MDBA 1TT5B 4KIFA 1SPXA 3SX0A 1MGOA 2JI4A 2R66A 1Y6RA 1X70A 3I32A 4F1KA 1Y5IA 4PGMA 1YE3A 1KI6A 3G8BA 3UBMA 3BMQB 4S1WA 2B2CA 2ZQ5A 1JLKA 2AFVA 4W8HA 3KSUA 4FMDF 3KTOA 3DHYA 1CB7A 2I22A 2Y2UA 2XY4A 2Y76A 4JLUA 1RLJA 1R4NB 1ZX1A 3C5CA 5JQGB 1YCDA 2OTCA 3QE0A 1ESDA 1KARA 1U7HA 3ZJYA 1ABEA 2DBQA 3AHDA 4EGSA 2G9VA 2PZLA 3AOEC 2P2YA 3WGNA 4BVGA 5JXWA 4MICA 2ZI3A 5A04A 1NUPA 2PUHA 2ZRLA 5JECA 4ZU1X 2J3MA 4F9TA 3M82A 4WZAB 2CHFA 2M32A 5K9ZA 2F1OA 4ZT4A 1A04A 3MWDA 2X19A 3N7UA 1FYWA 3PR3A 4M2LA 4BECA 3AFNA 5TS3A 1LSOA 1CY6A 3R09A 1J09A 1HE4A 4HI0E 4ZC8A 2QT0A 3COYA 4PGFA 1COWA 3IVXA 3NUGA 4LVCA 2G71A 2XCIA 3MWGA 4QEDA 4V0KA 2PSJA 1NVUQ 3FPHA 4KACA 1JA0A 1RLIA 3MJFA 3R44A 4C0QC 2QTGA 1EWTA 3CKMA 3VPFA 1BEUB 2CXHA 2NU8B 2GPWA 1E8NA 3L4BC 5REQA 3ZDEA 3M70A 4ALJA 3D31A 4Y1RB 3VJLA 4MVWA 3GLUA 1Z75A 1CE8B 4E4YA 4K28A 4NBSA 3GWGA 4OHFA 4YGXB 4LBZA 1V16A 1Y82A 2C92A 2PD4A 4Q6BA 4LDAA 2FMHA 7ABPA 2MYTA 3PPIA 5B7GA 4A8JA 1GZVA 5T8KA 1D6JA 4HWOA 3GEDA 1PGOA 1OWPA 2JAWA 3KUDA 4GC9A 4DHWA 2OOKA 4KWEA 3KYDB 4Q5IA 1UAAA 3HCPA 3JZIA 3H9GA 1DWQA 1K6JA 1M7BA 1YBMA 2P11A 2IOFK 2QWXA 2CDRA 2A5FA 1WMBA 4JB0A 4RD4A 4RS3A 4W5OA 2A30A 1JTVA 1YFKA 1K9VF 1LK0A 3AQ4A 3ICVA 3DZGA 2H4ZA 2UZ3A 3FUTA 3PS9A 4JQYA 2PH5A 4L4ZA 4I9FA 4Y3UA 3WBFA 4LOIA 4CV2A 4E7PA 1X87A 1D2MA 4H1UA 4Z7JA 1R8SA 4HQKA 3RHTA 4IDOA 1HE1C 1MAVA 1RI3A 3WYCA