2FJ0A

Crystal structure of juvenile hormone esterase from manduca sexta, with otfp covalently attached
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
538
structure length
530
Chain Sequence
EEVVVRTESGWIRGLKRRAEGNKSYASFRGVPYAKQPLGELRFKELQPLEPWQDELDATQEGPVCQQTDVLYGRIMRPRGMSEACIHANIHVPYYALPRDGLPVLVFIHGGGFAFGSGDSDLHGPEYLVSKDVIVITFNYRLNVYGFLSLNSTSVPGNAGLRDMVTLLKWVQRNAHFFGGRPDDVTLMGQSAGAAATHILSLSKAADGLFRRAILMSGTSSSAFFTTNPVFAQYINKLFVTNIGITATDPEEIHQKLIEMPAEKLNEANRFLLEQFGLTTFFPVVESPINGVTTILDGDPEQLIAKGRGKHIPLIIGFTDAECEIFRRQFEQIDIVSKIKENPGILVPLSVLFSSAPDTVAEITKAMHEKYFKKSVDMEGYIELCTDSYFMYPAISLAIKRARSNGAPVYLYQFSFDGDYSVFREVNHLNFEGAGHIEDLTYVFRTNSMLGGHASFPPHDKDDHMKYWMTSFITNFMKYSNPVTDAKLWPEVRADNLRYQDIDTPDVYQNVKPHSEQRDMLDFFDSIYNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of a potent insect maturation inhibitor bound to the juvenile hormone esterase of Manduca sexta.
pubmed doi rcsb
source organism Manduca sexta
molecule tags Hydrolase
molecule keywords Carboxylic ester hydrolase
total genus 171
structure length 530
sequence length 538
ec nomenclature ec 3.1.1.-:
pdb deposition date 2005-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fj0A01
4UFNA 4KRYA 2QJRA 5JD5A 1R9MA 3BF8A 5KREA 5DTJA 5ALTA 3TJMA 2AXEA 1YR2A 4MEBA 5C8XA 4UHEA 1VXOA 3F96A 5AI0A 1IMJA 2GZRA 3K9BA 2PX6A 4QWWA 2WG1A 5A7HA 3FBWA 4EZIA 3N0TA 5ISMA 4LYEA 1MX9A 3C5WP 5ALPA 2JBWA 2XUDA 2PBLA 3DS8A 4DGQA 2O2GA 3O0DA 4TVKA 3WMRA 1VE6A 2WLSA 2HL6A 4M0EA 4X85A 5CTAA 2VJAA 5FV4A 5AI4A 3A6ZA 5AKIA 1VOTA 2QZPA 4UBMA 3KWFA 4BYMA 6YASA 2ACKA 2YASA 3DDUA 2XQKA 2HM7A 1TCBA 4ZGBA 4QZVA 2GBCA 1CUGA 4UFPA 4QLAA 3FLBA 1CUZA 3QMMA 3C43A 1CUCA 3I6MA 4D9JA 1P0PA 4FTWA 4G4GA 3OG9A 1UFOA 2XT0A 4UHBA 1EB8A 2CKMA 2CMFA 3D59A 2NW6A 2VJBA 5HK8A 4FNMA 4X6UA 5JASA 1P0MA 2VTVA 5EHZA 1XZKA 4C01A 1ODSA 1KU0A 5K5EA 2WIJA 3R3ZA 4O08A 1L7RA 4KAAA 1CLEA 3HC7A 1EB9A 2WJ3A 3G0GA 3WA6A 1E3QA 3H2KA 2QXUA 2RI6A 1EHYA 1UZAA 1EK2A 3QMWA 2JGFA 4NMWA 2WHPA 1AZWA 2VSQA 2BUCA 4I3FA 3I1YA 3S8YA 1ORVA 4CCYB 3E3AA 2QS9A 2Q0XA 3W06A 4GW3A 1R50A 5EIAA 1DT3A 5AOBA 3VDXA 1K6EA 5AM4A 1XZMA 5A62A 3NOXA 2PSDA 4QDUA 7YASA 4C89A 4H7EA 1TQHA 3IUJA 3H04A 1XRRA 3G8YA 1KU6A 3G0CA 1JJFA 1GXSA 1CUEA 4EBBA 1ZIYA 2J3DA 4U2FA 5DTIA 4AZ3A 1QTIA 3G9ZA 2XMQA 1I6WA 3IUMA 3WI7A 2C5FA 4P92A 1SCIA 5DYTA 5HQ3A 3WYNA 2BJHA 2WU4A 5ALMA 5JAHA 3RKSA 1BRTA 1SOMA 1Q0RA 3V48A 2XMRA 3DOHA 1RYYA 1W52X 3OM8A 4XWGA 4UHFA 4FKBA 3W2TA 3LP5A 3QITA 4B0PA 2H7CA 4K6HA 4AMZA 3KXPA 4G8BA 5C8VA 2ZSHA 3QPDA 5DNVA 4CI9A 4M0MA 2RHTA 5A71A 1DX6A 2XQGA 2Z3WA 4LXHA 5BWCA 1CUJA 3P2MA 1Y7HA 1EVEA 2WHQA 5LZ8A 2JEYA 1BCSA 1O6GA 1BEZA 3AFIA 4P9NA 4UHHA 4YASA 2HA3A 4G8CA 5HF8A 5ALNA 1LPBB 2V98A 3E0XA 2QR5A 3DOIA 2DHCA 5T4EA 1SC9A 4WY8A 2ES4A 2QTBA 1NX9A 4KACA 1VZ3A 3M83A 1QLWA 5LIPA 4BZWA 1GQSA 4LYDA 2C0PA 3B12A 5FKJA 3OOSA 4CIAA 4N5HX 1G4HA 4LXIA 2LIPA 2VJDA 3QBJA 4QEKA 4BCBA 4BCDA 2QKYA 5T4HA 4C4ZA 1VXRA 5T4BA 4WY5A 4BBZA 2PVSA 4DYHA 3I1IA 5E4TA 3CN9A 2I3DA 3BJMA 4DMCA 1OCEA 3BL8A 3HJUA 4QDZA 1XQXA 4G1FA 4M0FA 4N8EA 1JJIA 5CXXA 2RGUA 1MNAA 3G9XA 4WFKA 1VLQA 4TGLA 3WK6A 5DYWA 3R3XA 1UK7A 2J4CA 1U8EA 4CG2A 4KE7A 5AKXA 3JW8A 4KE9A 3STTA 3HZOA 1SCKA 3VVMA 1TKRA 2VAVA 1IZ7A 1X70A 4CFSA 2PUJA 5A6VA 1IUNA 2HHAA 2E3JA 5CW2A 1XQVA 5K3DA 4B9EA 1THGA 5AICA 1BCRA 1UXOA 2HU5A 1CUDA 5AP9A 2PSFA 3WKBA 4NS4A 4OCZA 1XZHA 3HRHA 5BV7A 1TCCA 3IULA 4J7AA 1W1IA 3N2ZB 2HADA 1KEZA 1Q83A 2DFPA 5AO9A 3D4LA 3F97A 1DU4A 1ISPA 3C6XA 4Y2YA 4NZZA 3KWJA 2FJ0A 3D7RA 1DQZA 4CCYA 1PV1A 3DYVA 1PFQA 2GBFA 4XVCA 2BUAA 4EB0A 2EDCA 4BP8A 2YXPX 3R40A 3MGAA 1BN7A 2WHPB 4HTAA 1DX4A 1VZ2A 2Y2UA 4Q3LA 3E1GA 1QGED 3FWHA 4ETWA 3ZLUA 3H2GA 3CCCA 2DSNA 4ZREA 1N5RA 3WLAA 1YA4A 3WA7A 3E4DA 1A7UA 5C8ZA 3FSGD 2OGSA 5AOCA 1LPAB 3LCRA 1U65A 2ZJ6A 1G5FA 3FOBA 5AKEA 5AHXA 4DSZA 1AKNA 1CVLA 3AIMA 1QIFA 2WJ6A 1LBSA 1CUXA 4WDQA 1JKMA 2X76A 2BFNA 1AUOA 4YPVA 4IH9A 3IBTA 4C4YA 3DEAA 4TPKA 5DWDA 2WUDA 4PV7A 3C6YA 3FYTA 5AM3A 3HI4A 1ACJA 5CMLA 1LPMA 4PQEA 2YYSA 4B7ZA 1WB5A 3DKKA 3DJYA 1XLVA 1YB7A 3C6BA 1W4LA 4Y7DA 3S2ZA 3I2JA 3WK4A 4H18A 4A5SA 3D5EA 3C6ZA 4BC1A 1HL7A 3D0KA 1XRQA 5K3BA 4S0XA 1T2NA 5AK6A 1VA4A 2AJDA 2PSHA 4ARAA 2WM2A 4GXNA 1DWOA 1XLUA 3WWPA 3K2IA 5HK9A 1QIJA 3R3VA 4Q05A 5LLSA 2QM0A 1UOQA 3ANTA 3R3UA 5DNWA 4EY4A 4L72A 3WWOA 3I2HA 5SYNA 4RE5A 2WG0A 4G8DA 1B41A 3FYUC 4YX9A 4J3JA 4BE4A 3QYJA 1J2EA 2QUBA 2C58A 1RWQA 4AN0A 1RP1A 3DD5A 1GPKA 3SK0A 1P0IA 2XUHA 1GGVA 2ZJFA 4BP9A 1S8OA 3RM3A 5JZSA 4QA9A 1TRHA 1FFEA 3WWEA 5FXMA 2R11A 2XLBA 2B61A 1CQWA 2Z3ZA 2XUAA 4PNZA 4UBLA 1G66A 4H35A 1MTZA 2WUGA 1VKHA 2XMZA 4BRSA 4F21A 3O4IA 1DWPA 2K2QB 2OXEA 3KSRA 3K6KA 4X91A 1QJ4A 1UT6A 4KR0A 1UOOA 3UUEA 4QDXA 1E8MA 1WOMA 1A8QA 1L7AA 4W1RA 4FHZA 1F6WA 4Y2JA 2RIPA 1MAHA 1LZLA 2FJPA 2WTNA 2HRQA 5CURA 4B0OA 5FUMA 5CH8A 4AO6A 3F67A 3U1TA 4AO7A 3CXUA 3SX4A 3GBSA 3BIWA 1MJ5A 1BS9A 3ZLTA 4PF1A 5IH7A 4RE6A 4ZV9A 3HXKA 3TRDA 3HEAA 5D6OA 1XKLA 3VJKA 1JMKC 3G0DA 3RK4A 4DNQA 5AKZA 4W1SA 3QPCA 2D0DA 5CXUA 1UOPA 1ACLA 2ZYIA 5AM5A 2G4LA 1CUBA 3BF7A 2VA9A 2QJWA 5LZ5A 5JZ9A 4H7HA 2ZYHA 3D2AA 2HFJA 1UKCA 2Y6UA 3WL5A 4MEAA 3OPMA 1N1MA 4BZZA 3BWXA 5IVIA 5LKAA 3ESDA 3R3YA 4E14A 4J0KA 5JARA 2PKYX 4AB1A 4X71A 5JANA 4ARBA 4EY5A 1HBJA 2RAUA 1CUIA 4XX1A 3I2IA 4Y2RA 5IVHA 1XRPA 1XZGA 4H7IA 2V96A 2B20A 4FBMA 1MAAA 1R88A 3VJLA 3ZLVA 2J3QA 1CIJA 2GYWA 4IQ4A 1JU3A 2CBGA 1W75A 4HRXA 2V9ZA 4YK7A 1QO7A 3L1HA 4G4JA 4CG1A 3WL8A 3IUNA 1UWCA 4FLEA 4X3CA 3SWWA 2AJLI 4J0GA 4K6GA 4MJ3A 4QLOA 3CCBA 2XUJA 2EEPA 2WHRA 3WJ1A 3WWCA 4N5IX 4E11A 2O7RA 4BAGA 5K3FA 2PM8A 4EA6A 1H23A 3FVTA 4RNCA 5A7GA 5E4YA 5FLKA 4B81A 1FFAA 1H22A 3G0IA 3H19A 2JIDA 2I3ZA 1DWQA 1EH5A 1DINA 2UZ0A 4HXGA 4EY6A 5IVKA 3PDCA 4KE6A 4E15A 4I4CA 1IUOA 5ALZA 2PPLA 4AO8A 4MQLA 5HF9A 1VJ5A 3H2JA 1OXMA 4DMKA 1ZD2P 2OAEA 1NU6A 3I6YA 2HA7A 2BUBA 1HLGA 5HF5A 2XQIA 4PO3X 2OCKA 1H2XA 3D2BA 2XMDA 3MUOA 3WL7A 2B9VA 3G7NA 3EBLA 3SC2A 1YAHA 4QDOA 4H77A 1XLWA 1Z68A 1LPNA 4J0CA 2HA0A 3FAKA 1XZJA 4GHWA 1F0PA 1QO9A 5BWBA 4QE3A 3BJRA 1E8DA 4B85A 1PJAA 4B9AA 3WKCA 5ALJA 1ZICA 4C88A 4Z49A 1J1IA 4L0CA 4MYDA 3T4UA 2WG2A 3EQ7A 4AQDA 3IIIA 3RARA 4WFIA 3W9UA 4K5QA 4JEIA 2VAXA 4F0JA 1GKLA 5JYCA 2HFKA 3ESCA 3GELA 2YH2A 4X93A 5D3ZA 3GROA 2CUTA 5AOAA 1ZI8A 1R1DA 1YSCA 4OB6A 1CUSA 3ZV7A 3C8DA 4Q1VA 1HKHA 4E46A 1FFBA 2WFZA 2C4HA 3KOOA 1CEXA 1ZD5A 3M82A 3FVRA 2C7BA 2DCMA 2QRUA 1K63A 2H7YA 4JNCA 4HXFB 5AKKA 1ZJ4A 5AM2A 4I19A 2VT6A 5HFNA 1JI3A 1QIGA 4WJLA 1EDEA 3O4GA 2OLEA 3C45A 1CV2A 3H1AA 4Y2QA 1XZAA 4B82A 4OUKX 2VF2A 5CRIA 5AIBA 2OGTA 4FDMA 2ROQA 4FFVA 5ALVA 1FFDA 5ALFA 4U2EA 1LLFA 4ZXFA 1CPYA 2ZVDA 5ALHA 4KE8A 1WPRA 3EIOA 4EY8A 5HZGA 1FSSA 3R0VA 1B6GA 1M33A 5JATA 2WIFA 5ALGA 2QT9A 5E4JA 4X6YA 5ALUA 1AGYA 1G42A 4DTCA 3AJAA 5F4ZA 1THTA 1GQRA 4H7JA 2XLCA 5CT9A 1YAJA 4PSUA 1ZD3A 5LZ7A 4RGYA 5ALRA 5IKXA 1YCDA 2XUGA 4AN1A 1TCAA 2BCEA 4GI1A 3AUKA 1ODTC 5LZ9A 1C4XA 1EVQA 1ZOIA 3YASA 4P08A 1QFMA 2BKLA 3VJMA 2H9YA 4U2GA 4DMFA 4KYVA 3ICVA 3WZMA 2IITA 5ALOA 4B83A 4H7FA 4X6XA 3OURA 2XI4A 5AI6A 2J4FA 4Y2UA 3HYSA 2OQIA 1BEEA 2XMBA 4DSAA 1N5MA 2QVBA 4FMPA 3WKAA 1TAHA 1C7JA 3I6ZA 3STVA 3WIBA 3PF8A 2AJ8A 2H7XA 3QVMA 4QDTA 1E66A 2WILA 2JEZA 4C87A 5CT6A 1WB6A 2XMSA 1QIMA 1SFRA 5AK4A 2BGNA 4OB7A 3ZWQA 3WK7A 3PICA 5K3CA 5FP0A 4W9RA 3FYUA 3QMVA 1A8UA 3WK5A 2HRRA 3QM1A 5HCUA 1HPLA 4G5XA 4WDRA 3D3NA 4BB0A 4DLNA 1JU4A 4OYYA 4U2CA 4Y2SA 3A2NA 1WPXA 1MX5A 4GWLA 5EHQA 3WWDA 4JYPA 4W1QA 2AJBA 4MQMA 3NGMA 4K6KA 4MXDA 1EINA 3C87A 2QUAA 3H18A 3DNMA 2Y6VA 1JT2A 4A16A 1QIDA 3KD2A 4ZI5A 3BXPA 2Y1KA 4KRXA 1ZIXA 2XUFA 5IVDA 3AZPA 1UK8A 2V97A 2ZJ7A 4IH4A 4Y2XA 4Q82A 1W76A 2WIKA 1EX9A 3W9BA 4C4XA 4ZWNA 1YS2X 4N8SA 1UKAA 5E2IA 3FYUB 3W04A 4RPCA 4MYSA 3WYDA 3W05A 1AX9A 2W22A 1XZBA 3IVMA 1QE3A 4INZA 5JIBA 3I28A 2G5PA 1YB6A 1QFSA 4HAIA 5DLPA 3RLIA 4BE9A 3C8HA 5SYMA 1H2ZA 5ALKA 2GYVA 4DIUA 4P93A 1Y7IA 1IZ8A 2DQZA 5D3KA 2GBGA 2HDWA 3FSGA 2PU5A 2D5LA 4FBLA 4HS9A 5I7UA 2VATA 2BAGA 2HIHA 3DL4A 2PSJA 5AI8A 3R3WA 4GEGA 1YASA 1XZCA 3FCYA 3F9CA 1QIHA 1K5PA 4Q3KA 2PSEA 4GECA 3WQHA 1MN6A 2XDWA 5ALXA 5J3JA 4XIIA 4LIPD 4UBJA 3PE6A 4BRZA 5FPPA 3IURA 1D07A 2O2HA 4OSEA 2O7VA 4HZGA 3IA2A 4QNNA 5A2GA 1ZGCA 1ZI6A 1HDEA 5ALYA 2XE4A 3QH4A 2OCIA 4UUQA 3UUFA 4X97A 1BROA 4EUSA 4LXGA 2XUIA 1QIEA 3STWA 4DNPA 1GPLA 1LPOA 2X5XA 3F98A 3C5VA 5ALSA 1MT3A 4Q34A 4X00A 1LGYA 2WFMA 1ZGBA 3EF3A 3PUHA 3H1BA 1YA8A 5HQ3B 2Z8ZA 3I2KA 1QIKA 4OU5A 5KWJA 3ILSA 3H2HA 4FLFA 5AKGA 3G9TA 2XUPA 4FNGA 4KAFA 4V2IA 1R3DA 4AZ0A 5JAUA 4FLMA 3MVEA 3V1KA 1CUVA 1FJ2A 5ALDA 2B4KA 1U4NA 4B84A 4UBIA 1EDDA 5EFZA 5AH0A 4L9AA 5AI5A 4L3WA 5EGNA 5ALIA 2WU3A 2I78A 5K3AA 5HKAA 4AX4A 5JALA 4IHAA 3AZQA 4OU4A 3V1MA 3AIOA 1X2EA 3X3HA 1IVYA 1XFDA 2WTMA 1DTEA 1QIIA 2VJCA 3OC0A 1CRLA 5AI9A 4CG3A 2OQVA 3WIOA 5CH5A 1XZLA 3BIXA 5AM1A 5FPQA 1NU8A 2PUHA 4UBOA 3STUA 5K3EA 1QZ3A 2WIDA 4J0HA 2JGEA 5CT5A 1AQLA 1MX1A 4BTVA 1JMYA 1Q84A 3PFCA 1ZI9A 4X92A 2HA5A 4GLBA 4BATA 3WK8A 3NWOA 2Z5GA 1GZ7A 2Z8XA 1OILA 4UBKA 3C70A 2JGIA 2WUFA 3JYHA 4QWMA 4OD0A 1FFCA 3V1LA 3O9VA 2DQYA 2CEKA 4HRYA 3TEJA 3M3DA 3G0BA 3ESBA 1AC5A 4BDSA 3FLAA 5ALQA 4J03A 1LPSA 1CUUA 5ALWA 1ETHA 1EI9A 5LZ4A 1XROA 4Y2PA 4H7KA 4ZRDA 3H0CA 1HQDA 1XKTA 1QONA 5AIAA 1H2YA 1XZDA 4BDTA 4WCVA 3B3QA 5CT8A 4NVRA 1GPNA 5AKJA 1CQZA 3BDVA 4FWBA 3T52A 1CUYA 3DCNA 2FUKA 3G02A 3HSSA 4UHCA 1BN6A 5LYYA 2AJCA 1ODCA 2HU8A 4DNFA 5BOVA 3TGLA 3B5EA 5AKYA 3F8SA 3WKDA 3QZUA 2JGLA 4W63A 3GUUA 2QMQA 4AXBA 1L7QA 1E5TA 5I9IA 1F0NA 1MPXA 4Y2VA 3DLTA 5AJHA 4PSCA 1Q0ZA 5AKLA 1XRMA 4G4IA 1AMNA 2H1IA 3AZOA 3I2FA 1XQWA 2EDAA 1VA5A 4H0CA 4OPMA 1GT6A 4BVKA 4C6HA 1DQYA 5AKHA 4HVTA 4AMYA 3ICWA 5FDFA 5FOQA 3HABA 2WUEA 2OGZA 3FLEA 3Q8WA 4H7DA 3WKEA 1EA5A 1XZFA 2ORYA 1AURA 1J07A 2OAGA 4X94A 3MUNA 3PUIA 1R4ZA 5JADA 5DJ5A 2ONCA 2WFLA 4BAUA 3LS2A 1ZD4A 3LIPA 2PU7A 1F8UA 2G63A 4X7BA 3FNBA 3KDAA 5JZBA 3ZPXA 4F5ZA 2DHDA 5ALLA 1GKKA 2WKWA 2HA2A 5HFAA 4BCCA 2XUQA 1ORWA 4PSDA 1CUAA 4DNOA 1MNQA 2IX9A 1LBTA 1MU0A 1O6FA 5CT4A 4FFWA 2XQJA 2JGJA 1N8SA 2GZSA 1CUHA 2OCGA 1UKBA 5EIHA 1QTRA 3ZI7A 3ESAA 5JD6A 5FRDA 1QOZA 2FX5A 3GFFA 3O9MA 3I2GA 1TIBA 3U0VA 4GBGA 4ITVA 2OPHA 2QOEA 2JF0A 5A7FA 3HACA 4N8DA 2R8BA 5C81A 4UHDA 2WFLB 4A23A 1WHTA 2G5TA 3VISA 4DMHA 1EK1A 1LZKA 3STYA 5AK3A 2OG1A 1XRLA 1WCYA 3DYIA 2BGRA 3R41A 4LKOA 4BAZA 1C7IA 2RONA 4PW0A 5HF6A 2C5GA 1W6RA 4LHEA 1A8SA 1J06A 3NUZA 5AK5A 4CIBA 1CUWA 3VVLA 1XRNA 5HKBA 2HA4A 4KJXA 3STXA 1CUFA 3FCXA 1CFJA 1JJBA 3WK9A 3PI6A 2X8BA 2HA6A 4Q3OA 1UK6A 5JAPA 4ROTA 1UK9A 5YASA 4X90A 2JGMA 1A88A 2P8SA 4GDMA 4B6GA 2XUOA 2VEOA 3L1IA 2ZSIA 4IO0A 4MWSA 5ESRA 1P0QA 1WB4A 4Y9SA 5ALEA 2O2IA 4B80A 1Y37A 3JWEA 3QPAA 3H2IA 3IUQA 4BVLA 3IB3A 3IDAA 1EDBA 2XUKA 2OCLA 2ZYSA 3V1NA 4JUIA 4J0JA 4EHBA 3HLKA 4KEAA 4UPDA 4BVJA 4DM7A 3M81A 3O4JA 3UMJA 1CR6A 3WL6A 3V9AA 4UFOA 1BU8A 5D7BA 1EXWA 2PL5A 1T4MA 4BC0A 5AM0A 1K4YA 4OYLA 1SCQA 1K8QA 1X2BA 1WM1A 4BTLA 4UBNA 2ZYRA 2CJPA 4XJVA 5EI5A 1ZJ5A 5EHNA 3H17A 5LP1A 5EHXA 4JH0A 2WIGA 4EY7A 3DKRA 3ANSA 5DNUA 4KAJA 4MWTA 1R9NA 1XQYA 2XQFA 4F60A 1DT5A 2CZQA 1JFRA 1XZEA 3GZJA 3WJ2A 5I8PA 5T4FA 2ECFA 2WJ4A 3BE8A 4JYMA 4J0DA 1E89A 4W1PA 5JD4A 4J0IA 5LKRA 3A2LA 4X95A 2XB6A 2QXTA 1LNSA 1LPPA 2DR0A 3WZLA 2DHEA 2WQZA 1USWA 3G9UA 5C7YA 3CN7A 4WFJA 1U2EA 4U2BA 5CH3A 3A70A 4K2AA 2WSLA 3Q0TA 3PFBA 5KWIA 3VKFA 3ED1A 4Y2TA 2C0QA 1IUPA 3OTQA 2GYUA 2I03A 3VXKA 2JGKA 5JAOA 5DYYA 5H3HA 5EIEA 5CBKA 4CCWA 4IH1A 4U2DA 5K3FB 2RHWA 2XMCA 1MO2A 1H2WA 4FOLA 2IIVA 2CB9A 3D2CA 1E8NA 3DQZA 3DL7A 2HU7A 2VQ6A 3AILA 1BE0A 1YS1X 3GA7A 5KBYA 3LLCA 2ACEA 2XMGA 4OB8A 5LZ2A 2VT7A 2W6CX 1XZIA 3A2MA 3L1JA 4HXEB 3PF9A 3O4HA 1TK3A 3AINA 3EQ8A 1VE7A 3AIKA 3LIIA 4G9EA 1WHSA 2GBIA 3EQ9A 2Y2VA 4ZV7A 4G9GA 3O95A 3BDIA
chains in the Genus database with same CATH superfamily
4GZLA 2J9YB 1RKVA 2XHZA 2LBPA 4LHXA 3EOBI 4M6WA 3QI7A 1LDEA 1XIVA 4LK2A 3P0JA 3HB7A 5HR5A 5KREA 2EWVA 4XFDA 3IOCA 3PJGA 5ALTA 2IZ1A 1D5WA 2FY8A 3EN0A 4ZT5A 3S55A 1IDOA 4ZO9A 4DJTA 2OCXA 3CKMA 3P9QA 4PPYA 3EPKA 1T2DA 5GQSA 5C8XA 4HRAA 2R6JA 5REQB 1H6BA 1N2CE 2XZTA 2WM8A 1XEWX 1DG9A 1WDLA 3OQHA 4DYVA 2QSUA 3AVYA 4UTZA 2B0JA 2CLKB 1Z45A 4ZAGA 4LN1A 4M8SA 1WZEA 3F47A 3BWMA 5FCDA 1KNXA 1M2OB 1YI0A 1P7YA 3WLPA 1IMJA 2CF5A 1T9BA 4HNUA 1F12A 2IW1A 3SZUA 4DUYB 4D46A 2GZRA 3TLJA 2WYHA 1WQ4A 1LV7A 1V43A 4R3UC 4EHFA 4QOFA 3UTDA 5CBPA 1ZCBA 2RK3A 3EEFA 3JQ9C 3O93A 2VP6A 2HIMA 3EZLA 4GZMA 2QLBA 4WHMA 4MV7A 1JR3D 4RHUA 2I3BA 5EJFA 1ZM3A 4PCVA 4DIEA 1C1XA 2HD4A 3WQBA 2PXCA 3U7QB 3WAGA 1TECE 5IHPA 5E9QA 2WW8A 5TE9A 3INYA 3KKZA 2JBWA 1E9VA 1SULA 2ZSEA 1Y5IA 1NMEA 2HGSA 2PBLA 3GGOA 3T1VA 4F2DA 2ZVJA 2EFCB 2VDWB 1CR0A 1A8HA 4JITA 4RA9A 2B2CA 1MABA 1T6NA 1KEUA 1B3BA 1G8MA 2OLKA 3N0VA 3NH9A 4O4LB 3SZGA 4J3FA 4N5LA 3T7JA 1ST2A 2C04A 4W8HA 2HL6A 5ITVA 1TVCA 4LJRA 4X85A 3TECE 3COVA 1N6HA 2OBBA 1FMJA 4RLSA 2H2DA 2I0FA 2JI6A 1WQ1R 4K05A 2CSXA 2HJVA 3QFTA 5T6MA 4KDCA 1BJTA 2GASA 4BNHA 3ENWA 4OHWA 4WAUA 4WEOA 5AI4A 1NMZA 4GBMA 1N0VC 3FUUA 3MRTA 4WADA 1M2NA 2A2ZA 3K9CA 4O6VA 4UBMA 3SX2A 3LDGA 4AS1A 3MJ4A 2AN3A 3KXIA 1REQA 3WLOA 2VHEA 3CC8A 1QGDA 1RWBA 3GB9A 3KWFA 4Q01A 3DDHA 3E53A 3DFMA 2ZXEA 1IIBA 1P0FA 2YASA 4G67A 2FSPA 3TLYA 2HM7A 4ZGBA 1OWMA 3KV1A 3OCVA 2UYYA 1I13A 3U62A 1BE8A 1I2DA 2QRLA 3NIWA 5FA6A 2GBCA 3AG5A 5L53A 3ZK8A 3H5RA 1CUGA 4TMYA 4L85A 4CQLB 1OXTA 1KL7A 3PX2A 4RIHA 5U4QA 3I34X 2IX3A 1THMA 3G89A 1WUIS 3IDZA 4FOTA 3HVKA 4DA8A 5EIXA 1JRLA 1NXVA 2Q9AA 2OM6A 4U02A 4FYPA 1UBOS 3FLBA 4ZZ2A 3MUEA 5CA0A 2FYTA 1NXOA 2X0JA 1DKOA 4DFDA 1CUZA 3QMMA 4B7AA 4KUEA 3GK3A 1PFWA 4ZC1A 3H9GA 4L8VA 1W93A 3AFMA 4M6WB 5HTOA 1XX6A 2HRZA 1OHHD 4XPIA 3VU0A 4MPJA 4ASUD 5EMMA 4D9HA 2FA9A 2V9CA 4GR5A 1JB1A 3C2QA 4P38A 1BRMA 1KAGA 1UC9A 2G88A 3QTTA 4E5NA 4DV6B 1P33A 3TXXA 4ABYA 1UFOA 2XITA 1KHHA 1MW9X 3HJRA 3NX4A 4D42A 5IABA 3VHQA 4UHBA 4UVGA 4JBIA 1UIMA 1ZSVA 2CMFA 3AERB 1GZHB 1ICIA 3TAXA 3PFKA 2X14A 3UMBA 3I0NA 3RC3A 5JASA 3E6AA 3D7SA 1BDBA 4AMUA 1BFDA 1EVLA 5B7QA 1EE1A 2VTVA 1BKDR 1EWKA 3TMKA 4QATA 5LJIA 3GGPA 4IJ6A 1ODSA 3A1FA 3BFVA 1HQKA 1RQLA 3IAAA 1GD1O 2WIJA 1Z3IX 4O08A 1L7RA 4KAAA 4WLEA 2WJJA 2Y1OA 1U99A 3NKLA 2V7EA 3ZVRA 4JN6B 1CLEA 2J46A 5FLYA 2X1MA 1UM8A 1U0FA 5I01A 1CZOA 1NG9A 2HZBA 5KCMA 3K0KA 3WMGA 3X43A 5M04A 3I4LA 1US8B 3HCBA 3RRZA 4DMUB 3R7SA 2AZTA 3TO5A 1YONA 1SVMA 3L6UA 4MA0A 4HUTA 3GP8A 2POCA 1DRVA 1IBCA 2IELA 1G19A 2R60A 3T1QA 1V71A 2OUKA 1DCFA 3B70A 3PRJA 4HDSB 1YU9A 3IUEA 3QMWA 1EK2A 2RCYA 3ET4A 1KO5A 1F3LA 2BBTA 3HNRA 4O1IA 5LBIA 4WW0A 3SQDA 1VSVA 1ZG3A 2Z2XA 4GOXA 5CYOA 1WDKA 1MABB 3FHTA 4PQGA 1Y8RB 3N1UA 3UKDA 3G2LA 3UUWA 2PK3A 4MW4A 4QBGB 4UCQA 3MNFA 1GTSA 5JD3A 4JJ6A 1J21A 5IZ4A 5L4NA 2LCQA 1LFAA 2V54A 5EWLA 1T6ZA 4DANA 1LJUA 1RLJA 5DPMA 1DTSA 3QGMA 5B3JA 4HI0E 2CFCA 1X8JA 4QDUA 5HCIA 3RS3A 4C89A 3Q72A 1NR1A 5BN4A 1XK6A 1YK0A 3IUJA 1YTUA 2ZM6B 1MOZA 1XRRA 2VBGA 2UUOA 1GXSA 4KC0A 4V0QA 2ZUVA 2QTVB 2TMYA 3VR6A 2C1XA 4WASA 2GHQA 4WNYA 1TZCA 2QF7A 1V95A 1KPGA 4C6SA 2AF3C 1ONSA 1HXHA 3OCWA 3EZ2A 1JB9A 2IEAA 3BWYA 1Y4DE 2FWPA 3A10A 3G49A 3OMWA 2C5FA 1M34B 4YALA 5J59A 3WI7A 2ORIA 4BRWA 4MB0A 4KQJA 1WPGA 4FZ3A 1ZVQA 3WYNA 1K6IA 3DCIA 3MG9A 4V3BA 4FI3C 1D9ZA 1GUDA 4J0FA 2WU4A 3PFHA 3R6DA 5F21A 2VJMA 5JAHA 1RVV1 3RKSA 4Y1GA 1KK0A 2RG7A 4A27A 3WNZA 1OLSB 1AKRA 3W5VA 3LPNA 1N7HA 4D9BA 2HXGA 1BRTA 1PK7A 1M74A 2Q0QA 2ZWVA 3CZAA 4D3XA 4EDHA 1T35A 1JFSA 4IFTA 1MX3A 1PVDA 1RHMA 3DPSA 3IV7A 1IC6A 4ZHQF 3AERA 1BD4A 2JIRA 3NAZA 2J3KA 1NP3A 3PFGA 3Q4GA 3GPIA 1RZVA 5E0KB 1YRAA 3TIFA 3T9EA 1V1JA 2HO5A 1APBA 1DAEA 4GOKA 4IIVA 1H2RS 2CCGA 1V1MB 4KXVA 4PLTA 2RB5A 3E5NA 5BR1A 1OAOA 2H7CA 3QJ5A 1RPZA 4QFBA 4PAMA 5COBA 1OIVA 4KWTA 5TQ0A 1QP7A 1F2TB 2PIDA 4ITUA 3RF6A 4UD2A 2ZSHA 3HFGA 1H4SA 2SBTA 4LXTA 1Q1ZA 3SYRA 3TLGA 4NYIR 4M0MA 1FS6A 1U7PA 4MKRA 5KVAA 2GKSA 1ESCA 3AHEA 4QYSA 3TQFA 4DABA 5B30A 2R65A 1EUZA 1DX6A 1CS4C 1G3UA 2IGTA 3KYDB 3G2KA 3IQIX 1RT9A 2F3RA 1CZKA 2QTAA 2O1WA 3EDCA 4JLSA 4HYYA 4KX5A 4P8RA 1Z0ZA 1NXTA 5BWCA 3FMGA 5H8WA 1J8MF 3V1YA 4YMIA 2Z98A 3P2MA 1Y7HA 2H2AA 3K8QA 4G5SA 1V3VA 1JHPA 4JWTA 4D8VA 3VC3A 1YJ5A 1W46A 2VWPA 4HEA6 2V6MA 4PLGA 4DC0A 2OOKA 1BCSA 1BOOA 1NXQA 5J2TF 2AUMA 4BIMA 1O6GA 3EBOA 4TWIA 1E5DA 3AFIA 5TQ2A 3BZBA 1WBBA 1M83A 3ELWA 1M1NB 1WW8A 3H16A 1IXSB 1JEAA 2OZKA 2HJRA 3FN4A 2BZSA 3N2IA 3QX9A 3ITKA 4G8CA 2D1SA 4NE7A 3A4TA 3U4CA 3NVMB 2Q4TA 1A72A 4MX8A 3R5XA 4AY3A 1Q44A 4OGGA 4AG5A 3ADPA 1TA0A 4L4ZA 5EWMA 1SHTX 3S0JA 5JCZA 1MQ9A 1U2DC 2R8PA 4DDTA 1XGKA 4ZQFA 4BZWA 4MYTA 5FOUA 5JZVA 2AFIB 4BLUA 4G3XA 2ZVQX 3E27A 4LYDA 1C7RA 4I5GA 4C2AA 4R5HA 1TA4A 3U2QA 4OI0A 5LMNB 4N5HX 3R77A 1JR3A 2G9RA 4L8LA 5T8KA 1GGMA 1SB9A 4LXIA 4P32A 4XE5A 4BFVA 2W6ZA 3A0RB 1Y8ZA 3B7GA 3M4ZA 4EGFA 1KZ1A 2CXXA 1SXPA 1NZDA 4K86A 4M3NA 4YIKA 3UFXB 2Q6LA 1S9DA 3KB8A 3L84A 5AR1A 1JFTA 4EFMA 2WSBA 4BCDA 4RTPA 1SVKA 5AJZA 1Y0BA 3INRA 2ZBQA 2PVSA 4DYHA 4NTZA 2CT8A 4XR4A 1EZZA 4EMSA 2PT6A 4R8MA 5E7JA 2BMWA 4EMUA 2Y1GA 2ISCA 1AQIA 5BV1A 3NDJA 3K72B 4DMRA 2ZDGA 4IDEA 2JGNA 4LYJA 4DHEA 4DKXA 1SXHA 1CY6A 3CNLA 3HJUA 2VDWA 4P7FA 5SY9A 3K0SA 5G1OA 1P2FA 3I58A 3LAWA 4AS3A 2GFHA 4M0FA 1C80A 1K08A 1JYSA 2OENG 2OCDA 4KFSA 4N8EA 5EZYB 4G0WA 3OT1B 5ERGB 2HH9A 2CHQA 2A6PA 1QKKA 2RGUA 4FW9A 2O14A 1OPXA 1YR9A 4MGIR 4MAAA 3EEIA 4BWFB 2TMGA 2I6QA 4WFKA 1X1AA 1PJQA 3N58A 4TLEA 2V3VA 5IJZA 3KT0A 3GJZA 2AL7A 3VBCA 5JCOC 4HNQA 1HDIA 2F1OA 4TXJA 4U6QA 2QG4A 4KE7A 2QV7A 3HBJA 5AKXA 2E1PA 3ZVMA 2WNHA 3A1WA 3K0BA 5GONB 2GLUA 1AKWA 4RPLA 5TS3A 3TVDA 3U5TA 5KYXB 5JECA 4BKQA 4LQLA 4C5BA 1TKRA 4UVHA 3SJCA 3PTZA 4F3RA 1G3RA 1X70A 3QVTA 4JYZA 3RTBA 2FP4A 1IUNA 4IIUA 5FBRB 1QHYA 1ZRSA 2I2WA 2R87A 2HLHA 1JG1A 1XQVA 4B9EA 3OPYI 3ER9A 1OTYA 4YP1A 4DF3A 4Z9XA 4NZYA 5LU8A 2GN1A 1EE2A 3A2KA 4EL0A 1Q19A 2Z43A 4PYJA 1D2RA 3FDIA 1WUTA 2XRFA 1UP7A 3C3CA 5HUJA 2B7BA 1ISJA 1AB5A 4FC7A 1GZ5A 3FFAA 5EJIA 3KJGA 3TR6A 3UFXA 1RE1A 4F3KA 4CGZA 1BXGB 1SXJD 4R6XA 1GOTA 3VNRA 3HRIA 4J16C 2OV2A 1XMJA 3IQWA 4PX5A 1OZ0A 3NU1A 4I46A 1GU7A 3L0SA 3RYTC 3TXYA 3TLXA 2Y67A 3QPUA 4RTQA 3MJVA 5EKDA 4B4KA 2YL2A 4MV6A 5F9HA 2E21A 3ASZA 4GBED 4B3FX 1OPRA 1W1IA 2FF7A 1Z34A 3DUFA 3O1LA 1UAGA 1WZUA 5C8YB 2KBEA 3OLWA 2X7HA 1KIFA 2JPDA 3PNVA 1O58A 4N54A 5EWMB 3VR0A 1NW7A 2J9GA 5IT0A 2R85A 1IQUA 2DFPA 3U4IA 1BHSA 3D4LA 1CCWA 4H17A 5AO9A 1J7KA 2H07A 3MFQA 4RA6B 3F97A 1WUYA 1DU4A 3L6CA 2R86A 2Q3EA 4WACA 1WKVA 5HW0A 3KSBC 2ZUSA 1DL5A 4IKOA 1ISPA 2VTDA 2ZBFA 1DP4A 3PD1A 4YRKA 3IP9A 2FJ0A 2YINC 1OTXA 2JFFA 2I33A 2WRZA 1YI8A 2PS9A 2Q1SA 2R66A 3BJZA 1PV1A 3HKCA 3KBOA 2Q5IA 2X4LA 4N7MA 1UMDB 5E7MA 4JWKA 5K2MA 2AZ4A 2VLIA 2W6MA 3A3OA 4DJ5X 1CB0A 1Z38A 1U28C 4AC9A 5C3MA 2G1PA 4G0UA 1WP4A 1B6SA 1JEDA 4EKYA 3BD8A 4EHAA 1R74A 1TAUA 4ENWA 3CY6A 1Z6YA 1XEWY 3PDIB 4OHYA 2G9ZA 1RYDA 3LKZA 4BP8A 3IEVA 3DFIA 1SC6A 2H85A 4N3NA 4H08A 1BW9B 1NNUA 1VYVA 4LY3A 1D6NA 1GCAA 4W7SA 1DX4A 1Y34E 1QV9A 3OHSX 5JOQA 1JEYB 2IBMA 4QHYA 1XVUA 2QX4A 2ASVA 3FWHA 1TMYA 1ES9A 1VCMA 2NNLD 3ENZA 3I05A 3L4BA 3OVMA 3SSOA 2GDJA 3WLEA 4HDKA 1TQ4A 5FBLB 5FNZA 2YOFA 1JT9A 2FN9A 3RVKA 4R5MA 1IN4A 1L1FA 3G17A 5JVDB 3CSUA 4ZREA 3L4SO 4ZDJA 2IE0A 2UYOA 3H4VA 1E7QA 3K53A 5HIMA 3WLAA 2XUZA 2H1OA 4PTYA 2V4MA 2V3WA 3COWA 3DB2A 1LPAB 2A4KA 3V7NA 4H1TA 1JH9A 1GPYA 1CIPA 1H0KA 1JHMA 1N6PA 4K03A 1JKJA 3LCRA 3NHPA 4BU0A 3V4ZA 2HWYA 3R3JA 4P83A 1SK8A 2G80A 4K9RA 4Z6KA 3PEWA 1SK9A 2WJ6A 2Y76A 1V16B 4M22A 4AMVA 1L1QA 5IUNC 4YYZA 3RJTA 2OCBA 2CL6X 2P9QA 1BMTA 1CUXA 1LSJA 1ZMTA 2R48A 4TWZA 5GJWC 3Q15C 1A5BB 1MCZA 1YQ9A 2C82A 2CLCX 2ZRJA 5LL6P 4HB3A 2NG1A 1UBFA 2CL7X 3LSYA 3B1YA 1SKUA 2W9XA 4F7DA 3ZWPA 3KQUA 3HBNA 4I9FA 1OIWA 3PUKA 2WUDA 3AVUA 1CQIA 4PV7A 4WJKB 2X86A 1O57A 3FYTA 3X2FA 3I1JA 2DMRA 2BFBB 1TCUA 3OBBA 4WZ6A 2MR6A 4MV9A 1RU3A 6CHYA 2JG3A 4FKZA 2FQWA 1EK6A 4KGVA 1E2GA 2HJ9A 4B7ZA 4RHTA 5BW4A 2VFAA 1Q7BA 3R24A 4IIHA 4EGQA 2QI9C 2I34A 2WB2A 4ZOLF 5H16A 4RY9A 5KKCA 1SBYA 1F14A 2ZIZA 1X3SA 3CZCA 3VC7A 1Y3CE 4HL6A 4DLZA 1DEXA 3OQBA 3L7CA 2BL4A 3M6UA 4CUZA 4RA6A 1JEYA 3C3WA 4JI1B 4YUWA 1ZM7A 2IOFA 4L9SA 1VBFA 1H3FA 4YJFB 1GO2A 1Y5LA 4G01B 2ZROA 1R4MA 5JNLA 1CDZA 3K0EA 4BC1A 2HJGA 4I1IA 2HHHB 2NPOA 3LDUA 4MMYB 4P7BA 3DE6X 1LX6A 4S0XA 3GD7A 2OLJA 3CF4A 2LCIA 4BNUA 1L5VA 4L0QA 4M55A 2RKBA 1VA4A 4IYJA 1BH6A 1QG2A 3AGQA 4M89A 1PEAA 4FMDF 4OMFG 4R1UA 4EQ6A 3IGFA 4TXMA 3TUJC 5MFPA 1PZHA 3H3FA 2P9CA 3HO6A 4B3DA 2D0OB 5EUQB 4ARAA 1Q50A 1FNSA 2Q2WA 1R0XA 3L4EA 3PS9A 4G37A 3NHAA 4MHOA 1SCNE 3U31A 4AWBA 4M7PA 1YL7A 4QULA 2X9VA 1KSGA 3AR6A 3UBMA 1V16A 4LX0A 4RVOA 5LLSA 1TAQA 1UOQA 2ZB2A 3ANTA 1TO2E 3EFOA 5DNWA 1FU4A 1REQB 1WUHS 4F5WA 3SFZA 4H27A 2WAYA 3NONA 1XTUA 2L69A 2W42A 2NTNA 3I2HA 3ONNA 1G18A 2XTNA 4RE5A 2GFQA 5EVJA 3LWBA 1B41A 1QH1A 1KMIY 1YDWA 4LXUA 5I9TA 3F6YA 3PCTA 4KLZA 5J4HA 1GV1A 2Q1TA 4DQ0A 4FX2A 5DE3A 2JK1A 4TLCA 2C3OA 1UMCA 5IMBA 1EK5A 1INLA 2C58A 2XIQA 4J1NA 3ANXA 5KX5A 1B8VA 1MB3A 2PX8A 3WGTA 2XEDA 4JSTA 1FTWA 1QORA 2ZQ5A 1ISFA 1J56A 1KKUA 1R0ZA 4UM9D 3CKLA 1ZXXA 5F73A 4EO7A 2B8NA 3I04A 3HO1A 1TDJA 1PG5A 3M9XA 4MW5A 3IEIA 1GGVA 1P1RA 721PA 1XPJA 2R62A 3R0JA 5BRJA 2C5LA 2PWPA 2WR8A 1U7DA 4R1NA 1EXNA 2BI8A 2OMEA 1GTMA 1UJ5A 1MB0A 2F8TA 4U9UA 3WWEA 3K9NA 4EVQA 3GFSA 4MV5A 5JLAA 1SHLA 5HZKA 4CLRA 1BXRB 3V4PB 1S2IA 1TMOA 1E2KA 4XYBA 2IYOA 4DAEA 1B0UA 2Z3ZA 1K75A 4JEHA 2XUAA 1KDPA 2HRBA 2V59A 1J9GA 3NTVA 4UBLA 4URWR 4H35A 1MTZA 2WUGA 2PKQP 3TD9A 3ZQKA 2ADOA 2H0QA 3A05A 2QX6A 1RZRD 2I62A 1DXOA 2EGGA 4KZKA 5BSVA 2OK8A 5CJ2A 3RASA 3VDRA 2BFDA 4F21A 1E4YA 4LF4B 3L8CA 1RABA 1NE2A 1FU8A 1AT1A 3K6KA 5BYAA 4X91A 1UT6A 2IPNA 3SNHA 4DPLA 5HGXA 1TE2A 1Z5GA 5J4YA 4JGIA 3B5JA 2BYTA 4G26A 3VAAA 4Z5XA 3JQFC 1E8MA 1XA3A 4LRUA 3HP7A 2CJFA 1L7AA 4GUAA 4JVSB 1DIBA 2P30A 2XCQA 3ECCA 3LY7A 3N8NA 2O8NA 4W1RA 4ARZA 4L8FA 1LLCA 2JD2A 1NTOA 4Y2JA 3NV9A 4C3OB 1M1YE 1P81A 2B1JA 2ODAA 3SN6A 2YIJA 2WE7A 2YFKA 2FJPA 3NEPX 4OQXA 3P9XA 2PMWB 1FRQA 2BTQB 2WTNA 5I9MA 5FUMA 5CH8A 5HG0A 3R0QA 5K03A 1SIBE 1UQRA 5HP4A 4PGFA 3FPJA 1Y3IA 4C7JA 3D9QX 1YUMA 2P6MA 3QJYA 4RZ3A 2UU9B 3E23A 3CZRA 3HUDA 1F4VA 3IMEA 3EVAA 3L4BC 4AO7A 4NXNB 3SX4A 3HHEA 3U56A 3M70A 1RWOA 2WT9A 1A50B 3TR0A 3V97A 3RYCB 3UGJA 3G6KA 1D2EA 2VNSA 5A2QA 3AR4A 3ICEA 1FW8A 3OZFA 4ZICA 4TQAA 1MJNA 2BKEA 4RKQA 4F38A 2X8JA 1DJQA 1OZHA 2JGRA 3LX4A 2C2BA 1T3GA 3UH0A 3DFFA 8ABPA 3Q88A 3JAMA 3HEAA 3ITEA 3VPSA 3K0CC 4YP7A 3VJKA 4BTEA 1UC5B 4GQAA 3WJ7A 3N2KB 2V55B 1EG7A 3RK4A 4D0RA 1P5HA 1YZFA 1MA0A 5AVTA 4ERXA 1XJCA 3GWGA 1N1EA 1U8YA 1Y5RA 2REOA 4KB5A 4KR9A 4DNQA 1XPRA 5C4MA 1UZLA 4REOA 2VYNA 1OWLA 1NONA 1IJFA 2D0DA 2FZ5A 5I9NA 3B51X 2QXYA 5CDFA 1M1XB 3WGIA 1WCIA 4OXXA 3UKJA 2I3AA 1Z07A 2ZYIA 1U8XX 1N2ZA 4PXSA 1MC5A 3IV6A 2G4LA 3VAYA 2NVUA 1YB4A 3RV4A 3TLZA 2GD2A 2HXYA 4KO2S 4PR0A 1RYFA 2NTJA 1CUBA 1K0FA 2H18A 2QN2A 3TNJA 2YXLA 4MZXA 2BFCA 5LZ5A 4D8TA 3OJ0A 3O8OB 1KZYC 2QUIA 4GP9A 4H15A 3IBGA 5AW7A 5JZ9A 3V4RA 4GPEA 4B8WA 3CCFA 5BYBA 3I92A 1QCCA 4W8OA 3L5OA 1NLMA 1XTSA 5C4IA 1VJDA 1T0IA 1YB1A 2F7SA 1FZQA 2ID7A 2MCFA 4ZI2A 1KI9A 4GKBA 5KAMA 4MCHA 1IHDA 2OV4A 3WIEA 1N1MA 2HLPA 4BZZA 3P0RA 1A7AA 4GQBA 1JG4A 1OGIA 4AKEA 1ZUNA 4WLFA 1T9GS 5IM4A 1Y6FA 1V6SA 1EWRA 1RWNA 3H3JA 3JQGA 5TY0A 3N6RA 2RE8A 3ML1A 5AT1A 2YR0A 4E14A 2GJ9A 4J0KA 2JKVA 1BKSB 4UNRA 5DIFA 1OBOA 3KDSE 4MCIA 3PLAE 2IT1A 1MDBA 3NH6A 2EJCA 5FFNA 4AB1A 5LMCA 2RGNC 1ODKA 1D09A 1ZCZA 3DO6A 1DJLA 4FCTA 5C4GB 3EPJA 1KDTA 3JAKA 4I4TF 3GUZA 2JIQA 3GGGA 2Z9CA 1O9GA 2O4UX 4N0PA 5CVVA 1U5CA 1RIFA 4FR5A 1X8KA 5IVHA 2PMDA 4CT0A 4EAAA 5TX7A 1JQDA 2P69A 1XZGA 4H7IA 2V96A 2DWPA 2AK2A 2AMLA 1JALA 4OJTA 1VSBA 1WKCA 2G67A 1CIJA 1KR2A 3DMFA 4L3OA 1JU3A 4D8XA 2H51A 5CDYA 1W75A 4TV9B 1W5TA 2I80A 3IALA 3H42B 4HRXA 4OL9A 3KYCB 2V9ZA 3NBFA 1NJ5A 2A5JA 3WRVA 1QNLA 3AP1A 4MLPA 2BMJA 1OFTA 2CXNA 2P78A 2J3LA 4RACA 1PZMA 4TYYA 4RFVA 5GONF 4ZVVA 3G59A 4X3CA 3SIPA 4PY2A 4BQEA 1NM5C 1VG1A 2Q07A 4NCJA 4K6GA 2XDYA 4XPIB 4QTZA 4DSNA 4OI1A 4C30A 1XCJA 1IWPB 3G2JA 1VC2A 3CO5A 3REQB 3WJ1A 3X44A 5HXAA 2NT4A 4N5IX 1H9BA 1L5NA 4UU7A 3TPZA 3KFXA 3N39C 1H2BA 1SC4A 1Z29A 2XNCA 3B60A 2M1XA 5FTMA 5IM4F 3BFKA 13PKA 3UN1A 1NIPA 4B46A 4D4KA 2ZP1A 4NV1A 3UBTA 3WE7A 4A6XA 2V58A 1TGYA 3FVTA 3IDFA 2QTLA 1JJAA 2F6RA 2FOXA 3PGJA 4MB2A 1F60A 5CX4A 5I47A 5KHLB 5KQMA 1ODFA 1MQAA 2HWKA 3E9ZA 1S2OA 5JEDA 2ZUEA 1Y9JA 4IRXA 2UZ0A 3T3NA 1DINA 3HM2A 3QU2A 4HXGA 3PDCA 4EP1A 5CDGA 3PQ6A 3A31A 2NTEA 4KE6A 5HWSA 4Z1MD 1QCYA 1X7ZA 3JWHA 2EL7A 2ZDQA 3M5PA 5AUQA 4D9EA 3SZLA 4RJKA 4ROSA 3HM9A 2ZWAA 4EB0A 3ASYA 4BB5A 4AO8A 1Y6GA 4BP3A 3DXZA 3M4JA 2VPXA 4JJGA 2GBPA 4MQLA 1ZD8A 2ECKA 4QVGA 5IEBA 2BF7A 2Q3DA 3H2JA 4OHFA 2AEMA 1OXMA 4HDSA 1ZD2P 4MKFA 3RIXA 4DMKA 1L5HB 3I6YA 1UM9B 4AKIA 1UMBB 3DONA 2P5SA 2JS7A 2FE4A 3HJFA 4QBKA 4XJSA 1COWA 4WESB 3L7OA 3ZHYA 4ZMRA 1HLGA 2NP6A 1PQPA 4TKZA 1N6RA 2IODA 4RMGA 5L3QB 4JYCA 4JMPA 4D6XA 4CKBA 2ZQYA 4GMXA 3QIVA 1CB7A 3KLNA 3L93A 4K81B 4LZJA 2XQIA 2ONJA 4EELA 3F74A 2WEKA 2J0SA 3D2BA 3EGOA 1MEEA 2XMDA 3O1HB 2B9VA 2DQ4A 3A1DA 2FVXA 3NCTA 3EBLA 5DTEA 4RDXA 2AUNA 3U81A 3UJ8A 5IULC 5IJ0A 5KTRA 4NYIQ 2BF4A 4IUBS 3WAJA 1K68A 1SUCA 3DAHA 4H77A 4QDOA 1UPXA 4QOEA 3LOQA 4B3CA 4DLKA 3B85A 4Q7QA 1ARZA 3MWGA 1Z68A 3VR6H 1AM4D 2X9LA 4PN7A 3D8UA 4M9QA 1MO5A 3FHLA 4DLXA 1LWOA 5A9SB 2BCGY 3V1UA 5HIKA 2FPSA 1XZJA 1Z28A 1GXSB 1EP1B 2Z5LA 1F1BA 5BWBA 4FWIB 3C3DA 2JA1A 4B85A 2ZULA 1HFEL 3EUFA 4JBWA 1GDDA 5DASA 3ZY3A 3W5JA 5BQOA 1OH5A 2QPLA 4QGHA 3JWPA 2PQMA 1ZQ1A 3GLQA 2CHVA 5KJ1A 1QVRA 1XXHB 3MJCA 4W5QA 4F8YA 2DG2A 1MORA 5DGCA 1ZGZA 1TNDA 4UTVA 4EVSA 4HDRB 1GCGA 1J1IA 4EFNA 1BWRA 1UEJA 2RGCA 4MYDA 4Z4HA 1M73E 2HQSA 2ZLBA 1QK5A 1RYNA 2VTBB 3ZE8A 1GPUA 4G6ZA 4EKGA 1N2HA 4J9VA 1KJJA 3VPHA 1KRWA 4OO3A 2CCKA 4M54A 4AP9A 2QD2A 1YJAA 2XDAA 3PC4A 3CB4A 3QOWA 1KZHA 3OQIA 2ZB8A 4JEIA 1GKLA 3DHNA 2Y1EA 2O07A 3CX6A 2WAOA 3HDYA 3MTBA 4J2OA 4MS4A 1Q0QA 5F2EA 4D79A 1PDWA 5BXYA 3PG5A 5KWVA 3SGLA 1EFAA 3LVQE 3WWYA 4Y2HA 2D0IA 4X93A 1AUVA 2ZK7A 3UICA 1XKQA 1MFPA 3GT3A 5A05A 5ITZB 5KYYB 3QXJA 4L78A 2CUTA 1SIWA 2VWGA 4XTCS 2WKQA 5DN6A 4RFSA 5CLJA 1Q21A 4JU9A 4AXXA 1UJ6A 4H4EA 4DV2B 1KZGB 5E95A 5BSTA 1T9ZA 3RFVA 3U3KA 3E8SA 1I2AA 2P1DA 1MO3A 3AP2A 3O75A 1B74A 5LQCA 2IZ0A 1O5TA 4H2DA 2FPPA 4YLGA 1YSCA 3O1JC 4DN6A 5KIAA 3ZV7A 4HWRA 2YWDA 3U40A 4DQVA 4L8GA 3M3PA 2EAUA 3TFOA 1OH6A 2X1LA 2ZIXB 2PS3A 3RRYA 1TYZA 2WMYA 1WF6A 3F9RA 1GV0A 5FUVA 2H2HA 4NU0A 2H92A 4B75A 3CNOA 5D51S 1KTIA 3TW0A 4BXOB 1PJLA 1U3DA 1IMOA 4WVLA 2XKBA 2GK7A 2RFLA 3SKYA 4YRBA 1NPYA 1W9MA 2RIRA 3QEMB 5LQKA 1SUBA 3LYUA 4RZQA 4D0GA 5B7GA 2KWIA 4E5MA 2KM1A 2CXRA 2DCMA 3A04A 3AR9A 1NTRA 1YXMA 3PGA1 4OKIA 2RAFA 5SZHB 1PX2A 3TZKA 4ARZB 3HWSA 1I4WA 3ZOKA 4R01A 1F38A 3HUTA 4CV3A 3KS9A 3M1LA 4TWBA 3PXUA 4I8XA 4JOBA 2H7YA 2R8ZA 3KR1A 2I7DA 3ADDA 1Y3BE 3HDJA 3LP8A 4NATA 4WN9A 4XSHA 2VJOA 5B53A 1TFUA 2EBWA 3GQBB 2H65A 3KEFA 2Y77A 4OTZA 1CY7A 3ZWVA 3ZK9A 3NDBB 1UFKA 3IDSA 5BV0A 1ZEMA 3FDZB 2O48X 4X1KA 5FBHA 1Y98A 3A36A 3JRWA 1P9NA 4N40A 1M2KA 4TVBA 4C7MA 1DKPA 3F1LA 3OUTA 2GD0A 5HE9A 4BAUA 1E59A 2OLEA 5T5QA 1HK7A 1X13A 4RGQA 2J3HA 5IAJA 5BQ3A 4K9MA 4P7GA 2Q4DA 4NEGA 1DWUA 3TJZA 4N7JA 2F64A 2YN0A 2QDKA 4OUKX 1U2GA 5E6UA 3O94A 1FFWA 2OAP1 2VXCA 4FDMA 1MXHA 4QRDA 1HURA 2AG5A 4G1CA 4YHBA 2ZAIA 4UTPA 3QE0A 4E70A 1YH3A 3A1NA 2CNKA 1L5SA 3MGCA 4JA0A 1H6DA 4O5OA 1HYHA 4TXNA 4XB1A 3SDZA 3ZWOA 3U9LA 1LW6E 2FPKA 1LLFA 2YHAA 1JIUA 1J0AA 2R1TA 1Q3HA 2W2VA 1CPYA 3CHYA 3MRXA 3D1LA 3E9MA 5ULLA 5EGSA 4MW0A 5FQOA 4G1BA 1HE5A 5K99A 1ZMBA 4EY8A 2Q9UA 5H3LA 4TZTA 1X1CA 5A3JA 5HZGA 1WXIA 2F00A 1FSSA 3BKWA 4OIMA 1E1YA 4MIYA 1AN0A 4REQB 3R0VA 1DRKA 3VHXB 4RJ2A 3BRSA 3I53A 1CT9A 1U2PA 4HJXA 2Z6VA 2R3SA 2ZRCA 3K4QA 3NFRA 4FQ7A 4JLKA 4OEHA 1QB7A 4REMA 5J58A 4CM9D 2BEWB 4TL9A 3C15C 1VL0A 4NJEB 3GLRA 1QQBA 5ALUA 3S6JA 2NVOA 4N6NA 5L7YA 3AJAA 3R7WB 4CQJA 4OUDB 3OLXA 3AR3A 3RANA 2P3SA 2HK6A 4PAQA 4TV8F 3C3XA 4RS3A 4G24A 1PZFA 3QWAA 3Q5EA 2JFPA 2IPLA 1Z5WA 1GVNB 1Z35A 1XJWA 3OP1A 4WN9B 4ZCRA 4R69A 3KKMA 3Q7PA 4D6YA 2FZGA 4IQ8A 4PC3A 3L7IA 4YMSA 3HVIA 3GMDA 2XUGA 1N5KA 1I5EA 4QO8A 1K88A 2Z4SA 2RSLA 3OWOA 1TCAA 1QK4A 4MO9A 5DW3A 3VR6D 3ZY6A 2AEFA 4GI1A 1ODTC 1U2GC 4I99A 1C4XA 3LOPA 2I4TA 1JXQA 3KVVA 1ZOIA 1UDBA 1D03A 3IS3A 3WGJA 4I4IA 3X1WA 1QFMA 4UKDA 5DX1A 2JH8A 4CJXA 2BKLA 2R8RA 3VJMA 2PFSA 3PL5A 1DRUA 4OGKA 2BGGA 2WJPA 1OLOA 1U7ZA 3AI1A 3TW8B 3L8YA 2EFDB 3PPIA 4P4TA 2PE5A 2QEQA 1E64A 3OJCA 4AZ3B 1Q7CA 5E38A 3OPQA 4AKTA 1FTQA 4H59A 1IBSA 1J24A 2VF7A 3AXTA 1JG3A 3KHKA 4UU1A 5BT9A 2Z2KA 3C85A 1P18A 1ZA1A 2BLNA 2CVPA 3DDCA 1UF9A 2YOGA 1KMNA 4IGKA 1VP9A 4UE3S 1O2DA 2J4FA 3HYSA 2GDZA 5T3YA 2XMBA 3Q5DA 3QY9A 5GAJA 4DSAA 3EXG1 4M1QA 2ZPUA 2J09A 2AD1A 2D13A 2XYQA 5AHKA 4JL6A 1QB8A 4TKVA 2MYUA 3A9TA 4K3UA 3ZLJA 4N5MA 3MCUA 1WE2A 4GVLA 4Y6SA 1ZUHA 3SDBA 5I5EA 1ZWLA 3IMCA 2H8GA 4OHOA 1S2MA 3F90A 3DP7A 4IIBA 3AEKB 4A92A 5JNTA 3AFOA 2FW7A 4U3JB 1JLRA 1K6JA 3EGDB 3MELA 5EXDA 3H4MA 3STVA 2HT6A 3E0QA 3PDUA 1Q95A 4HD8A 4M7OA 3USES 1YDGA 1V5WA 2AJ8A 5DF1A 4RQAA 2OZVA 2IIQA 2WILA 3A6KA 4AJ1A 2G40A 4RJIA 2JEZA 4LECA 4Q7MB 4C87A 4TUYB 4OUDA 4D96A 4PC2A 3ZDBA 2DPYA 2GHIA 3W2GA 3WGUA 1FB5A 1V4VA 1QIMA 4MS1B 3EZGA 3HA3A 3FZQA 3OCCA 4OLHA 1I5OA 2A30A 1CIVA 2W2TA 3CZQA 4Y6LA 1CQJB 5CGQB 5AK4A 5DM2A 1CWUA 5K51A 4P3YA 5KNBA 3P2IA 3TTVA 1IULA 4QGSA 5LIRA 3VM6A 2X8AA 4PVDA 4YAGA 3IAEA 3NR2A 2RBKA 2V7GA 4G0XA 4MCAA 1P2BA 5HOQA 3DA8A 4DHWA 3JZAA 3QVWA 3VH3A 3SXJA 2X5JO 1B42A 3MK31 1A8UA 3R5SA 4ZQBA 1IG3A 2H5IA 3EX7C 3N0XA 1QHNA 4OBEA 2HRRA 3MSXA 4O1MA 1V7ZA 4KK4A 4BUJA 3G2MA 2WHYA 4WDRA 4BJ3A 5I7VA 3VBEA 3M5CA 1YCGA 3MT9A 1KEEA 3K1TA 2D5IA 2XSZD 1UC4B 2ZWIA 4OYYA 4ON9A 3NIDB 3PXBA 3J81A 4MYHA 3KSMA 1CERA 2E89A 3EULA 4D02A 1VLVA 4ZALA 1WPXA 3T3IA 1MX5A 4XIFA 1LBEA 4GX0A 1WWKA 1FP7A 4GWLA 1UOEA 2BI7A 4HDRA 1MFZA 3D6HA 5EHQA 3WWDA 4E2ZA 3QBTA 2E37A 4RTSA 4GFDA 1RMQA 2PS1A 3RG8A 5D7NA 2LDBA 1FS5A 4MQMA 5FL7A 2OZPA 3NGMA 3QPBA 4O2AB 3V4SA 2AIRA 1KP3A 1UP6A 4CKBB 2R1VB 1XR3A 5TQJA 4JT4A 4NKRA 2E85A 1EINA 3LP6A 3SS8A 3C87A 1FNNA 3ANLA 3E70C 3EDRA 4ODIA 4MRMB 1ZJZA 3IQFA 1ADCA 4M1YA 4NBTA 1DUSA 1SEPA 2OFFA 4DCPA 1QIDA 1NXWA 2A35A 4Q9IA 1XN1A 3BXPA 1LLUA 3UK0A 1WETA 4FMDB 4ICIA 2Y1KA 4LAFA 2ECPA 3PCRB 4KRXA 3VX4A 3ZVKA 3I01M 4C04A 2XUFA 2WB4A 5TT0A 5K8JB 3ZCPA 3OZBA 4IY1A 4KDFA 7GPBA 4WK6A 2II6A 5HQTA 1SOVA 4PFKA 4Q1EA 4IH4A 3PJEA 1E3IA 4Q82A 3UXHA 4QJ3A 1RTTA 1NW4A 1LDBA 4HAYA 4P7JA 1AU9A 2P2GA 4F84A 3C3KA 1EA7A 3X1YA 4C4XA 1A9XB 2QN8A 2NMVA 2B4AA 1YS2X 4C3UA 5BP7A 3V6LA 4Q5IA 3AEZA 4JENA 1NVVR 4QASA 4IDDA 5KYUB 1KZ9A 4FZVA 4O2LA 3U7EB 3ZGOA 3GAAA 4BFXA 5J23A 2IP1A 5TNXA 3RRNA 1II8A 3TOSA 1P2TA 1DC3A 1FLNA 4V03A 4DE5A 1O0CA 4L3VA 3MYRA 2ZKIA 3LFHA 2FN4A 2ORWA 2PV7A 4DLBA 7ABPA 1TT7A 3H5AA 1QE3A 5GVRA 4GOMD 2FSHA 4HGZA 1TLLA 1WXXA 2GCNA 2GESA 3ZWAA 1DJOA 4HAIA 4BO7A 4C20A 1ZX1A 5DGIA 1E9CA 5EXPA 1JZTA 4EUHA 4I1PA 4KPUB 2PZKA 1YJQA 5SYMA 4X84A 5A3SA 1ENOA 2POQX 2GYVA 2Q0HA 1N4AA 3ZU3A 3TIXB 4OREX 2HMAA 4P93A 4IIEA 5EE1A 4U7DA 1Y7IA 4JB3A 3WGLA 5IAEA 1BGVA 4GC5A 5DZSA 1YZLA 2XF2A 2H29A 4NZPA 1E2HA 2KBFA 3JQDA 1PVOA 1T3LA 3LC7O 2W43A 5FPKA 2D5LA 1GZ6A 3KAKA 3WNQA 3Q7SA 1E6KA 4HS9A 4MUJA 3ZV4A 5I7UA 2CW5A 3D6TB 2IS4A 3OM9A 4COKA 3OLQA 2GN0A 5GONA 1BE1A 2W4IA 3G2NA 3ABSB 3GMSA 1SKBA 2BR3A 2HTEA 2WV7A 1IM2A 5KCZA 4MQUA 3KKKA 3G23A 4I50F 2ZITA 3TPFA 4JDPA 1VFPA 2FETA 3JWIA 3VZRA 2B1RA 1LKZA 4BNWA 4FNAA 1SCUA 3KXDA 1YASA 1FYVA 3GLTA 4L16A 1WCWA 4AIRA 4HQOA 4C6RA 3V8RA 3RSLA 3IDQA 3CZPA 1KXZA 4OK5A 4Q3KA 1BNCA 2BMVA 3IO5A 4WCDA 2E4VA 5CCDA 3IC5A 3WQHA 1GL3A 5CB4A 1MN6A 1WUJS 3B82A 3T4XA 5KJ6A 3A6FA 2MYPA 3TNFA 4ZOQI 2B6HA 4DQKA 1LDMA 3OQOA 4RPIA 2NV6A 3I04M 3RRBA 3V1TC 2A3NA 4BGUA 1TT5A 4FXOA 4UVDA 1R5OA 4A2WA 1LC0A 1Y8QA 4KN8A 1AS0A 4B44A 3MS7A 2X9QA 1SKQA 1JPUA 2GWRA 1NKSA 3PE6A 1I33A 5KX5B 1Z6ZA 4BIIA 3ITDA 1PJCA 4IWYA 3K9GA 4U9HS 3UMFA 3M4YA 2KS6A 2OK7A 3N2GB 4ADSG 1JKXA 5BMOA 1MAUA 1N2EA 1RADA 4OSEA 3KE9A 2GZMA 2QP9X 4HZGA 3C3BA 3IA2A 4N7BA 1DLIA 4IHJB 1J0XO 1DAHA 4QNNA 4CR7A 1H05A 3BFPA 3NEYA 3OIYA 1O5OA 2GH1A 7ADHA 1P61B 2C88A 1NVAA 1JA9A 3DBRA 3AVQA 5LNK1 1RIIA 4CT5A 2Q4BA 3E5RA 3OEEA 4P98A 4UUQA 3RFUA 4TYNA 1JHYA 5P21A 1NAHA 1EX7A 1PFGA 4TV8A 7REQB 1EDZA 1SBZA 5KQSA 2FMHA 3WL3A 4B5KA 1P62B 3JWJA 2ZPTX 1X0VA 2LDXA 4IRUB 4IZIA 1B73A 4PLHA 4XVHA 3STWA 3W5HA 3L7YA 3ETHA 4DNPA 2QTVA 5IXSA 3ZG6A 2B5WA 2FPIA 2F3UA 3K9LA 4QL3A 2VK8A 4EG7A 4A3SA 2ZZMA 4PLYA 4CM4A 3LQYA 5DYIA 4BVEA 2YV5A 4R54A 2EVWX 4RLFA 4EA7A 1MGOA 3B3AA 2CZCA 2F1KA 3C7TA 4Q4LA 3ILYA 3VKUA 4GS5A 4JYAB 3BXEA 1FXWA 3H1BA 1JXAA 3NATA 3RSCA 5BNWA 2FUEA 4GE0A 2QLLA 4M9RA 3VNSA 3UAZA 3CV3A 3UCEA 3DMPA 3EMDA 2Q5HA 1VMKA 5JYEA 3RVRA 1QIKA 4QXMA 3SYLA 1D8TA 1YHYA 3P9CA 4PQFA 5KWJA 5F5XA 1N6LA 1GTZA 3ILSA 1SA0A 2RAPA 1ZM2A 3NI2A 4LVNA 2ZIUB 2BKUA 3SC3A 4LJ7A 2ZIFA 3SE0A 3E48A 2OYCA 2XUPA 1AGNA 2IF2A 3KNZA 4OQYA 4Z0TA 1EFHA 3Q6NA 3FSJX 3OQ6A 4FNGA 4KO3S 3EGVA 1E7YA 4L0MA 4TXHA 1T4CA 2RJ3A 3HE3A 5M2QA 1OB2A 4FLMA 3SC4A 5CEFA 1OI3A 4BOYA 4FOPA 3Q7QA 4D80A 5K8UA 4AKGA 2C96A 4D3ZA 4F11A 5LDGA 4CLHA 1FJ2A 3LW8A 2HR1A 5ILGA 4F3NA 5KSPA 1T5TA 1O1YA 2NXWA 2QQEA 5E9AA 5DGXA 2D7DA 2Q5FA 3ZU5A 3LL4A 4G63A 3X0DA 1ZZEA 1FU7A 1L5WA 4QOGA 5JS8A 3WP0A 3SQWA 1E2MA 4XFKA 3MXTA 1G98A 4U6SA 1E1LA 5EGNA 1N2GA 4LW8A 1JDVA 1IFXA 2Q7DA 1D5CA 2GEVA 3IMGA 4R31A 4Z3OA 4Y9DA 1JXMA 3MGBA 1WLSA 1JW9B 3PNLA 1RLTA 5JALA 2JFVA 1S96A 3RS2A 4NCAA 3OIGA 3P9YA 2W2KB 1NXXA 3LCCA 4W6QA 3ED5A 2I8LA 2QYOA 4Z4GA 5HQJA 1BMQA 3VQTA 3KAPA 2GN2A 3V42A 4RCZA 1IVYA 1TPZA 1XFDA 1U0EA 1GEGA 3QVXA 4FPXA 2I55A 4URUR 4MUBA 4XQ0A 2WTMA 1DTEA 3L7NA 4S1OA 1QIIA 4LXYA 1JPJA 4YO7A 3DTNA 3M8KA 2PJRA 2D4AA 4UMEA 8MHTA 1AS2A 1UBLS 2OO5A 2LXNA 4Z0NA 1T2VA 3AUSA 3CRZA 1CJSA 3G5MA 4FP9A 4N47A 5LM3A 3EZNA 5B1EA 2IUTA 2XGJA 3IIJA 4B3GA 3TNLA 4AUMA 4IIJF 1HKUA 2DBRA 1RKXA 1GA6A 1BDJA 2J5BA 3SYTA 2XSZA 4AZ0B 1YDFA 5FTJA 3ADBA 3URKA 2HU2A 5K0JA 4PHHA 4M4SA 1QP8A 4ZCMA 1WY7A 4TSFA 3ZVNA 3D3KA 1OFVA 4RSGA 1ZCAA 3QX3A 1D2AA 4DCSA 4JBYA 3CRNA 2BDEA 4CF3A 3AUAA 1QZ3A 3BE6A 3I6QA 5IKPA 3UWSA 2C2ZA 3KRTA 3H0KA 3KZMA 2YWJA 1N57A 1YZKA 4DLUA 1DI0A 3MLEA 4J0HA 1H0SA 1M1ZA 4O2BB 5SICE 1WSWA 4JQOA 1RI2A 5G41A 4PPNA 3WDSA 3BD9A 1Y8CA 3DWIA 1C9EA 5AMXA 4TS3A 1B93A 3WXBA 4DIDA 4ZTUB 3LHSA 3HXPA 3VR5H 3ZK7A 1E1QD 1UMCB 4CM1A 3MHPA 4MH0R 4GNRA 2HA5A 2ZB3A 3QUAA 3KOZA 2AGVA 1GZ7A 4OJMX 4CV0A 1GADO 2DBQA 4US1R 2Z8XA 3Q6IA 3JWGA 1KJQA 2Z2YA 3JASA 3C70A 3AKEA 1L8QA 3EXHC 1NATA 3FBTA 4LS3A 5I9SA 4NQZA 2WUFA 3JYHA 2IFTA 4QWMA 4XGRA 4FB5A 3RRFA 3CH5A 1UANA 1O0SA 3BKXA 2ATEA 2IU6A 5DNEA 4YPFA 3V1LA 5TMPA 2CLSA 3M3DA 2EARA 3MT0A 2IBSA 2G9NA 1JAIA 2IGBA 2C4TA 1JS1X 3CX3A 4KZPA 1VI6A 1A76A 4MNTA 3T0FA 5I7EA 3KPJA 4BDSA 4BO1A 4WBNA 1KAHA 5DWQA 4J03A 4IUDS 3JATB 1DXQA 1LPSA 3CE6A 2BEUA 4G56A 5ALWA 1V41E 2ESRA 4FXPA 4D8UA 1Z4NA 3B20A 1SBQA 4MRPA 4O2BF 3IUSA 1EI9A 1NN1A 3VNVA 1XE3A 3EMKA 5BURA 1JYFA 4YUAA 1G4AE 1A7JA 4E5DA 4JJIA 3IKTA 4WECA 2O3SA 4DSOA 5ENZA 1BX3A 2BE7A 4N6GA 3K35A 3QXSA 4BMXA 4I50A 3TF5A 1U9CA 1SXGA 2QSJA 1XKTA 3K3PA 2HWWA 4O63O 4Z99A 3BIJA 1GZDA 1JQBA 1ILEA 4DR1B 5AIAA 3NTOA 5ESWA 5H1YA 3DOUA 3OZWA 1C3XA 1XZDA 1R66A 2VJMB 2Y1DA 3CUWA 3PRKE 4JVNA 3F5FA 5CIQA 5LXTF 3SS9X 4CIVA 4G9BA 4D4GA 2VJYA 4YMLA 3ILVA 1XTQA 3LUBA 2ODBA 4US2R 1CJBA 3B7PA 5DEOA 2JNWA 3CX7A 3HTXA 3DMYA 4Q4AB 4V1CI 2C1ZA 2VYQA 5A1TA 3W7VA 1KJNA 2QAJA 1K86A 3FHJA 4I81A 4IKEA 4NVRA 3O2SB 5CHEA 5AVXA 3NTQA 4QYTA 4EPWA 3H8SA 3T9AA 2YICA 1ZH0A 1TLTA 3GRYA 2VAWA 2EFEB 4C5AA 5GJVC 3BDVA 1Q3TA 4R9RA 2QQGA 3T52A 1N9GB 4MW9A 4P1ZA 3UGTA 1NSTA 1KE1A 4GGPA 3DCNA 2FUKA 3CTPA 4A2QA 1KOLA 2E9SA 1VIVA 1I3CA 3HRKA 4UHCA 5LMUB 2AJCA 2HU8A 3C39A 4LHZA 5BOVA 4BNGA 2N0SA 1Q14A 3IE2A 4LBWA 5AJXA 3V7FA 1OOEA 4LYGA 3QZUA 4UD6A 3JALA 3D3QA 3JTEA 4Y1FA 3PDIA 3VR3D 1CF2O 1J4AA 2BI4A 2I8CA 3GGSA 3GUUA 1VIYA 4XWYA 5IHXA 1NY6A 2ZBEA 3BREA 4OQEA 4W8GA 3UGQA 1RPNA 4XB2A 5HRUA 1IBRA 1OFHA 3FH0A 1MPXA 4HFRA 5I9IA 5KOIA 3R0IA 5ILQA 4I5IA 3DJFA 2J45A 5BWOA 3LUPA 1SKAA 3HLTA 1E9AA 3UHJA 1TM7E 4BN5A 4IF6A 4AROA 3T1HB 1XQWA 1YR7A 4EJ0A 2NYAA 4P3KA 2PMFA 4Y6OA 2I7VA 2JCVA 1Y4AE 2A0UA 1NVBA 4MUYA 1R9JA 1VA5A 4H0CA 3RUDA 1R00A 1UPCA 4MVJH 2VUUA 4WOJA 5K0TA 3BWCA 4G4SP 4BVKA 2HMWA 4RGVA 5AKHA 3PHCA 1UEIA 3S5JA 5JG7A 5M7EA 3H2BA 3U6KA 1FQOA 1I7DA 5FOQA 3HABA 2WUEA 4MTLA 1U31A 1GSAA 3FLEA 4X8HA 1T25A 1XMVA 5I7RA 3ZHQA 3AHDA 3D1JA 4O29A 1XZFA 5DBGA 4ZI3A 3F2IA 4KKXB 1AURA 5IBQA 1SVNA 4R3WA 3K1YA 4M49A 2EJVA 2ZR8A 3UUGA 2FG7C 1WY5A 1T1GA 3LCJA 4HKTA 3JQGB 4DQDA 2VF4X 1JSCA 1DKLA 1R4ZA 3AFNA 3B78A 3BJIC 3OESA 2ONCA 4U7TB 3R44A 5K1ZA 1N7GA 2PY6A 1GU1A 1NW9B 3FZNA 2ZE6A 2FPPB 1DE0A 1GUYA 1KJWA 2QE7D 3CEAA 1HRDA 3K09A 3LS2A 4FMBB 4HGRA 3ZDDA 2F43B 1USVA 2GEDA 4P53A 5T3UA 1FRVA 2Z1MA 5FBQB 1WAMA 2A0YA 4Q7LA 3A9RA 2PU7A 4FGZA 4JUCA 4IMRA 4GDFA 2G63A 3FNBA 4RANA 3CH7A 1MH9A 3CLTC 1M6NA 3KTOA 4MO2A 3QI2A 4YV2A 4RHFA 1ZL0A 3MFYA 4MKGA 3VV2A 1N5IA 2DPHA 2B69A 2WAAA 3DSRA 2WF8A 3RYHB 4AY6A 1ICEA 1K27A 4NDAA 4BQOA 2J08A 3DE0X 4E30A 4F5DA 2OCYC 5JISA 4BCCA 4DRYA 3R5JA 5L45A 1GPBA 1ORWA 3OSZA 3MWKA 3OQVA 3MBKA 3TGWA 1BVHA 1Z62A 4V0RA 2WYWA 5AVKA 4HFNA 4RBNA 2BHRA 1OUMA 2XQJA 3V8NA 1Q5PA 3PEUA 1N8SA 1Q11A 1YJCA 4NK5A 1NZFA 3GX1A 1N2CB 1NV8A 2CCJA 4YJ2B 2X13A 3H3XA 2XXAA 2Y0EA 2OHVA 1Z5ZA 1KVUA 1I4DD 4ZAZA 2C7QA 2RD2A 1WXFA 2Q2QA 3ZY2A 3PR3A 5H59A 1S7GA 1W8IA 5JNVA 1QOZA 2FX5A 1I9GA 3BWVA 4WXHA 3PD7A 4EZEA 4R0MA 1QDUA 3GUYA 4CLOB 3W7BA 4NE9A 5FO0A 4NFSA 2OV6A 4Q66C 4A0HA 2V0NA 4HPJB 3IMFA 4GBGA 1P6UA 3T7AA 5EEHA 4CV1A 4MUIA 3R9KA 3TEFA 4DDMA 2FEMA 1N2SA 3FI0A 2PZFA 4M53A 1F1JA 1NVWQ 4LWQA 4HQFA 4AJJA 1U7UA 3ZDXB 3UWMA 3PNOA 1GDTA 4YJHA 3T9DA 1VLJA 2BPOA 4QU8A 4UTOA 4V0NA 1V7CA 4DUPA 3PC3A 4IF4A 3V7WA 1A9XA 2A78A 1FYFA 5C81A 3HP1A 4M37A 4A23A 3ETGA 5JXHA 1BGXT 1L7NA 3RUEA 5G4KA 2B4TO 1S2LA 3VISA 1EK1A 5KSYA 1ULHA 3H6GA 5AK3A 5ICMA 5DOZA 4WWHA 2GJAA 1IHXA 2OG1A 3S2FA 4RF5A 3PVSA 2YVQA 3ISTA 3S2SA 4LKOA 1PJZA 1XHLA 3IV9A 1TU0A 5I48A 2RONA 2GM5A 5I51A 4HWOA 1OV4A 4PZDA 4L6IA 1NPTO 3TMAA 1TUBB 1NI4A 5DVZA 2QRZA 3QUTA 2WJYA 2QTRA 2CDCA 2G9UA 4KMRA 5IKOA 2RGYA 4MMXB 3RYHA 4LHEA 4S1TA 3NUZA 4LKRA 3FF1A 2ZCVA 1HLDA 1VMAA 2X3YA 1CE8B 5AK5A 5DGHA 3VGPA 4CIBA 3VVLA 4ARUA 3A27A 3OO1A 2HA4A 3STXA 3LX5A 1R0KA 3B9BA 1I0ZA 3HZZA 1CY4A 1ZIDA 3NWPA 3KR2A 3HLYA 4JLDA 4MV8A 3PI6A 3WK9A 2IH4A 2HA6A 3GT7A 3QXGA 3RIYA 3EEOA 3QTBA 3PRHA 1HWYA 4IJQA 1E7WA 2XT9A 1N2CA 4I1VA 5KYNA 4ZOLA 1EFDN 3BD6A 3VZPA 1P3Y1 4I55F 2WABA 2FPUA 3UJCA 4IVRA 3I64A 4OQNA 3PHJA 3B6EA 4MRVA 3R5HA 4EOGA 4O2BA 1DIOB 1XZ8A 5DTQA 1DPFA 4QTUB 3M33A 2P8SA 1N3YA 2PRIA 3W2EA 4B6GA 5CD9A 1ZEJA 4B3TB 1WW3A 2O2EA 3L1IA 4MZDA 2K5UA 3FX2A 4RO0A 5BORA 5IG2A 3P9RA 4FGSA 3MILA 5ESRA 1G3QA 1P0QA 1UT5A 1Z0DA 2DAPA 3IAS1 3PQ5A 4YPOA 5B58C 1P4HA 1WB4A 1C1XB 2B25A 1RCTE 2FPRA 2R4QA 2O2IA 5B1DA 1H42A 2WKPA 4OHRA 1PQ4A 1M34E 3IPRA 1SD5A 5BW6B 2X8LA 4EWLA 5BV2P 1ZNZA 5L3SB 1RC8A 1OI2A 2IDKA 3FR7A 3VZDA 3WIVA 1NIJA 1ULAA 2XUKA 3KK0A 3G13A 4QYMA 2QENA 1TKAA 1D2CA 3V1NA 1LI7A 3DEIA 2B5OA 1YIDA 4J0JA 3IUYA 1L1RA 3PXCX 2JHGA 4KEAA 2H9IA 2PAAA 2C5BA 3UMJA 1DBIA 5F3RA 3VX3A 1DAGA 1NBAA 1MO4A 2GNPA 2OO3A 4YAFA 2BJVA 1HFKA 4UFOA 3AR7A 3TG2A 5C52B 1K9SA 5FUQA 1JVNA 2YRXA 3LX6A 4HDMB 2PL5A 3BPSA 1T4MA 1GFSA 2C57A 5CK5A 3CB2A 4L4YA 1T15A 1P1BA 1K4YA 1HTTA 1ZRHA 1SCQA 3CM0A 2XD4A 3AI2A 3BVPA 3GCXA 4EF4A 2GO7A 5K6AA 2QVXX 4P0QB 4LOAA 3JVIA 3FRHA 5KTSA 2JVJA 1K66A 2GEUA 2A1UB 1WM1A 3EUWA 3GLGA 1PR5A 4QPPA 4EHHA 4XQ9A 3LM8A 2REQA 2JGAA 3L0PA 1V4BA 2ADMA 2CJPA 4RUKA 1GG5A 3QTLA 2V3CC 1Y81A 4AUKA 4GOOD 3QKUA 2O0HA 1H5UA 1YNOA 1DRWA 4WNAA 3PI7A 5DRYA 1ZJ5A 3LC1O 3M7IA 1NVVQ 4ZCSA 3DD1A 3L6DA 4N01A 1GFIA 2HWXA 2WIGA 2G09A 3DKRA 3ICCA 2A94A 6Q21A 1Q7TA 4KPFC 3RW9A 3ANSA 3OZSA 4CKWA 3A32A 2YWHA 5E1OA 5HKKD 3ULKA 3VOBA 2WJIA 3GBVA 2XRMA 5AVYA 4PCAA 5JROA 4P5PA 1EDOA 4TVSA 2OY0A 3CUYA 3LBYA 4CKZA 3GZJA 1JFRA 4EUEA 5IU6A 1D0VA 1EVIA 5KOYA 1I6LA 4B6PA 3Q3JB 3GLIA 4OMUA 1S8NA 4KQWA 2HZ7A 1ZGGA 3SBEA 1R2QA 3PQDA 4LY0A 3RAFC 3NM4A 5GM1A 2P65A 1WX1A 1QWSA 4JYMA 3G2OA 3I23A 1ZOOA 1RPJA 2HXSA 4H4CA 5LN1A 1XDUA 2XBMA 4RD1A 1QC5B 4MAFA 4KVFA 3MD9A 3LH5A 2Q5OA 2LWIA 1QOPB 4EY3A 4KSYA 2YFQA 5K6AC 4HY3A 5JD4A 2JI7A 5C35A 1VYTA 2GN6A 1T9HA 3A2LA 1CLUA 4YY3B 5D84A 3VMMA 4NHOA 5K8CA 2XB6A 3JQRA 1CNFA 5TPZD 4O2RA 2XDQA 4UTRA 1GTG1 1BHJA 4LHWA 1JLLB 5EWJA 1E1CB 1LNSA 3KLBA 3L7BA 4WGFA 2P6RA 1TC2A 2G0AA 3H4TA 1H8HA 3NMUF 1MOQA 3WB2A 2GCGA 4FN4A 3OTOB 4UNQA 4ZKDA 3IILA 5C7YA 1WMSA 4AM8A 1ZHOA 3EISA 3TIVA 2XOKA 1SC1A 5EZ6B 5CNKA 4FE3A 5F7ZA 3GOQA 5CH3A 3A70A 1ISGA 3FCUB 3IBSA 5JSUA 1V96A 5JAIA 5K2OA 1XMQB 2MSCB 2WSLA 3PA8A 1QR2A 4LDQA 2PUVA 3A6EA 3JXEA 2XD9A 3H5OA 2MSEB 3KJXA 1OI4A 2X7JA 4H1HA 4Y2TA 2OC9A 2YMMA 5CG2A 2YYZA 2BHLA 2WNIA 1JIJA 4G84A 2E5LB 3KWMA 2PG3A 4BNDA 4TRRA 4PG4A 4DM3A 4DLWA 3EJWA 2BR5A 4I55B 1KOFA 5KNLA 4DCVA 4QOHA 2RH4A 4PGGA 3THYB 1XLTC 4ALJA 1EIZA 2J67A 3CNHA 1SKMA 3ZJUA 1GPMA 3FE2A 5DBIA 4UUMA 2B37A 4I5EA 1DBRA 1GAQA 4BHTA 4CCWA 3GOHA 1YE8A 4BLVA 4IH1A 5IWCA 4Z54A 2EZUA 3L6OO 1AGPA 5JZOA 3PE4A 2YHUA 4FOLA 1J99A 2R00A 1T5HX 4CE6A 3DE2X 3DVQX 5IZCA 4C7XA 3ISVA 3AX6A 2IIVA 1YS7A 4ENQA 4M7RA 3CW8X 2ON6A 4BX0A 1E8NA 3DQZA 5EIBD 2VQ6A 3C3YA 3Q3HA 1GGFA 4OKSA 3KEGA 5EIOA 4BX2A 1YS1X 4HAWA 3W5AA 4PN3A 2GK6A 4YCDA 2GN4A 3OT5A 2QRVB 1T0BA 2ACEA 3QOFA 2W6JA 1EUCB 5C5CA 3KB1A 3LT5A 4FD3A 4DG9A 4DMLA 1ISHA 4KP7A 4LC1A 3KQHA 5K7SA 3G3EA 3D4OA 4C29A 4AWAA 2JH3A 4FYMA 3LWDA 3L7DA 2CHEA 3O4HA 5ITWA 1WMEA 4JI8B 2C07A 1ZXLA 2GAIA 3EG9A 3LFUA 1CR1A 1U0HC 2KMLA 3G1UA