2FJ0A

Crystal structure of juvenile hormone esterase from manduca sexta, with otfp covalently attached
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
538
structure length
530
Chain Sequence
EEVVVRTESGWIRGLKRRAEGNKSYASFRGVPYAKQPLGELRFKELQPLEPWQDELDATQEGPVCQQTDVLYGRIMRPRGMSEACIHANIHVPYYALPRDGLPVLVFIHGGGFAFGSGDSDLHGPEYLVSKDVIVITFNYRLNVYGFLSLNSTSVPGNAGLRDMVTLLKWVQRNAHFFGGRPDDVTLMGQSAGAAATHILSLSKAADGLFRRAILMSGTSSSAFFTTNPVFAQYINKLFVTNIGITATDPEEIHQKLIEMPAEKLNEANRFLLEQFGLTTFFPVVESPINGVTTILDGDPEQLIAKGRGKHIPLIIGFTDAECEIFRRQFEQIDIVSKIKENPGILVPLSVLFSSAPDTVAEITKAMHEKYFKKSVDMEGYIELCTDSYFMYPAISLAIKRARSNGAPVYLYQFSFDGDYSVFREVNHLNFEGAGHIEDLTYVFRTNSMLGGHASFPPHDKDDHMKYWMTSFITNFMKYSNPVTDAKLWPEVRADNLRYQDIDTPDVYQNVKPHSEQRDMLDFFDSIYNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of a potent insect maturation inhibitor bound to the juvenile hormone esterase of Manduca sexta.
pubmed doi rcsb
source organism Manduca sexta
molecule tags Hydrolase
molecule keywords Carboxylic ester hydrolase
total genus 171
structure length 530
sequence length 538
ec nomenclature ec 3.1.1.-:
pdb deposition date 2005-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fj0A01
1MU0A 2J3DA 1A8SA 1CUUA 4YK7A 4DYHA 1THGA 4H7FA 3QZUA 3ZWQA 1EH5A 4Y2JA 4GEGA 5KREA 4MXDA 2HA0A 1DTEA 3AILA 1TK3A 5HK8A 1EB8A 1RWQA 3WWDA 2WU4A 1TQHA 3IBTA 3R3VA 3HZOA 2DQZA 4BAGA 4BZZA 3QBJA 5CTAA 1EB9A 4HAIA 2DCMA 5DNVA 1UKCA 3GZJA 2XMDA 4I19A 1R3DA 1QIIA 2IIVA 4Y2PA 3IDAA 1W52X 1XQXA 3I2HA 5LZ2A 1FFDA 1HL7A 3DOIA 4W9RA 4TGLA 4WFKA 4QDXA 4TPKA 3S2ZA 1CUXA 2B4KA 4NS4A 1GGVA 3GUUA 3STUA 3H04A 1WHSA 4JH0A 4BZWA 3G0CA 2ECFA 2HL6A 3H19A 1BCRA 1WOMA 3R41A 1AUOA 2GBGA 3WJ2A 2I3DA 3G9TA 1VA4A 1TCBA 1EX9A 3R3WA 1A88A 4OPMA 4UHFA 1J1IA 1XQVA 3OPMA 4OB7A 4X71A 3OM8A 5I9IA 2QOEA 1E3QA 4EBBA 5AKJA 4DMCA 1CRLA 1LNSA 5A7HA 4CI9A 4GW3A 4U2BA 4EY5A 2FX5A 3HYSA 2IX9A 5JZSA 1OCEA 2CB9A 1NU8A 2BJHA 1L7QA 2O7VA 1LPPA 2Y6UA 3QM1A 4J3JA 1XRRA 1J2EA 1U65A 4PSCA 2Z3ZA 3UUFA 2ZVDA 3C6XA 5A71A 4KAAA 5AOAA 1XZGA 4IH9A 3FCYA 3D7RA 3KXPA 5JADA 1QIEA 2VJBA 2QRUA 5AI6A 3C8DA 1IVYA 1CUGA 2XUJA 1UWCA 2X5XA 2XT0A 1QO9A 2Q0XA 3JWEA 1ZD3A 1DX4A 1XZBA 2FJ0A 3X3HA 5LZ4A 3FYUC 3E4DA 2ZYHA 3G0IA 5HF5A 4HVTA 5FPPA 3LCRA 5ISMA 1J06A 5YASA 1OXMA 4V2IA 5LIPA 4AMZA 5FUMA 1JJIA 2AJ8A 2PKYX 2H9YA 3DOHA 3I6ZA 4LXGA 5ALTA 2R11A 5C7YA 2ZSIA 4PW0A 4U2GA 5ALZA 2JGMA 4XWGA 3FOBA 3NOXA 3QPCA 4WJLA 3F98A 4KE8A 4AMYA 1ODTC 4BCDA 1YB7A 1AZWA 1MN6A 1YAHA 1AX9A 2XQGA 3PFCA 1K8QA 1QFSA 1L7AA 4NZZA 5DWDA 4E11A 4ZV7A 4MWTA 4EHBA 1TAHA 2HA2A 1AURA 2CMFA 4Y2TA 3IA2A 2C4HA 3AIKA 2OGTA 3DYIA 2XMSA 1ODCA 2G63A 3PFBA 4NVRA 3VXKA 2XUDA 5JAUA 4RPCA 3H2HA 3BF7A 1R1DA 5DYTA 1H2ZA 5EIEA 1MO2A 5JZ9A 4KRXA 5K3BA 3EIOA 1UK9A 2PBLA 1ISPA 3WJ1A 4ZI5A 7YASA 5FPQA 1KU0A 3BJRA 5LZ9A 3PICA 3I28A 1Q0ZA 3I6MA 5AM3A 5AKIA 2XUQA 1ZOIA 3FYTA 3TGLA 3ANSA 2GYUA 1EDEA 1SCIA 4CG2A 4HS9A 4X93A 1FJ2A 3C43A 1XLUA 4X97A 4Q05A 3FSGD 1YB6A 3C87A 3D4LA 1QIHA 5JARA 3AZPA 5CH3A 2OCLA 5JASA 5AK4A 1XRLA 4X6UA 3V48A 1C4XA 4CIAA 3IVMA 1JT2A 3ESDA 4RNCA 1VXRA 4GXNA 1WCYA 2B20A 1N8SA 2WJ6A 3FYUA 1Y7HA 5D3KA 4X00A 4GI1A 1F8UA 3E0XA 1FFCA 3PF9A 1XZAA 2O2HA 4M0MA 3WYDA 1QTIA 5HF8A 1X2EA 1XKTA 3JYHA 2WILA 3OC0A 4OB6A 2RI6A 2OAEA 2XUKA 3HXKA 4DLNA 4GHWA 5AKXA 1SCKA 5IKXA 1IZ8A 2WFMA 4N8EA 5CT4A 2HHAA 4UFPA 4FNGA 4UBLA 3WL8A 4HXFB 2C0PA 5EHQA 4ZWNA 3F96A 4IH4A 3LS2A 2XQKA 2YXPX 5CT8A 4WY8A 4FWBA 5EHZA 1CUVA 4FLMA 4U2FA 1FFBA 5LZ8A 5BOVA 3BF8A 5BV7A 4EA6A 1VJ5A 3IUNA 2HA3A 4CFSA 3G8YA 6YASA 4UHHA 1BROA 1L7RA 1MTZA 5JANA 3R3UA 3H2IA 1E5TA 3PUHA 4KAFA 5ESRA 4B9AA 1WM1A 4P9NA 1EVQA 2X76A 2PUHA 3PUIA 4MQMA 3C8HA 5ALJA 2ZJFA 1CR6A 2WFLA 1BN6A 4W1PA 3HSSA 5CXXA 3FCXA 1U8EA 3C6YA 1DWQA 4XVCA 2OGSA 1JJBA 1WB5A 3EF3A 3L1IA 1JU3A 4XIIA 3EBLA 2AJCA 1QGED 4BB0A 2Z3WA 3SWWA 4ITVA 5ALLA 1UOPA 3D2BA 2XMZA 5JD6A 2XQJA 3VVLA 1GQSA 1YS2X 3WIBA 2BCEA 3H2KA 4ZREA 5AM5A 3I6YA 3HC7A 4FMPA 4N8DA 2QUBA 3FLAA 3U1TA 2J4CA 2XUAA 4U2CA 1XROA 3DL7A 1AMNA 3W06A 5JD4A 5AJHA 3VJKA 2Y1KA 4PQEA 4N8SA 5C8XA 1HPLA 5AI8A 1M33A 3IUQA 4AB1A 3QMWA 1QFMA 4AXBA 4UPDA 3WYNA 1CUBA 4PNZA 4OYLA 3S8YA 3FVRA 3AIOA 5LZ5A 2VTVA 1XFDA 3V9AA 1W6RA 5AKKA 2VT7A 1K5PA 4GBGA 3WZLA 4B81A 1MNQA 2WUFA 4C6HA 4PV7A 4QZVA 4HXGA 4LKOA 1D07A 4UHCA 4C4YA 1H2WA 3AIMA 4J0HA 2NW6A 4W1RA 2XQFA 2OQVA 3WKAA 5LKRA 1W75A 5HFAA 4G5XA 2O2GA 2QKYA 4PF1A 4LYDA 3BJMA 2JGIA 3BDVA 4A23A 1QZ3A 3KSRA 1WB6A 2LIPA 3MVEA 1VKHA 2XLBA 2WIFA 4MEBA 2CBGA 3N2ZB 2VEOA 3PDCA 2VJDA 4RGYA 4HRXA 4YASA 1JKMA 2JBWA 3WQHA 1GXSA 3B3QA 3AJAA 3H0CA 4Y2XA 3FWHA 4JEIA 2XQIA 1EDBA 4ETWA 1G5FA 1IZ7A 1ZI6A 4LXHA 4EY7A 5DYYA 4A5SA 1EINA 3R3ZA 2WUEA 1XZEA 3G0GA 5AKLA 5K3EA 3C70A 4X94A 4Y2QA 4BP8A 1Y37A 2JGEA 1BU8A 3E3AA 5ALUA 1DT3A 4F0JA 5F4ZA 1T2NA 4BTLA 3DNMA 2WIKA 3WKEA 2DSNA 3VJLA 5AM4A 4XX1A 4OB8A 2ZYSA 3YASA 2XDWA 4E46A 3PF8A 3I1YA 1TCCA 3FAKA 1TCAA 1QE3A 5E4YA 2W6CX 1WHTA 5EHNA 3JW8A 1K4YA 2VSQA 3EQ8A 5ALQA 4BAUA 4AO7A 1CUIA 3H1BA 4F60A 4X6YA 5KWIA 5DNUA 2AJBA 4KYVA 3L1HA 2R8BA 4GLBA 3CN9A 2ROQA 1G42A 3M81A 2AXEA 3ESAA 3GFFA 3H17A 1LBTA 4ARAA 4QEKA 4BCBA 2OXEA 5CT6A 2QJWA 1O6GA 1GQRA 4E14A 4KE7A 2JGJA 3B5EA 4N5IX 3G0BA 4BDSA 1HKHA 1UFOA 1ZD2P 4QWMA 3KDAA 1G4HA 1XZCA 5K5EA 1HQDA 3LLCA 3T4UA 2HA4A 2CJPA 4F21A 3R3XA 5LKAA 2VJAA 2XE4A 5CRIA 3O4JA 4DNFA 1H22A 5FKJA 5AI9A 1QIJA 3W9BA 4JUIA 3K6KA 4J7AA 2Z8XA 5T4HA 5EGNA 2WSLA 2XLCA 1UOQA 3RLIA 4X7BA 4Q82A 3O9MA 3HRHA 2OG1A 4JYPA 3UUEA 5HQ3B 4J0DA 3KD2A 2G5TA 4J0JA 2OGZA 2Y6VA 4BRSA 1E8NA 1QIGA 5T4EA 3BWXA 3VISA 4QDOA 5ALDA 5KWJA 4IQ4A 4RE5A 1CUHA 5DTJA 5FXMA 4L72A 4D9JA 5JAPA 1QONA 1VLQA 3WA7A 1GT6A 2OQIA 4UBJA 3IUJA 3WIOA 3K9BA 2BUCA 1XKLA 2GZSA 4UBMA 3DKRA 2I03A 4EUSA 4B82A 1VZ2A 1CV2A 1CPYA 4OUKX 3D2CA 1W4LA 4BYMA 4MJ3A 4B6GA 3ESBA 5JATA 2GBCA 1XRNA 4FNMA 1LPSA 3WK4A 1H2YA 4X85A 4RE6A 3A2NA 3I2IA 2GBIA 1LZKA 1EK2A 3ED1A 4Y2VA 4EY4A 5AI0A 2WJ3A 5EHXA 4FLFA 3VVMA 2HU8A 5IH7A 3WWOA 1ZJ5A 5JIBA 1RP1A 1ZJ4A 2YYSA 1SC9A 1OILA 3G0DA 1Q83A 5ALYA 2BUAA 1DU4A 4UBKA 5FRDA 2QJRA 4IHAA 3O4HA 5FV4A 2PSJA 3WA6A 4L0CA 4UBIA 4DNPA 1S8OA 5LZ7A 5ALIA 1QOZA 5D6OA 1KEZA 5T4BA 1H2XA 2WIDA 4QDTA 3WKBA 1CUJA 2HIHA 5AKEA 5EIAA 4B0OA 3FVTA 2HU5A 4QDZA 3ICWA 4B9EA 1O6FA 2C0QA 5E2IA 4ZV9A 3WMRA 3WK5A 1N5MA 1VA5A 5IVIA 3VKFA 3G7NA 3AZOA 1QO7A 2WFLB 2OLEA 1AGYA 1F6WA 2QXTA 1AQLA 2VT6A 4Q1VA 5AKZA 2E3JA 4QLAA 1YCDA 2JIDA 3W05A 2PL5A 5ALPA 5ALSA 3GA7A 1Q0RA 4B83A 4H35A 3W2TA 3VDXA 4W1SA 3KWJA 1ZIYA 4YPVA 4OCZA 4PO3X 1MX5A 3Q0TA 5K3FA 4UHBA 5D3ZA 1CUCA 5A2GA 2BKLA 3N0TA 4A16A 4C89A 4H77A 2GZRA 2BGNA 1HDEA 3F9CA 1E8DA 2BUBA 3QPDA 1DINA 2CEKA 2PX6A 4KE6A 2QVBA 3QYJA 3IULA 3M3DA 3STYA 4ZGBA 3CXUA 4TVKA 1XLVA 2ONCA 4J0CA 2O7RA 1P0IA 4IO0A 4X91A 4AQDA 4KR0A 3WI7A 4X90A 4WCVA 4K6GA 1GPNA 2WHPA 2WTNA 2XMQA 3BXPA 3HI4A 1LBSA 2C7BA 2C5FA 1NX9A 2XMCA 2RHTA 3AUKA 5AP9A 4QE3A 1UK7A 1VXOA 3R40A 4EZIA 1T4MA 2QMQA 3C45A 3O0DA 3C5WP 4DGQA 1CVLA 4EB0A 1N1MA 4N5HX 4AZ0A 1CIJA 3TRDA 5AK6A 5JYCA 1UOOA 4J0KA 3BL8A 5K3CA 5AHXA 2HM7A 1CQZA 5HCUA 3P2MA 4Z49A 2VA9A 3V1KA 4BC0A 1P0PA 1IMJA 1UK8A 4X92A 1LZLA 2C58A 4AO8A 3HEAA 2WM2A 4M0FA 1XZJA 2RAUA 5EI5A 5EFZA 3B12A 4L3WA 3K2IA 3FLBA 1HLGA 2ZYIA 1DQYA 1VZ3A 2HA6A 1HBJA 4MQLA 2QT9A 4BRZA 3V1NA 1K6EA 1QIMA 3F67A 4G4JA 4OSEA 4WDQA 3T52A 1W76A 2D0DA 4EY6A 4Y2YA 2ORYA 1UK6A 1CUSA 4UBNA 2HRQA 2VAVA 1ODSA 5AM2A 2WHPB 3WWEA 3WKDA 1DT5A 1SOMA 3IURA 2YH2A 4KE9A 3G9UA 4K5QA 1VE6A 5A6VA 4L9AA 3RARA 4BP9A 5ALNA 2WHQA 1LLFA 4WFJA 5KBYA 4Y2RA 5CH8A 1C7IA 2VATA 3IIIA 2WTMA 2JEYA 4MWSA 1A8QA 4UFOA 1LPBB 5D7BA 1MJ5A 3RK4A 1YSCA 2PSDA 1A8UA 4FLEA 5C8ZA 2GYVA 2FUKA 1EXWA 2OCKA 4G8BA 2WUGA 3WWPA 5JAOA 1WB4A 4QA9A 5HZGA 3D2AA 5ALOA 2WU3A 2QM0A 4AN0A 3STVA 3WLAA 1TKRA 2P8SA 2DHCA 5ALXA 1YA8A 5C81A 5E4TA 1XZMA 2BFNA 1A7UA 1QIKA 2XUOA 4Y9SA 1SFRA 2RONA 1R4ZA 2EEPA 2WJ4A 3WL6A 1P0QA 2GYWA 4IH1A 4Y2SA 1U4NA 4BVLA 3LP5A 5LLSA 3FLEA 3C5VA 4I3FA 4LYEA 5AI5A 4UBOA 2BAGA 2IITA 1XZIA 2PSHA 4DMFA 1GKKA 2RHWA 3DEAA 2XMGA 5AICA 4G4GA 1FFEA 5HFNA 4G9GA 2W22A 5CT5A 2RIPA 1EI9A 3CCCA 4ARBA 4UHEA 1PFQA 2XUPA 1PJAA 4HTAA 1I6WA 5AOCA 1BEZA 5T4FA 1IUOA 1EK1A 2PSFA 3LIPA 4WY5A 2QUAA 2VF2A 4CCWA 1R88A 4QWWA 3WK6A 5ALRA 1R50A 3KWFA 4FBMA 1P0MA 1X2BA 2G4LA 5SYNA 3STWA 2VJCA 5AM1A 5HKBA 1J07A 3ICVA 3ZLVA 3H18A 1ACLA 2Z8ZA 1MT3A 4J0GA 4AX4A 2WKWA 1JFRA 5ALKA 3DLTA 1CUFA 3F97A 1IUPA 1G66A 3W04A 3STXA 1F0PA 1JMYA 1IUNA 4AN1A 4BE9A 4CCYA 5DLPA 2OPHA 2WIGA 1MX9A 3Q8WA 2ZYRA 4NMWA 3V1MA 2QTBA 3OURA 1MPXA 1UKBA 3MUNA 1PV1A 4O08A 1CUAA 3FNBA 2HFJA 4U2DA 4DNQA 1U2EA 1CUZA 1RYYA 1BCSA 1SCQA 5BWBA 3A6ZA 3DS8A 3DDUA 4INZA 3NGMA 3HACA 3EQ9A 4XJVA 4B80A 1X70A 4OD0A 4BCCA 3ZI7A 3EQ7A 3ZV7A 3AFIA 3D5EA 4OU5A 4PSDA 4Q34A 3ZPXA 3IB3A 2PPLA 4KRYA 1H23A 1VOTA 2B9VA 2FJPA 1CUYA 1UXOA 4P92A 3H1AA 4FTWA 3STTA 5I7UA 1CFJA 4H7EA 3UMJA 1UZAA 1XRMA 4ZXFA 1UKAA 1FSSA 1GZ7A 3TEJA 3I2JA 1K63A 1AC5A 3H2JA 2WG0A 3OTQA 3PE6A 4ROTA 2Z5GA 3DJYA 5AI4A 3RM3A 3ZLUA 1XZKA 2B61A 3NUZA 2HRRA 4B0PA 5HK9A 1JU4A 1NU6A 1YASA 5E4JA 4PSUA 2QR5A 1GPKA 2V98A 2V97A 3G02A 1YS1X 5K3AA 2XI4A 1CUWA 2WHRA 4QLOA 5A7FA 3A70A 3QVMA 3IUMA 3O4IA 4BVJA 2WG1A 3I1IA 1QIDA 1ZD4A 2XUGA 4G8CA 4UFNA 3OOSA 4KJXA 2XUHA 2HADA 4CIBA 3I2GA 4FOLA 2DR0A 3OG9A 2WUDA 2CKMA 3D59A 4H7HA 4J0IA 1GPLA 1DWOA 1QTRA 4UHDA 3ANTA 1E8MA 2PSEA 5AK5A 1W1IA 5CMLA 2RGUA 5HF9A 3C6BA 4Y7DA 2Y2UA 5AO9A 3G9XA 4C87A 4C01A 2XB6A 5AKGA 3RKSA 4AO6A 2HFKA 5CH5A 4W1QA 1ACJA 3R3YA 4FBLA 5JD5A 1XQYA 3F8SA 4BE4A 2BGRA 5HF6A 1EA5A 2HU7A 2OCGA 4KACA 5I8PA 4G9EA 3R0VA 4U2EA 1BE0A 2XUIA 5SYMA 2ACKA 1E89A 3G9ZA 5LP1A 3C6ZA 4LXIA 4FDMA 1AKNA 5HQ3A 3A2LA 2JF0A 5ALMA 2EDCA 2WLSA 4Y2UA 5FOQA 1ZGCA 4DMKA 2Y2VA 4DTCA 4DM7A 5ALGA 5IVKA 1R9MA 1CUDA 3M82A 5A7GA 2CUTA 2JEZA 3QMVA 5J3JA 5K3DA 1ETHA 2WIJA 1LPAB 5ALEA 4BATA 2J3QA 4DNOA 1DQZA 4W63A 5JAHA 1XZLA 3L1JA 2V9ZA 3H2GA 4QNNA 3I2KA 4JYMA 4K6HA 2EDAA 1USWA 5AM0A 4BC1A 5AKYA 2HDWA 3NWOA 2I78A 1JMKC 3M83A 2HA5A 4H18A 1ZIXA 1B41A 2XMBA 1TRHA 2K2QB 4WDRA 5AH0A 3HABA 5FLKA 5AKHA 1ZD5A 4G8DA 3BE8A 1ORVA 5CW2A 3WL5A 2WG2A 4FKBA 4FFVA 1Q84A 4C4ZA 1B6GA 4E15A 4F5ZA 3DKKA 4LIPD 2ZSHA 1YA4A 4BVKA 1XRPA 2H1IA 3WK9A 1VE7A 4CCYB 4EY8A 5AIAA 1DWPA 5H3HA 1XZFA 4G1FA 4HXEB 4QDUA 2GBFA 3KOOA 4DSZA 4Q3OA 1XLWA 2PUJA 1F0NA 3U0VA 5AK3A 2PU7A 4DMHA 1XQWA 2XMRA 3BDIA 1BEEA 4Q3LA 2UZ0A 4BDTA 3DL4A 1TIBA 2JGKA 5JZBA 3D3NA 5ALFA 2I3ZA 4KEAA 1XZHA 2QXUA 3SK0A 5JALA 3LIIA 4ZRDA 3HJUA 1YR2A 4P08A 1EDDA 4S0XA 5HKAA 2H7CA 1BRTA 4KAJA 3ESCA 1ZI9A 2J4FA 1EHYA 3FYUB 3WK7A 3SC2A 1KU6A 1WPXA 1CUEA 3DD5A 5DJ5A 5DYWA 1GKLA 2H7XA 2ZJ7A 2O2IA 2VAXA 1UT6A 4CG1A 2XUFA 1XRQA 5K3FB 5C8VA 1XZDA 4C4XA 2PU5A 4I4CA 5ALVA 3QMMA 4B7ZA 5EIHA 1WPRA 2VQ6A 1LPOA 1N5RA 1ORWA 2DHDA 2D5LA 3O95A 2QZPA 4MYSA 3WWCA 1ZGBA 1CEXA 2DHEA 5AOBA 3BIXA 3ILSA 4J03A 4LHEA 3FBWA 2ZJ6A 4MEAA 4BBZA 1MAAA 4G4IA 3I2FA 5CT9A 4GWLA 2C5GA 1DX6A 1YAJA 1Z68A 3MUOA 4C88A 1JI3A 3WKCA 4JNCA 3MGAA 3TJMA 2AJDA 4HRYA 1MNAA 3O4GA 3GROA 4X6XA 3W9UA 3VJMA 1E66A 5IVDA 4Q3KA 4DSAA 5FP0A 1BS9A 1R9NA 1QJ4A 4M0EA 1JJFA 3DQZA 3GBSA 1CQWA 4H7JA 1THTA 3V1LA 4CG3A 3CN7A 2AJLI 5ALWA 4FHZA 1MAHA 1MX1A 4BTVA 3DCNA 2X8BA 4B85A 2JGLA 4HZGA 5DTIA 4UUQA 4GECA 5A62A 1Y7IA 1QLWA 5BWCA 2JGFA 4P93A 3QH4A 3GELA 4OU4A 4BAZA 2H7YA 2DQYA 5CXUA 1CLEA 4H7IA 1ZI8A 1QIFA 3E1GA 3FSGA 1FFAA 3WK8A 5FDFA 1EVEA 4DIUA 2ES4A 3QPAA 3HLKA 3WZMA 3CCBA 1C7JA 1LGYA 2WFZA 5ALHA 4X95A 5CURA 4H7KA 3QITA 4GDMA 5AIBA 4MYDA 2WQZA 4OYYA 4WFIA 1LPNA 4K2AA 2DFPA 2OAGA 2G5PA 2HA7A 5CBKA 1ZICA 3D0KA 2CZQA 4X3CA 3DYVA 3PI6A 2OCIA 3SX4A 4AZ3A 4B84A 4H7DA 2YASA 3ZLTA 3O9VA 3BIWA 4FFWA 2QS9A 3A2MA 2PVSA 4YX9A 1BN7A 2ACEA 3AINA 2PM8A 3WL7A 5LYYA 4H0CA 1LPMA 5IVHA 2V96A 5DNWA 4K6KA 3AZQA
chains in the Genus database with same CATH superfamily
5B3AA 1ABEA 2J3DA 1I7PA 3OZUA 1Q77A 4DYHA 3AM1A 3GV0A 4O2RA 4CN8A 1IL0A 1THGA 1DL5A 1E7QA 4L5JA 4U6QA 4ETNA 4WADA 3C6KA 3E05A 3IYLW 3ZWQA 3LOQA 3LQQA 3LDUA 5EIBD 3F2VA 2RKBA 3NW9A 4QEZA 1DG9A 3K92A 3AUYA 3ST7A 3OQPA 4GEGA 1BS1A 1JDVA 3OIWA 3IHWA 1P2UA 5HA5A 2YWEA 3H1TA 4QFCA 5JTUA 4JGBA 2HA0A 2ZJYA 5KHOC 3LQYA 3MW8A 3G2HA 4CEJB 3ZWVA 3M4YA 5LCXA 1ZUD1 1W25A 4DDVA 1HDYA 4LDNA 4MPPA 4RK4A 5HUHA 3COJA 1LBEA 1PWZA 3O3CA 2YVQA 2O1XA 2P69A 1JYEA 2C29D 4NCAA 4A15A 1TQHA 1XVVA 2Q4TA 2VUIB 3IBTA 1PJRA 1QWSA 3HZOA 3VI3B 2X8JB 4KWTA 4DNXA 4UTVA 2M6SA 3RQIA 2Q1YA 2DQZA 4G0XA 4JBIA 4JQZA 4LZOA 5EP3A 4BZZA 5CX1B 1U9ZA 2EKBA 5AR1A 3BA1A 5H1YA 4YJ2F 4A8TA 3A7EA 3FMPB 1L1RA 5DGXA 2D74A 2DCMA 3PNLA 4R68A 4WZAB 3MGCA 1UKCA 4ZAZA 4D74A 1MV8A 1FXUA 1OWPA 1P2SA 3U1BA 3O8LA 3L41A 2IT1A 2Q62A 4RL4A 3NHUA 3VZRA 3L6DA 4Y2PA 1SA0B 2GZ1A 4I4NA 4E0BA 4YRBA 3NXSA 4ZCRA 3T4PA 3RAJA 5E7QA 2FZGA 2G36A 2V6IA 3CZQA 4PTYA 4QXQA 5BO5A 3NTOA 4DC9A 2B4RO 3HWSA 3DLHA 4P53A 2N9UA 1PQWA 1FFDA 1UAGA 3RYCA 1BD4A 4J43A 1G9XA 3BXOA 1H93A 1ZZEA 2AUTA 4HQ0A 5ADVA 2A30A 4FE3A 5E7MA 1NLUA 2BI4A 3DOJA 3CW8X 3HEBA 4IQFA 1GG2A 4TTPA 5BURA 5U1PA 4N7BA 4TPKA 4FBGA 3O26A 4Q18A 2HNBA 2VSOA 5IH3A 1JHZA 4KU4A 4ALLA 3UT5B 2V45A 3I9V1 1PJZA 1VM6A 2FW7A 2GTPA 3NVMB 1CERA 4YP6A 1JE1A 2UYYA 3WYEA 3KSUA 1GAJA 1CJTC 1TM7E 4DIMA 3BG5A 1WHSA 1KVQA 1V6CA 2RB4A 2VRWA 3H04A 1R6BX 3HXPA 2NACA 3Q88A 3U3ZA 3CWQA 3OE7D 3SQWA 3KHKA 1G6Q1 2VH2A 4EZEA 3L02A 1H3NA 1WOMA 5JBQA 3UV7A 3E9YA 5DULA 3SDSA 2GBGA 3G9TA 3NAMA 3TL3A 1N2XA 1EX9A 1OREA 1WZNA 1HH4A 3HBJA 4AS1A 3WBJA 4MA5A 2PLAA 4PHCA 3V2IA 4JBYA 1Z6PA 2HSEA 3F3YA 4HNVA 4DYVA 4D45A 5IF9A 3S1AB 4IZOA 3CVVA 4D3FA 1U2QA 1B16A 4POOA 3IOEA 1MW8X 3ILXA 5C53B 2C77A 1VE3A 5J63A 2J31A 1YJAA 3DFIA 5C1BA 3FSJX 4XQGA 5ARDA 5CLIA 5AKJA 3TSAA 1ONOA 1F8GA 1U9IA 5A7HA 4CI9A 4RUKA 4MQEB 4PHFA 3FPCA 5JV5A 3FGOA 1SO8A 2EBUA 4KFUA 2RBEA 4EY5A 1YZUA 4XQ0A 5H68A 2H1FA 2WINI 5I7SA 5EJMA 2GK4A 4Q1DA 1ZQ9A 3U31A 1OCEA 2RK6A 2OV6A 3O7MA 4LBYA 4C14A 4DCGA 1RE0A 3IP6A 1X86B 3AR6A 3IJ5A 4MH0R 1US8A 5EP4A 1GL6A 3RV4A 2O7VA 1KP2A 2JASA 2NO1A 1DRUA 2XCRB 1XRRA 1JG2A 1ESZA 1NW7A 1II0A 3ZDCA 1L9KA 1Y4UA 2AFIB 3HCOA 5CFZA 1U65A 3OU7A 3M4ZA 2QTHA 3H7IA 4WHMA 3BN3A 3EODA 1KXZA 3MWEA 3QXGA 2A5DA 4ZT6A 4RXTA 3UUFA 5IULC 3VJRA 3LXUX 4N9WA 4EPRA 1QYRA 5BT9A 3FUCA 1XTVA 2C8KA 3U62A 2DPMA 4EG7A 1GFIA 5AOAA 2YZGA 4LBVA 1KMCA 2VCYA 4CQMA 2WF8A 1XZGA 2QLMA 3DVSX 4RHEA 4FDTA 2YN0A 1IOZA 3LYAA 5KVVA 2I4LA 1QIEA 3OAAD 1HYQA 1XP8A 2WJWA 1K97A 2YVLA 1OGJA 4RJ2A 3IE1A 1NUAA 5CA1F 2GGSA 2VK1A 3PYXA 4RETA 3CZ5A 4FFLA 4WL0A 5TF0A 1CUGA 4E1BA 1RPZA 1UWCA 2B0JA 4FGZA 4P0TA 2QM7A 1ZU4A 2XT0A 3A3YA 4XH9B 5AOVA 2PKWA 2IEIA 2P9HA 2XYGA 5A2QA 2BN4A 1JEDA 2AN5A 2GWHA 2DYKA 1XXLA 3K15A 4CMHA 2XTZA 1ZD3A 3BOSA 3ECSA 4UREA 4B3DA 1PR1A 1EFHA 1QUFA 1TEHA 2WZBA 3GPDG 1CY0A 3ANYB 1HNXB 2MR6A 4NYJR 3RHZA 4XRGA 4O4IA 3OOHA 4HVTA 5FI0B 3WNBA 4NARA 1TEXA 1IVNA 1QFJA 1HDCA 1JPVA 1OXMA 1PR2A 2IY7A 4DLTA 4ZYTA 5LIPA 1G9TA 1K3UB 4BIMA 3UGKA 1MO5A 4DV0B 4UE2A 1Z6XA 2Q5HA 3OPXA 4FIDA 4WK4B 5JC1A 1YZFA 2LDBA 1II8A 2WJVA 4AJLA 5JQWA 1M5RA 4LZZA 1CF4A 1BDHA 3VTFA 1GFSA 2ORIA 4FYIA 2AJ8A 1O58A 3SJZA 3V7YA 4A10A 3DDWA 4BQIA 5BV2P 4G0ZA 1CDOA 3ET5A 4HPJB 4CEIB 1X0XA 5KVAA 3B1VA 3HJTA 4INAA 4C5BA 2IS2A 1U02A 4TSFA 2H9YA 3DOHA 1PTKA 3I6ZA 1EE1A 3ZHTA 3BD9A 4G2NA 4UUBA 4R1MA 4CKZA 4GF5A 4OGKA 1GNQA 4GM1A 4PW0A 4BFLA 5F9FA 2J1LA 4MWBA 2K7FA 2HXSA 2EQBA 4OF4A 4KCGA 5JRZA 4WA7A 4I1PA 4BMCA 1G20B 1XNQB 3FMIA 5HPYB 1NJFA 2LIVA 3L8DA 3R7BA 2P9BA 5IXJA 4Q9NA 2X1HA 5DHFA 4DCPA 3PEWA 1YKFA 2IYLD 2Y1FA 3M6VA 1VCIA 1T3TA 5HBGA 4JJGA 3CSDA 4UUMA 1A2BA 1KDVA 2X0IA 3GJ3A 2NZJA 5LQMA 1EQUA 3SKYA 2E48A 4BCDA 2V4MA 4DVGA 5AD1A 2Y68A 2Y9PB 2YZNA 4PZEA 4W5QA 3T7TA 1FYVA 4A26A 3IQHX 5BVHA 4A2WA 4BVFA 1OLSA 1QNFA 1TLLA 1AX9A 3PFCA 4NHEA 5TQVA 2EBWA 2BLNA 1X9HA 3LX4A 1YFJA 1XG5A 2PFKA 1E92A 3KHSA 4NZNA 5DWDA 2VDPB 2W2OA 1TAHA 1C7ZA 1CS0B 1A5AB 4R05A 4X63A 2C2YA 1UBSB 1ZW6A 4TKUB 5F1PA 3U1VA 4BV8A 4LPSA 3T7DA 1Q0QA 1RKQA 3P5SA 2H2IA 1AURA 4AG3A 3D3WB 4Y2TA 2WJGA 1EVLA 2BM9A 3F6CA 1S2DA 4OUDB 2OGTA 1HLDA 1UEIA 3DYIA 3CHYA 2X9GA 1A27A 5B4VA 4QXAA 4MPDA 4FDUA 2O3TA 9MHTA 1IY0A 3SYNA 1IB0A 3WL4A 3ZVNA 4UM9B 2JVJA 1YNSA 1IRIA 1W581 2XUDA 4HB0A 2ZS9A 3B7GA 1HXHA 1BJTA 1OIWA 1V47A 2QE7D 3BWCA 4DG9A 3DVLA 1E9CA 2W90A 3S5JA 1K66A 1Q20A 3BF7A 4CIWA 3PCTA 3PEFA 2HPAA 1DEOA 2YUIA 3QG1A 3PIRA 1ZK3A 2WF9A 4OHCA 5LQKA 1H2ZA 5EJGA 4JLOA 4MS1B 3KTAA 3UYLA 1P5HA 3EPRA 3U2QA 1ISHA 2JD2A 5EJ2A 4IRMA 2W70A 4MVJE 3FVQA 3H5VA 4ND4A 2HPVA 3F4KA 3T99A 2PBZA 5T8KA 3TWOA 3OO1A 1JDNA 3ECCA 2WM3A 2P4HX 2QX9A 3H87A 1KVTA 3AETB 4QL3A 1KC1A 1KU0A 4OQLA 5FI1B 2FSUA 1Y1QA 2FYTA 2CV0A 1VL0A 4HDCA 2VBGA 4CM5A 4LF7B 3G5UA 3LPAA 4ND7A 4ZHQA 5AUPB 4IBOA 5CJPA 2FE4A 1SUCA 3DV0B 1NNEA 3KWMA 5JZOA 1R9JA 4BMPB 4EO7A 2ZR9A 3GJ6A 2GDJA 1XMQB 4PO9A 3KDPA 4RHFA 2BFEA 3FYTA 4MS3A 2RH5A 1LDGA 1VJDA 3N2KB 4MUYA 3GUCA 4CLEA 2V7QA 2O1SA 2QTMA 3ANSA 2VZ8A 2YZMA 4IRUB 3NV7A 3MT8A 2ZM5A 1L1QA 1L4MA 2BE9A 2BHTA 4FEYA 1XTKA 4YV2A 1Q57A 4B6OA 4X93A 2Z6VA 4O63O 4F84A 4M0LA 3NBZC 3D3EA 1W94A 4B2PA 3LBHA 2Z98A 4YAOA 1W96A 1YB6A 1PR6A 1YZKA 5C34B 3RIHA 5ICFA 4FFBA 3VRHA 2FZCA 2PZMA 4HAZA 1KAOA 2IYEA 3A36A 4JJ8A 4M38A 4MB2A 1X3SA 1JR4A 1Y3CE 2JDID 1U9JA 1T8TA 4R2JA 3VZCA 3WBFA 5FWXB 3ZJVA 4B3RB 1RWVA 2NO9A 3WLSA 1ZMTA 1R0WA 3ORFA 1D0SA 2G82A 3GEPA 5JCPA 4ZEXA 1OH7A 1C8BA 1GU7A 2HRDA 2Q7OE 4ENTA 2X4GA 3AESA 3K0CC 4RNCA 4C0QC 4CE6A 5KYXA 3SZMA 1GCIA 3T1QA 1Q22A 3L0SA 2RSLA 2CLCX 4KVGA 3RRXA 3WMXA 4MWZA 3TIVA 2B20A 4HQRA 3WGTA 2IPLA 3FYUA 2BKVA 2ZBRA 2F4VB 5D3KA 1P2DA 5EYPB 3SFZA 3IRUA 1F8UA 2C3PA 3E0XA 3R74A 2ZG6A 3PF9A 3K1AA 4NZ9A 1LWOA 2G6TA 1MO4A 1MJNA 1KF0A 2PT7A 4HAOA 1G4UR 4UM5A 3SE7A 2WWFA 3UQYS 1QTIA 1QZXA 1G5RA 4CLDA 1T3SA 1ULBA 3FHJA 3HGTA 4YV1A 3NOVA 4ZCLA 1NMZA 4JEHA 4PAOA 1CVRA 1E0SA 2R86A 2WILA 3AQ4A 1LJLA 2JFBA 3GA0A 3RRMA 1F2DA 4EEKA 1GQ2A 1S4MA 1XMOB 3JR3A 1XPOA 3LPCA 3UJDA 2HK6A 4MHOA 3RSCA 3DE0X 4EBFA 3KYBA 4N8EA 4W9NA 1W4ZA 1Q44A 4EWLA 1XJCA 2HHJA 3N8IA 1XYYA 4IJMA 2BBWA 1YE3A 5EHQA 4J2OA 3FUXA 4WE3A 3R5XA 1P1IA 4ZZ0A 2GZ2A 1RYZA 2Q2QA 4B3HA 4QTXA 4U6SA 1R2QA 1RLJA 4JZYA 4BWYA 3AFGA 3LS2A 2V6BA 3JD3A 3RUPA 3UT5A 4M8KA 2BFWA 1DIRA 3DZFA 4F2GA 1F7VA 1W44A 2I4OA 2LBPA 3E18A 2O7SA 4REQB 2RBKA 3JY6A 3NKLA 4NCNA 4UE6A 1DC3A 3N3BC 1OSNA 3RRBA 4MRVA 4RELA 3QKIA 4WN9B 2R96A 2WWRA 5LZ8A 5U4XA 1N5DA 1SEVA 2MDTA 2EZ4A 3J7TA 1DC7A 4KB5A 5FT9A 1PWYE 1FYWA 2W5UA 2JI7A 4RVDA 3QQ5A 2VYND 1VHLA 2ZUUA 3IT3A 3QNUA 1SA0A 4QJ5A 5HFJA 3UWOA 4WZBB 4D0SA 5FX2A 2HA3A 2Q45A 4F5DA 1PNQA 3C5EA 4J16C 1TT5B 4L02A 3IBFA 5AJTA 3TLKA 3WRYC 1OC4A 1VYTA 6YASA 4BNGA 3IIJA 3C6MA 4XUDA 5E3HA 5KWSA 2YFHA 3EF0A 4MP6A 2P2GA 4DILA 1BROA 2HMWA 1QAOA 4DG5A 1ID1A 1L7RA 4IIUA 5K8LA 2GK6A 3V9PA 5JANA 2V9CA 2EARA 4H1HA 4O4LB 5JCOC 2O8BA 1BMQA 1BS2A 2FG6C 5CD9A 3R9WA 1E5TA 1LXCA 4Q03A 1XTQA 3R5TA 4KAFA 2TMGA 3DGFC 3AR7A 3CRMA 3IODA 4NP6A 3EN0A 4HZIA 4LSGA 4TS9A 4ZO7A 4EGSA 4FB4A 4DRZA 3JQ9A 1X1SA 2GEBA 2B1QA 1EVQA 2VKQA 2PUHA 2X1MA 2X0NA 4I1OA 4B7UA 4DRXA 1XD9A 1ISFA 2F1IA 1KIFA 4TLBA 5KPDA 5CIWA 5DM1A 1M72A 1GV0A 2VBCA 3OH8A 3QQPA 3MELA 3THRA 3JCZA 5FTJA 2ZJ1A 1YS4A 2GKGA 5J4HA 1IY8A 4B6FA 4PY2A 4R9RA 2IZZA 1XEXB 4G9BA 3LKBA 3B3FA 4YJFA 4LNAA 4NEHB 2REOA 3JQGA 4BMVA 5CCBA 3INNA 3U3DA 4N3AA 3SAJA 3F3SA 2EG9A 2BTQA 4R0VA 2QAIA 4W1PA 5EAIA 3HSSA 2M32A 1JQAA 3ZY4A 1WE2A 1U8EA 3K20A 1HRDA 3NH9A 5TT0A 1LSSA 2LD4A 2C95A 4YDQA 4YCBA 2PG3A 4XVCA 2QI9C 3U44A 1JKXA 3L7OA 1CRQA 1IWBB 1T6YA 1CZLA 2A0WA 2JZCA 1JJBA 1SB9A 1YDGA 2A0KA 2P6PA 4MV6A 1MEJA 4B43A 4HNUA 1UPAA 3NP9A 5FO1A 1WZIA 1NDHA 1FNMA 1VPWA 3IKTA 2Y27A 3RC3A 1EUDB 2FPWA 4MVJM 4RKWA 3M9WA 1LWNA 2WV9A 2GHQA 3EBLA 4A6DA 1GA1A 1QGED 1S8NA 5CB0A 1VB3A 5KJFA 4R5MA 1CFZA 2QSYA 3EXEA 3ENVA 3PS9A 2JRLA 2GSWA 3DV2A 3QHAA 4BB0A 3SWWA 5IUJC 3SBOA 5J9FA 3V33A 1GL7A 1X1QA 4OMDA 1P33A 1RWBA 3BE4A 1L7PA 1E4EB 5GZ1A 2HT1A 3D2BA 3L7BA 3BICA 5SY9A 3X1XA 4ZT7A 4NAHA 4BO6A 1X14A 1OFVA 1E6KA 3DFMA 1GQSA 1NUSA 1Z74A 3WIBA 5BSVA 2JCVA 2C9ZA 1R6DA 2AR0A 4D43A 2BFFA 2ZI5A 1XE3A 5KVSA 4NBUA 1PG2A 1P9RA 1RVV1 2I4TA 2VJKA 3KYDB 3D0RA 4MA4A 5COAA 5BYBA 1IEVA 3SM3A 5L7YA 3S99A 3A28A 3OEWA 1PR9A 2QRKA 5DCUA 4EYOA 1YFZA 2BKAA 3SQOA 1H05A 1GV1A 1WVMA 4OQYA 4FMPA 3HL0A 3VH4A 3HHPA 4YFYA 2QHXA 1WQ1R 4C0SA 2XXAB 1HOTA 4DFDA 5CYPA 2WTXA 4LJ6A 4MW4A 2TS1A 3KOYA 4U2CA 1MC4A 5JPIA 1XROA 3PNPA 1G3RA 1XOIA 2EIHA 5EJEA 1AMNA 3QBEA 1GN8A 1N2ZA 3GRKA 5H81A 3RVBA 3WO0A 3VSCA 3W06A 5A4KA 1G38A 2C2WA 3F6EX 5JD4A 2ZW9A 5LLTA 5LQNA 1FXWA 1U5BA 2DBQA 1KORA 1SU7A 2D7CA 4J91A 4XA8A 4F5YA 4JQOA 5EVJA 3BIJA 3FIJA 3WO1A 1XI2A 3GCXA 2QN6A 4LW8A 4HDKA 1B6RA 1ZNQO 1BYUA 2X7HA 4Y8VA 1B0AA 4KUEA 2ZIFA 4TT8A 5EJ5A 2H00A 4U63A 4ZI7F 1M9NA 2Z43A 3OWHA 3OX4A 1UH5A 4MUKA 3OC6A 1FLDA 4UPDA 1CUBA 2RGEA 4FXOA 1P5ZB 1XD2B 4K7JA 2D2VA 1NQAO 2AF3C 4NY1A 2D1TA 1L7BA 2FFQA 1ZBDA 2XOXA 3MJEA 1KYIA 1POWA 2JFHA 3ZJ5A 3NU1A 5TJ9A 4XXHA 2BHLA 2WYIA 3QX7A 3V9AA 4XYLA 1XHEA 3AUAA 3L8CA 5E6UB 3CLTD 5IAGA 3PRJA 4N0QA 3A6GA 1Z2OX 3FLMA 2GESA 3FDZA 3K4QA 4YYZA 1MNQA 3CUWA 1ECPA 1MVNA 1VKOA 1BD3A 1TVMA 4IG9A 5LXTB 3SLRA 4AJNA 1V8OA 2P9EA 4PV7A 1G7RA 1D7AA 1EP9A 2ZRJA 2H0QA 1F0KA 2CDAA 3O2JA 3C14C 4HXGA 4LKOA 2ZT7A 2X0DA 3IBYA 4BP3A 1O7JA 2H52A 1TM5E 2V58A 2W2TA 4XR4A 5DCLA 2I1LA 5TJHA 3ROMA 3OIYA 2XCSB 5K0FA 2V5UA 5KTMA 1Q0LA 4XCVA 5CLGA 2PLFA 5JEDA 2XDQA 4DARA 2QORA 3K1AB 1PKXA 2CEAA 1RQLA 4PZUA 1W75A 1JJ7A 2ZB7A 5HFAA 4OLHA 4LISA 5M34A 2B78A 1T3HA 3OO0A 4FFRA 1Z29A 1PJSA 4AQ7A 3THWB 2I62A 1J25A 3AUFA 4RCVA 1OLUA 4HXYA 3R6TA 4LVNA 3ZWKA 1SKBA 3NT2A 1QZ3A 4HNAB 4I4LA 4A5OA 1G5QA 2P68A 1A82A 1L5FA 1N7JA 2FLKA 2B92A 2Q9UA 3L06A 3MVEA 4BIIA 5LQRA 4NENA 3UAYA 3MS4A 4NNPA 2JB9A 4R8KA 4JYAB 4KGVA 4GOJA 1WXFA 1IC6A 3EQ2A 5CTJA 3TZHA 1O89A 3CIOA 2O9JA 4MEBA 1VMKA 3WGMA 4RY8A 1HT1E 3I04A 2J9RA 4R8MA 1GDTA 1IJKA 2VEOA 1O57A 2XBUA 3PDCA 4UU0A 5L4SA 1KK1A 3PE4A 1T24A 1NFFA 2P1ZA 1O8BA 1Y8QB 1A50B 1RLUA 5AVQA 3MWGA 4OJMX 2V6MA 3KQWA 2IS4A 3B3QA 3LY5A 4KXQA 1YDHA 2IOYA 2YXBA 3NHRA 2XQIA 3WFIA 1X7DA 2H4HA 1TK9A 3KLPX 3ZDZB 3LT5A 3G68A 4JR2A 1RLMA 1ADFA 1LK5A 3ANMA 3VVCA 4ESHA 2X0RA 5IPFA 5HG0A 1PJ4A 3PQ7A 4OQMA 1E18A 2BGIA 5DP2A 1UBOS 1ZQ1A 4DSUA 4EW2A 2DTDA 4EY7A 2CNDA 3EXEB 4A6PA 1CD5A 1E1RD 1F1JA 2JW5A 2W6PA 4MVWA 4TSFD 5DSTA 2ZR7A 2NUTB 3PX3A 3C7DB 3X2EA 1K5DA 1NQXA 5AKLA 4Y2QA 4HG2A 2HJ9A 5AW4A 5LLDA 2X22A 4HAVA 2ZJ5A 4CMEC 1RYBA 2JGEA 3L5KA 2XOKA 5JVDB 2XTAA 5AVUA 5HM8A 2VZLA 2XZLA 4B4KA 3BXFA 1M1NA 1V8BA 4AYWA 5ALUA 5EJ9A 1QH1B 2XR1A 2ZRCA 1L5NA 2MSNA 5IWAB 1MZVA 4BFWA 4L4SA 1YJ8A 1Y5NA 2JAWA 2ZRNA 4NPHA 5FOTA 3I8OA 1Y42X 1W5AA 1T6XA 2X8WA 3LKZA 1U0NA 5H7XA 5JR3A 2XSZD 1B76A 1AV6A 4IDEA 3D7NA 3HJCA 3Q2OA 4BY9E 4NCXA 3G1TA 1IG0A 4IIEA 3TB4A 4J1TA 5BVGB 3D5TA 3F1LA 3WKEA 1LBHA 1UQRA 5JZVA 1FE8A 4L76A 4DY4A 2MOKA 1EVKA 3EIHA 1O95D 4HX5A 3EDCA 1IN1A 1IN5A 2VAMA 4NFYA 1IWPB 1NKSA 2P4QA 1Q95A 1XR3A 2A5GA 4ML3A 2JLXA 3WGVA 1W0KA 4QRHA 3AFOA 4ENVA 2WM9B 2PT5A 4OHWA 3RU9A 2ONYA 3JQCA 3OZWA 2QTLA 1DC8A 3JD4A 3PF8A 1IY9A 3FAKA 2B1RA 3W2GA 1XDSA 3HKBA 1XQ9A 5HKLA 1DAKA 2O50A 2M6KA 2JIBA 1Y4ZA 3WBKA 5B53A 5JPDA 1QE3A 4G0PA 5KYUB 5IFKA 2C54A 1CZOA 2FOIA 1JWBB 3CRQA 3L7JA 1RRKA 1M2VA 1HEUA 1IU9A 1P29A 1UJBA 1PUIA 2AJTA 2OO7A 2RJOA 3MT7A 5FI5A 2ICAA 4MIYA 3LKDA 3O9ZA 1E32A 4MR9B 3PFWO 4NXMB 1K4YA 2YQZA 2ZITA 3AL3A 3JZDA 3LVFO 3PR3A 3R3JA 3DMTA 2R1ZA 5BSEA 1P6QA 5E2BA 1IBCA 3RYCB 4AO7A 1PFVA 3HEMA 4WOKA 3CWZA 5L3RA 1G9SA 1WUJS 4TV9B 3BJIC 4PG4A 3TG8A 4OOEA 2Q50A 1JH8A 4AMBA 4R9UC 3KOXA 5FNZA 5KWIA 2A5FA 4S1OA 2IYYA 4ISBA 1D4AA 1CJSA 3PHBE 2D0PB 4O4JB 1U8AA 2GM3A 1IM2A 3N0RA 4ND6A 3E70C 4TRMA 4GLBA 4TYQA 3K72B 4Q4LA 1KOLA 1WW3A 4WESB 2YTZA 3RTCA 3UATA 1UAYA 1TUEA 1E79D 2C2HA 3ESAA 4KQIA 2HH9A 2IYUA 3KSBC 1CU1A 2AE1A 2G04A 3A6LA 2V4UA 1Y7LA 4QEKA 4ARAA 4BJ6A 5F98A 2OXEA 3EZ6A 3PYMA 2BI7A 1XDUA 4KHPB 3SC4A 4XM2A 2H85A 1VBKA 1VLVA 5LM3A 4MICA 5JAMA 2CYBA 3T3DA 1O6GA 1RWWA 2PR7A 1GTJ1 1LVUA 2RGAA 4KVAA 4O5AA 4RY2A 5TMPA 3GNQA 5FLXA 1LI4A 1P74A 4PM4A 5D6NA 3MCUA 3X43A 3K6SA 4MPRA 1KRXA 1ZRHA 2B6NA 3B36A 2R5WA 4ALJA 2ANCA 3M49A 4JR1A 3IHLA 5HKKD 3G0BA 5KYNA 3O90A 1SCAA 2VXOA 5FLYA 2JARA 4B3IA 4FGLA 2QIPA 3SN6A 2Q5CA 2BSQA 2HK9A 3RB8A 4QWMA 2Z2JA 2WAAA 1RZVA 2F3RA 1YR1A 3NBAA 4JNKA 1VSQA 4DXHA 5L95A 1ICIA 1HQDA 4H6WA 3WGIA 7REQB 3TPZA 2IWHA 3OE7A 5FL7D 3ZHCA 1HM5A 3ASYA 2VTKA 2R1TA 1GT91 2ON6A 3B8HA 1XBTA 5LKAA 2VJAA 3NNDA 1ONSA 3DL0A 3BAZA 5CIQA 4CV0A 2CY0A 1MRZA 2VWQA 1VGVA 4EI8A 4EYEA 1E1CA 4HQFA 4JUDX 2NZ2A 4RK7A 5AJXA 1N0UA 1IQRA 3TJRA 2QF7A 3W9BA 4DCSA 4F38A 3M4NA 5JUWA 1GN9A 2QUHA 4BMXA 3GARA 5I5EA 5FL3A 1HDGO 4IVNA 3WMFA 4EKIA 1RE1A 3IAFA 3PE3A 4F92B 1VSBA 2UYOA 5HIKA 4CQNA 3LW7A 3MTEA 3PGMA 4MCJA 4NYJQ 5T4HA 3GZNA 1PR4A 2BR4A 1NLZA 3R0XA 5AFSA 3PEEA 4KMOA 4JYZA 3SYRA 1FYXA 2ZXUA 1QHHA 3UUEA 5HQ3B 2DCUA 3G59A 4RKYA 1KEVA 3T1VA 3BKWA 3I9NA 3TZBA 2XE7A 2B69A 4X41A 3VKHA 2AXNA 5DGIA 1MGOA 1QIGA 3D54D 4DZZA 3ZHRA 3ND8A 3BWXA 2BPOA 4ZAXA 3EXAA 1SKMA 3TQSA 1ZH4A 3P2KA 1IATA 1FFHA 1KJJA 1M6VA 1M54A 2DJ5A 3ZI4A 1VLZA 2HN9A 3NWPA 3TIXB 2CDBA 2PV0A 3WA7A 1OAKA 3EAQA 1L4NA 3I6BA 4X1YB 2IOHA 3ZE0B 4XPIA 4UEWA 5AUOB 4WK2B 3MQFA 1B23P 2DC1A 3K9BA 3GNTA 3ZH2A 1J9ZA 1TECE 1M34A 2JAXA 4MO9A 4UBMA 1X9GA 3DKRA 4L5IA 3WWZA 4B82A 4ZJUA 1JE0A 4D9FA 2FI1A 1CV2A 2CJYA 1SD2A 2OM2A 3EBOA 3SKXA 2H2HA 1CPYA 4KWEA 4LQ4A 4R3UC 4JCCA 4JLVA 4LE2A 1N75A 3TSOA 3D2CA 4A2CA 1Y4DE 5KNDH 1XLTC 1FNNA 5B58T 2RHCA 3AUUA 4WOBA 1QK4A 2VPQA 3R0QA 4MJ3A 4TYNA 4RHTA 5DLEA 5KMGA 3MK31 4H3HB 5J58A 5LA6F 1M8PA 1AS2A 1EIZA 4FNMA 1ORIA 1NE7A 3BD7A 3IDSA 3SJUA 3FXAA 4Y7CA 5EWLA 1D2CA 1KI8A 4QQFA 4QX6A 4MKGA 3EXHA 5FUYA 1H2YA 3M2PA 4MQFB 5AXDA 5I45A 2PWZA 3JWJA 4FONA 1R8SA 1NN1A 2E18A 1QB7A 4X1KA 3TOSA 1Q1BA 3RC9A 2H2AA 1K7FB 2ZT8A 2JFVA 4XSHA 5K0BA 4FMDF 1XD2A 4DBLC 2R8RA 3REFA 4FWIB 2VG8A 4FCVA 4LNUB 3U4HA 4X62B 2EQ5A 3CBQA 1ND5A 1XELA 2ZCUA 3I2IA 3IAM6 2LDXA 4G65A 5L3SA 2XGJA 1H1LA 1X80B 1H1DA 1A2OA 3F71A 4JL8A 3VMMA 1Q5PA 4OGWA 3ZUPA 1L7VC 1LZKA 1P4SA 1GZSA 4R8RA 5DHPA 2G9ZA 4P2GA 4NS1A 2HMYB 1YO6A 2DTEA 1IZZA 4D6YA 4BNTA 5AI0A 1T9BA 2E4UA 4S35A 3A1EA 4C4PA 4N40A 1TFRA 4EA9A 3ZJTA 2EQAA 1S2LA 4MUMA 1PJQA 1OLOA 4HO1X 3K9FC 4G0UA 2PGJA 3TDMA 3DBRA 1RP1A 4ILKA 4JHXA 2ODEA 1TQ8A 4XJXA 4CEHA 4KUHA 5K20A 1BWRA 1SC9A 1TTQB 4O4JF 3V7WA 3IMFA 4EB8A 3PC8C 1OILA 3KKMA 4WV3A 1QORA 3ZDRA 5JHGB 3FN4A 1Q83A 1QPBA 1ZWKA 3Q2IA 5ALYA 5F2OA 5J2UB 2OORC 3B6EA 3RDPA 1ULZA 4K2HA 3SFTA 2QJRA 4IHAA 1P5RA 4S05A 4YQEA 3IP7A 4BNZA 1U0JA 2QX7A 4L0CA 2WZDA 3N8GA 4DNPA 2Q07A 1UXKA 1W35A 2BTOA 1XTJA 3NCHA 3OECA 3VR5A 4UASA 2WYUA 5FFMA 2C3UA 2IEGA 3I1JA 5TMBA 2NQ2C 2G67A 5BV0A 5MFPA 3R20A 3ER9A 1KFKB 1NG9A 3GFVA 1W36D 2HIHA 2CFSA 5CYGA 2B5VA 2P7HA 3DCIA 1OY1A 3IHTA 1U0GA 2BELA 2HU5A 3LA8A 4UEQA 5H0IA 1C7FA 1X7ZB 4QDZA 3TBFA 4B48A 4D6XA 4RHUA 4YWHA 3SE0A 3ZCVA 3K09C 4NJEB 3PQ3A 2O0HA 2FRDA 4FFOA 1O6FA 5CAEA 2QQEA 3H2YA 1RQRA 3ZQJA 3NC4A 4HCJA 2ZZMA 4C7OB 3SVLA 2QTGA 4W8HA 4ZV9A 2L42A 4PEVA 2LV8A 3WMRA 3HJNA 4YCCA 3Q7QA 3HR4A 2J9FB 3ZKWA 1U5AA 1N5MA 2NO4A 1NW4A 2AQHA 3VI4B 1L3BA 2XBMA 3EGCA 1VA5A 5IVIA 1R00A 1DBQA 2CN1A 2DKNA 3BFKA 1RAAA 2DFLA 4OQDA 4RV4A 4AMGA 1VG1A 1XF1A 2XYPA 2Y8EA 1U1CA 1V5EA 2QZSA 4FOPA 4U1RA 3H5NA 2C9MA 1PYOA 4GC5A 4M22A 4Q4HB 2A1UB 3A4NA 3AZOA 5CAEB 2H0RA 2OLEA 1JEQB 2QXTA 3HZHA 1AQLA 3PXBA 5CVDA 3WYAA 1XUOA 3ZD9A 2HNAA 1Y34E 3DNFA 2J32A 3FY4A 3QVJA 4JFAA 4MPJA 2H48A 3PK0A 2QVGA 4U7GA 3IV6A 3W05A 4JX8A 3U09A 2W98A 4MS1A 4W5WA 4UARA 4ADSG 1C9YA 2QUZA 3CB2A 1T4BA 4MUNA 1D1QA 3EIWA 4I14A 1GPUA 3QKRB 4Q3NA 1VE5A 3GF4A 4HUQB 4ZD6A 5BR4A 5KKAA 1L7OA 4LSZA 3SHQA 2IUYA 2Z58A 3QV1A 3NO4A 4WASA 1FMTA 4Y1RA 1EK6A 2A5LA 2QP9X 3EUAA 5EXPA 3ZLJA 1EVYA 4QNMA 4YPVA 2XVAA 3ETJA 4F2PA 3TL6A 1FRVA 2UKDA 1Z73A 4F8JA 5HRCA 5L4NA 5K3FA 5IS2A 4W5TA 2DWQA 4QBKA 2FPGB 3RREA 3VNQA 1UMDA 1DMRA 3EG5A 4DIEA 1N2HA 3GEHA 5HJEA 2F8MA 2UYGA 1H3FA 4JR0A 1BOOA 2GS9A 2IDMA 2R25B 2XNCA 3QU5A 5BSMA 3TGWA 3LJKA 3I1FA 3W6OA 4BFXA 2H8KA 4XWWA 2ZR8A 1G6OA 2E4ZA 3VZSA 5I51A 121PA 1AXRA 2RCNA 1ZBQA 3EZ9A 3QW2A 4QOFA 3VUFA 1I80A 1AU9A 3WFZA 2QB5A 3BD6A 3FRIA 3D1LA 4U0JA 3FB1A 4QOIA 3PXXA 3TZEA 1KIMA 1E8DA 3F9CA 2BUBA 3W2IA 3QPDA 3GO4A 1Z3CA 2C03A 3LRPA 4Z99A 4JP2A 4XSVA 2Q6VA 4KR2A 5FA8A 1HDOA 2YJZA 3UGQA 1LDEA 3AHIA 4MR9A 5E38A 3RO7A 4D3XA 5JRJA 4OXXA 3LA6A 3CXUA 3L8ZA 4TVBA 4JXJA 3JTMA 1H6CA 2GI4A 2VJOA 2PV7A 3FFTA 3RYHA 3VSEA 1QGDA 2HYDA 3WLPA 3EIXA 4G37A 5CHYA 4NZYA 3NDBB 4KVZA 4AQDA 1X7XB 2IV2X 4X90A 5A0TA 4MVJA 2VJYA 3IT1A 1MUUA 2BMAA 4ZGGA 1CP2A 4UNPA 2FFAA 1E2PA 2GCOB 2FN9A 5E7JA 1R6VA 5AVYA 3WISA 2HAEA 1N2IA 3AC0A 2HK8A 2PUDA 4EJ6A 3HDTA 1O8CA 2EJWA 1SKYB 2C5FA 2IX3A 1G8FA 3W7AA 2XMCA 4NPAA 4BQEA 3T12A 3MWKA 2VHTA 2RHTA 2WAYA 2X8LA 3AUKA 4J75A 4LMPA 2XWQA 1HRKA 4O59O 4B35A 4TSKA 2AX4A 3PJDA 4OOFA 4H2DA 1T4MA 2QMQA 1VYUA 4PR3A 3TZKA 3ZDEA 2QNIA 3DYBA 4DY6A 4HWGA 4PG6A 2PRJA 1CEQA 1A9TA 1RFGE 2YHIB 3BMXA 2ZI9A 3GPCA 1FVHA 4WK6A 5CVVA 1HLFA 2PYZA 4X1IB 3O0DA 3UOGA 2ABWA 3C5WP 5LDHA 1W1WA 2IPXA 1MRSA 2PCLA 2R6AA 4BNJA 4BB5A 3CB4A 4TV9A 2DX7A 4EB0A 3URKA 3OFNA 2EERA 4PO8A 3MXOA 4NAUA 3ESYA 1CDEA 2NTYC 1HE1C 1DXHA 2BEKA 1Z4OA 5JNUA 2R7KA 3PGJA 1A5BB 5CEEA 1C80A 3TN7A 3AM5A 3CZMA 3K5IA 4G26A 1SBCA 2P9JA 1FSZA 2HM7A 1CQZA 3DR5A 4MW6A 3WGOA 5HCUA 1OD6A 4ES6A 5KYUA 3L92A 1I10A 2AFHE 5EERA 4MZXA 4CQMB 1Y3AA 2F1OA 2VA9A 3LU1A 3FF4A 4HGQA 1UCFA 1E2GA 2VWHA 2EU8A 1W2WB 3EIEA 2R4UA 3GUVA 3ACCA 4FSHA 4L73A 4YRZA 1PK9A 4FFBB 1IMJA 1SWWA 1NKTA 1A9YA 1K9VF 2QN1A 4B3JA 3IH5A 4ZMRA 2HMSA 1CS4C 2NIPA 4X92A 3MTAA 2O3RA 3WC4A 5F21A 4GXQA 3E81A 2PJDA 2PX4A 3EC1A 4PFSA 1ZSNA 3HU2A 5FV7A 2VUSA 4WA8A 3PFFA 1UBNA 3O4RA 2R48A 1L4GA 1U7DA 4J07A 4PTLA 5GM2A 3FWYA 1C3XA 1XSEA 4CHGA 3QXJA 2HZBA 1DAEA 3GRYA 4H1TA 3UN1A 5CFOA 4FCWA 1HT2E 1SBQA 2JPDA 4EJSB 4EL0A 2QE6A 3NJ4A 3N2EA 1JBQA 1RXUA 4EX6A 3U6BA 5KKCA 4ZYYA 5IJWA 4KNWA 3IBCA 4LOLA 4BNMA 1DQYA 1M7HA 2PWBA 4CL8A 4JDPA 3L6RA 1DAOA 4RVUA 3ZHZA 4E5VA 4EEZA 3DTVB 3R8CA 3I83A 5CCEA 5ED4A 4YP1A 1ONPA 3KNZA 2YDXA 3LRXA 4UVGA 2I6FA 4MRMB 2BFMA 4TL9A 1NR5A 3CJQA 3SU8A 1EKXA 2WQ7A 4LF4B 4NRDA 2PKCA 4L7QA 2I1VB 3NZEA 4BRZA 3OJEA 4YMUA 5KNCA 3V1NA 5CLQA 4JXZA 4R1SA 2R5NA 4R9VA 3T7CA 3TLMA 2QD5A 3G23A 2C94A 4F9FA 2B30A 1TVEA 3R1IA 4X65B 5E6UA 4OLJA 4GQAA 1PDOA 1UMKA 3K9WA 1JLSA 1GZ4A 1UJNA 2AEEA 2EF0A 2G0NA 2ZSUA 1KH3A 4IIBA 5DX8A 1SRQA 4G4JA 4MUJA 1FFXB 3PZBA 5LWHA 5FUBA 1L7EA 3CTMA 1E9SA 2KX7A 2G77B 4L4UA 3NOQA 1PGJA 3T52A 1W76A 1G8JA 3D4PA 3MTJA 2X42A 2BEUB 2Y3IA 4J29A 5F1KA 1KZHA 1C0EA 1W2GA 2CXXA 1UK6A 4KO1S 4IUCS 1CUSA 2HRQA 2W6IA 3BERA 2P8JA 2XVZA 2ATEA 3DEJA 2C2KA 2C59A 2VAVA 2VHUA 3D31A 4I0WB 4J7CA 4P3YA 3Q9UA 3ZBQA 4KPFC 2ZIVB 4G67A 5EP1A 2FFRA 2X15A 5EUQB 4D1YA 5EP2A 5CDSA 821PA 5JJKA 3OTOB 4Q9AA 2DKOA 2YH2A 5BPFA 3A1VA 3JPYA 4W5NA 2HC9A 4OL0A 3GU3A 4Q9KA 3DDOA 1QH8B 5G0VA 4BVHA 2JLYA 1AKVA 2CFOA 5A6VA 3DHWC 4L9AA 4E31A 4N0PA 1L0BA 4KLZA 5DCYA 3HDGA 2VZ9A 3OOJA 5AVZA 4I5EA 4IG4A 3SS7X 5ALNA 3EG9B 2WHQA 5EHIA 1RWMA 4HDKB 4TMKA 1D09A 1N33B 2X0KA 1ZEMA 1C7IA 1PV2A 3P9SA 4TN1A 4M1EA 5ESDA 1Z6ZA 3LHDA 4CKBB 4RPKA 4MKXA 1JEYB 4GOOD 2R7MA 2WTMA 2YVKA 3FHCB 4D8XA 3K9GA 3G8DA 4QGAA 3LWZA 4W8OA 5CR9A 1LPBB 5E2AA 4Z7JA 1OFUA 2HUPA 3EEFA 1T6ZA 5D7BA 3P94A 3P97A 3H2SA 3SHFA 4NE9A 1C7EA 5CB8A 1G8HA 5CBPA 2CNBA 4YUAA 1A8UA 3LGAA 4OJTA 3TR0A 4C7JA 1ZJYA 3OZIA 5JSYA 3NV9A 1LW7A 3C8UA 2GYVA 2O7QA 3DMGA 3RROA 5DGCA 2FUKA 1ZPDA 1T36B 3QUBA 2OCKA 1LJUA 5F78A 4ICIA 5BQFA 4OFBA 4AX8A 2WT8A 1FPQA 2Z9BA 4INOA 1X8XA 5JAOA 4BQNA 4BO3A 2C00A 3T7AA 1AKEA 4EKNB 4F3KA 4F1WA 5BWOA 4QUHA 2BFFB 1RM5A 1VMAA 4YUWA 1V25A 2AIRA 2RHGB 3KX2A 1PWEA 1KI3A 3V4SA 1SVNA 1FSFA 2WU3A 4B17A 3Q7RA 4AN0A 3F74A 3STVA 4E5MA 1PG0A 1HSOA 1RHJA 1TKRA 5DYIA 4IIHA 2D1QA 2AMVA 5DCWA 3VC1A 3WLAA 1IN7A 1JAHA 1NF9A 3B1JA 4KN9S 1R3UA 2I76A 1YA8A 2EL7A 3ANXA 3OUZA 1CYDA 3AY7A 1XZMA 3HCRA 5AW0A 1X77A 3W5AA 1J8VA 4QHYA 1Q2UA 2IEYA 2HRZA 1YIOA 2QLFA 4K3VA 1GLGA 2H3EA 1CW2B 3B5JA 4IEIA 1GWNA 2RONA 4ZCSA 3U3RA 4CT5A 1PT7A 3NBYC 1KI4A 2PWAA 5JDCA 4R2LA 1U8TA 4D82A 3OT4A 1NYQA 4KZPA 3BFPA 4PNEA 2O2CA 1HR0B 1V2HE 4XTCS 3B1XA 2PGNA 3TE6A 1Q3TA 1OAOA 1U4NA 5CW1A 4JJ6A 1TTPB 4BVLA 4JROA 3UKOA 4UKDA 3D5QA 2C83A 3C5VA 1V95A 1J8DA 1DP4A 3MUFA 1RWXA 3PFIA 5B7QA 5CX4A 2O59A 3AR5A 2EKQA 2DT5A 1WXHA 1ZISA 3CGWA 1TKAA 2AOTB 3L0PA 1J70A 2ZWVA 4MUFA 2MSDB 1WV0A 4PX5A 3ROXA 1S89A 2IITA 3U3KA 1EE9A 3AP2A 3QTBA 4GLFA 3CX8A 3UOWA 4F7DA 5L53A 4MA0A 1C4WA 2HWKA 5FWXA 3FKSA 3DKVA 4S1PA 1E4OA 1JG7A 2YNMA 1NM5C 4G4GA 3JQ7A 1R0KA 2PMBA 3F7TA 5HFNA 2X4DA 3O91A 1SXJD 3LUKA 4RF3A 1Q91A 5E1BA 5BSTA 3TQTA 1KNXA 4JKYA 2Z2ZA 4GKJB 3L3BA 3LZCA 2FZKA 1KVSA 5EMHA 1EESA 4Y6RA 1RXWA 1T1IA 2QTRA 2VH5R 1U0EA 1W73A 3CCCA 1NIJA 3IJEB 2R1UA 3S1LA 2HSJA 4EHDA 3LPMA 3GFTA 1E59A 2Q8NA 2XUPA 3L4SO 3PNMA 2L18A 3LX5A 3UJBA 2CLFB 4L51A 1U28A 1LF0A 1WLYA 2HQ1A 3EYAA 2J09A 1OX6A 4CFZA 3GLGE 2ZREA 5K03A 4R98A 4YR7A 3LT4A 4AP5A 1E5QA 4IFIA 5SZJA 3LIPA 3QY0A 4TLEA 4Z9FA 3VU0A 4NMLA 3GD7A 5GAJA 4D8UA 4PIMA 1IM8A 5FTWA 2Z3VA 3OPVA 4WY5A 3VO9A 3VU1A 4EHKA 1UOEA 1GLNA 4UNRA 1RWOA 1GL3A 1ODKA 3SLGA 4M1WA 4M53A 4DMRA 2J9FA 1TMOA 5FBQB 4ZEWA 1BNCA 2VRBA 4HUTA 4MR8B 5CGZA 4UMDA 4CTOA 1Z2PX 1XP5A 3EGVA 4IEFB 3LHFA 3H5WA 2ONZA 1GAEO 2ZPTX 1CY8A 2XMPA 2A92A 4IYJA 2FPIB 2IC5A 5EOVA 3K9NA 2WSSA 1G5TA 1PUJA 1POXA 1TM3E 3NGLA 4DKXA 4F4CA 2YWHA 5KOHA 1ZMRA 3JQGB 2DPHA 1E60A 1I1OA 4ILEA 4WH0A 5ENDA 1JLKA 1B3BA 3PVZA 5HKBA 1PBTA 1ACLA 5FFFA 2GBLC 3QW4B 1MHPA 3A9CA 4HLNA 5KCZA 4GE0A 4LJ4A 2LRHA 1ZXBA 3U40A 2EZUA 3KUKA 4CM6A 3ONVA 9ABPA 4ZXPA 1Z5ZA 2ETVA 3NVDA 3SXJA 4IDNA 3GFSA 1YUNA 3IELA 4ND3A 5KJEA 4AX4A 5H9VA 4BVGA 1TLFA 2JFWA 4PWZA 4X1OA 3FYSA 5I47A 4LSWA 2FFBA 1IJBA 2HXGA 2WKWA 5BWMA 1Z8HA 2V3CC 2HI0A 1A7AA 2AD5A 4NG4A 1JQBA 4XZ3A 1E61A 1XXHA 3AEZA 3FH0A 2RH8A 3QOWA 4ZQGA 3VZQA 4E09A 1RI1A 3AERB 3ELWA 4M1OA 2VI5A 2XA2A 4JI1B 4ZDWA 3DBRB 1QF6A 1SUSA 2XTNA 1P3Y1 3F97A 2CYAA 1QQ7A 3CYFA 4I1YA 4MV8A 4RCZA 3IAUA 4YT2A 5A9TA 3F1KA 4WZBA 3RFXA 4BO4A 1JMYA 3U80A 4P35A 4A73A 1T1RA 1TF2A 1UMCB 1Y5MA 4MUBA 2XRZA 4CCYA 1LDBA 5DLPA 4GWGA 3B53X 4PLPA 5DXAA 2OPHA 4IWNA 3HCBA 4ZC8A 1JFFA 4KQFA 4WNAB 1MX9A 1Q15A 3AOEC 5C7IO 3GXBA 4ZA2A 1XNGA 2C3OA 2SNIE 3T0IA 3ZIUA 4HDOB 3ZE1B 2GPJA 2YIMA 4TXLA 1NA5A 4GP6A 1M2JA 4TN5A 2BH2A 3M8KA 5IUKC 2F3SA 1Z35A 1TYCA 5CB6A 3GLIE 2BZ0A 3PBKA 1JHPA 2ET6A 4X5OA 4DWVA 5J1SB 3RJMA 3KHTA 2D7JA 4U2DA 3LI2A 3FMOB 4R8LA 2AKAB 1U2EA 1CUZA 3OZAA 5LQAA 1ELOA 3HSKA 1RYYA 4PQYA 3O0TA 4A27A 3SM9A 2F8TA 3KC2A 1ZN9A 1QGAA 3A6ZA 2JAPA 2O3UA 5CB4B 3BH7A 1F3LA 4IWYA 3HACA 4D9MA 1EFRD 5E1DA 1DWUA 2MYUA 2Z5VA 4D4JA 3GZ4A 1R4MB 5EINA 3ZI7A 1GTSA 2FX2A 3EQ7A 4MVXA 3AY3A 3H4TA 4M9RA 2CT8A 5SV2A 1EP2B 5K4HA 3ROGA 3D5EA 4OU5A 3S29A 4QTYA 1VPTA 4TYMA 1FQJA 2YCBA 3UXHA 3AHFA 3QLEA 3IQEA 4Q34A 2G4CA 4CIDA 2OCPA 2DOKA 2FQXA 3W1WA 5K8VA 2BEJA 4N6OA 5P8WA 3ZGXA 4YQFA 1PWXA 1PFGA 4LQDA 1EBBA 2B9VA 1J8QA 1Y48E 2ENWA 4Z86A 3QV2A 2E0IA 2OV1A 2WHXA 1CUYA 2EOAA 1SG6A 4RD6A 3H1AA 2CSXA 1BEUB 2GPNA 2GYYA 5CXQA 4M37A 3SS8A 1N4DA 1NVAA 1Z5WA 3IDOA 4I4TF 3HZRA 3KIPA 1ZK0A 1GKYA 1RBQA 1RHMA 1WIWA 1BH6A 5ICGA 2ZT5A 4FYXA 5I7UA 4B4UA 3N8DA 2QRZA 2EJTA 3BHIA 4H7EA 5G02A 1WUKS 4IS3A 5LMZA 1D9ZA 4NXNB 2E6KA 3MQ4A 4RWZA 1WP9A 3UMJA 2ETXA 1JL3A 2IFTA 4B7XA 3O94A 4MW9A 4PX2A 1XRMA 4ME6A 2L82A 3AM3A 4YHBA 2ZRHA 2R00A 3DLAA 4XYEA 4ZPJA 3D2LA 3ESZA 4ZXFA 3TOVA 5A4DA 1GZ7A 1XMPA 4Y9TA 1P75A 2P79A 4U7WA 3RSLA 4CJXA 2BGMA 2LE0A 1M2OA 4AS3A 1NQVA 1DAIA 2FPSA 5DW3A 4Z4QA 3TPFA 1Q1NA 4LJKA 3FOCA 3AKCA 2COUA 5IN4A 4YCLA 5A3VA 2N0SA 4LI3X 3F4BA 5I9MA 1ZUIA 3ZDBA 1FFGA 1YCFA 1V48A 1V5WA 5AYVA 1FP4B 1T36A 2D4HA 1U3TA 4TXNA 2AG1A 1RCTE 4JXKA 4MMYB 4XB2A 2XWSA 3X2SA 2R8YA 4OK5A 1W8IA 2INGX 1EG7A 2CUZA 4Z4CA 3PUYA 3RRJA 1FJGB 3OFVA 3NUZA 1Q3KA 3H5AA 4R2KA 3UEOA 2Y0CA 4BX9A 3FOEC 1J7JA 4OQEA 4LX0A 4IHQA 5HK9A 1P3JA 5JZMA 3L8EA 1JU4A 1Q1ZA 4WKBA 1NU6A 4IDCA 3THOA 1MBZA 4CDRA 2O8FA 2YY6A 4HGZA 4GU5A 5E4JA 1G18A 3TUJC 3QVVA 3VU3A 4R7GA 4HNRA 3WJAA 4CUJA 5FFNA 2ZI7A 1FUKA 4XDHA 4ZKDA 1JKFA 5K3AA 5KB3A 2YHIA 2YIDA 1NAIA 3WG9A 3GLHA 2WHRA 4UU7A 5A7FA 4HMPA 3BMNA 5BR8B 5ERYA 4DV1B 3IUMA 3O4IA 4G5YA 5F76A 3SOZA 2NPIA 3I1IA 1XWWA 1OYWA 2X3YA 2XUGA 5B12A 4UFNA 3TLZA 5JXJA 5EPOA 2NP6A 3ZLBA 2FWIA 2G1AA 5GIPE 3N0VA 1Z6YA 2WSSD 1YTLA 2ZQYA 1I2CA 2VAPA 4BX8A 5JDIC 2ZIWB 4FOLA 3KR0A 5IF3A 2PUWA 4CKEB 3H99A 3N3AC 4EI2A 5BSWA 3GA5A 2G72A 4JT8A 1E79A 3OX3A 1D1PA 4H7HA 4J3NA 4ZHQF 3S5UA 5TEVA 4J0IA 4R6WA 4B4OA 2OGUA 1M75A 1SVSA 3G79A 1Z0ZA 1J6UA 1ZD8A 4OEHA 2B1IA 2CE2X 4LMRA 4U7JA 4MV0A 1NN0A 3LFHA 5HF9A 1A0OA 4Y7DA 3AKZA 4F8EA 5K0GA 3WGKA 2PNFA 3HPRA 3IBGA 4NOLA 2CCGA 4Q1CA 1JX6A 1SIUA 2B25A 3LV8A 3RUIA 1IPHA 2AV6A 1L5OA 3FNQA 4QREA 4JX9A 2ASEA 1S7GA 4C21A 2HFKA 3LFUA 1I7SB 3ZTWA 4W1QA 4E4TA 1ACJA 3WNCA 5BV8A 1TO6A 1AQYA 1J99A 3R3YA 5AJVB 1OT3A 1CZRA 2CVHA 4EQ6B 1KFJB 1TZCA 2FWJA 4NC9A 4BHTA 4I81A 3WNZA 4G3XA 2PFGA 1SIOA 1W5TA 4FYHA 5HEKA 3W8NA 2BGRA 4BE4A 1L5RA 2HIGA 4EFMA 2WSIA 1NVMB 5BNWA 2UUCB 1SIWA 3NEYA 3RS4A 1G21A 1OAAA 2OCGA 2EFCB 2YXEA 4M49A 5TLSA 2C7QA 5JLJA 2TMYA 1VCOA 2C2XA 2PRZA 5I8PA 3KT8A 4P4UA 2AMLA 4G9EA 4AKHA 3CNBA 1KJQA 3LP6A 1VCMA 2X8JA 1TTTA 4DIKA 1NYTA 3ZU2A 1SCNE 2M6LA 2BE7A 4IGKA 2PGXA 4B6EA 2RG7A 4EELA 5IJ9B 1FW6A 2I3GA 1NTOA 4AWBA 5HQ3A 3LCJA 3RIXA 2V7PA 4W7SA 3RR2A 2PPVA 3QKRA 3R5KA 2ZIXA 1M1YE 4I4TB 1ZH8A 3W7BA 2G08A 5HTOA 3QHPA 1E9AA 5ALMA 2ONJA 1DBPA 1OWMA 2PKQO 4BB9A 3I0ZA 4Y2UA 3GG9A 4ARVA 5FOQA 1JV2B 1XFAA 4WAUA 4N03A 3E5RA 4BO1A 2ZB8A 5IANA 1O9HA 2GZAA 4L27A 4FGKA 4R8VA 4IF6A 3GAAA 4W8GA 4DTCA 2IY8A 2PZEA 1E99A 3AVPA 4UCQA 1FTNA 1E3WB 2A58A 2D8MA 3FJYA 3LVQE 4A91A 2E5FA 3V8NA 2H4WA 3A7DA 5FOSA 3NVKI 4URYR 1C30B 5DTQA 1MJHA 1ECFA 1G3MA 5TEWA 3K0AB 3NGXA 1M1NB 2JEZA 2K4MA 1KE2A 4HEJA 1SHKA 1A2QA 2R6ZA 4GBJA 5ALEA 5GJWC 1OHHA 2VF4X 4BATA 4C2AA 4DNOA 2VT3A 4QXRA 1DQZA 4W63A 1XA0A 1H0HA 3ETNA 4DEYA 4GKKB 1XXHE 2OXFA 3ABIA 1T1EA 1E3WA 1F5NA 1XEWX 3QI7A 3EGXB 4QFDA 1K6XA 1XZLA 4RHXA 5LQJA 1Z5UA 2V9ZA 5DSZA 3U48A 4B5KA 2W4QA 1Y1RA 1E1MA 4K6HA 4QYIB 2BF7A 5HX7A 4C07A 2HDHA 5ICEA 5ADWA 3UJHA 4KZKA 2F90A 3Q85A 2I78A 2Q6TA 3BMOA 3KJIA 3M83A 2HA5A 4GKAA 4GT1A 2CNOA 1FFWA 4FMBB 4UCXA 2IU0A 1MORA 3QGMA 3MOGA 2XMBA 2H5EA 1UZMA 1FU7A 3OLVA 1HDZA 4ZYZA 3AB3A 2K2QB 2HR1A 3N53A 3AO0B 1YK1A 2RKOA 4KMSA 4Q16A 3U39A 3GC6A 2HCTA 3IC5A 1X1EA 2JLBA 3KKEA 4G8DA 2NO5A 4H0FA 2FMTA 4NMXB 1KK2A 1EVJA 1GSIA 2ZBGA 3EUFA 5CW2A 4Z9BA 5ECGC 2W2LA 4Y3UA 2VDVE 4DBLE 5J2UA 1N77A 2WVAA 1QE0A 3OPYI 1AF7A 4L6IA 4MYRA 3SF0A 1G21B 4MDFA 4FFVA 5FCDA 2FMIA 1ZSYA 1UPUA 4C4ZA 1B6TA 2H9IA 3P0JA 4PINA 2DTXA 3W2FA 5JW6A 3DKKA 2ZSDA 1GAQA 2ZSHA 4FDAA 3C3JA 4GS5A 4HBZA 5KHAA 4BVKA 2H1IA 3BK2A 3I5XA 4C7MA 5JWRA 4EY8A 3F9RA 1GYQA 2WJIA 3ZCSA 3KELA 1LA2A 3B9RA 3QEMA 2OC9A 3GCGA 1XZFA 2O8FB 2C9YA 1VI6A 1DEHA 1BDJA 1U6KA 3DFZA 1ISGA 5ILQA 5SZIA 3KOOA 4Q6WA 3U9TA 2VNKA 2Z8YA 3OZFA 4Q3OA 1SCUA 4RTLA 3A32A 2PUJA 3TFQA 3VAZA 2YJ4A 4WXRA 2NLOA 4TV8F 4CL0A 3O1LA 1FDRA 3OJWA 1BXZA 4F04A 3U9SA 2X1VA 5AK3A 4O6VA 3JQAA 1XQWA 4DMHA 3TGPA 1O94C 2P1DA 4RD0A 5HILA 3JD0A 2CL7X 1IDN1 1J8FA 1ST2A 2VZEA 2VP0A 4EHNA 5LVAA 4BDTA 4C0KA 4JGGA 4UUOA 1RPAA 1O0BA 3OCVA 2QTFA 1D2GA 3QI2A 1JQ5A 5JC8A 4NAVA 4R31A 4C2BA 3R09A 4UDXX 4DUGA 1BA3A 1DZ3A 2PH1A 3V34A 4HV4A 1S96A 1XC7A 2ZIEA 3D1VA 4E32A 1XCMA 1M2HA 1L4YA 2C1EA 1FX1A 1WOYA 3CLUC 4PRKA 3G49A 4Z8XA 4ZRDA 4S04A 1WX1A 3GQBB 3EASA 3C16C 1HDIA 1EDDA 1JPNA 4KK4A 4P08A 2E7ZA 4JIMA 3PZRA 1WDTA 3O2NA 4GH5A 1E6WA 1Z0SA 3I6QA 1MG0A 4QQNA 3TM5A 1LF5A 1DE0A 5BRAA 8LDHA 1T0PA 4KAJA 2D6FA 2ZBDA 1EK0A 1MC8A 1SUWA 3ESCA 5DH9A 3UG7A 3V3TA 2OTCA 2JDIA 1QV9A 3AB8A 2IUTA 1EJ0A 3PUWA 4FNOA 1LBQA 2WW8A 3BSSA 1PZHA 2QPAA 3GOQA 3CEAA 1KU6A 3G2KA 5D84A 4JENA 2W43A 4LWOA 5DJ5A 4R1OA 1UT8A 3R5JA 1GKLA 3QFFA 1T10A 4BJ1A 2FW6A 3D6AA 1C1XB 4F7WA 3K0EA 1QU3A 3OY2A 4GMXA 3RS8A 1JR3A 1XRQA 1YB2A 2OWDA 3T0GA 1H2FA 1NXVA 3EK2A 3RFVA 1UC4B 4YQZA 4JA0A 1FMFA 4Q24A 2PU5A 3OCJA 3ZHXA 2P3QA 1D8AA 1S3GA 4AJOA 3AVWA 4P7BA 1SHZA 1K2WA 5JJLA 1N5RA 3CNHA 3G2JA 1MDFA 4UZSA 2D5LA 3O95A 4QUDA 3WWCA 4MDHA 4RKRA 1CEXA 4P31A 4QHTA 3E9NA 2DHEA 3EBPA 4DXAA 4E08A 1Z88A 4K1XA 1FQOA 2ZJ6A 4WLEA 3ZUGA 5HYVA 1QLJA 2P0YA 2LWIA 2VOEA 4R40A 1Q0TA 1UDBA 2ZU6A 3GHYA 1JEQA 3DLIA 2ZAGA 3I2FA 1LC0A 4TVOA 3EZ2A 3LNTA 5CT9A 4BKOA 4BWVA 3IUBA 5CM2Z 3GPBA 2C5GA 3QXSA 1BVRA 1DX6A 3DDHA 3OICA 4UW9A 3RU7A 1RXIA 3PHGA 4KO8A 4LC1A 4FIZA 2B21A 2ZS7A 3OQIB 1NV9A 1Z68A 4M8IA 4PG7A 2PWPA 4Z3DA 3CH5A 1JI3A 4JNCA 3SIPA 4JOBA 1NYLA 1P9LA 5E3IA 1YVRA 3GLFA 1BVYF 1IJFA 2C2ZA 5ICMA 2DUWA 4B76A 3SXUA 4TV8A 3HFJA 3RC1A 2EXXA 3D1JA 4MGZR 5CK4A 1SOAA 1PZEA 5L45A 3RBAA 5KYYA 3DOCA 3IAS1 4V3CA 4YAGA 4IDGA 3VJMA 5K8UA 4MVJD 1XNHA 3ANLA 4ECAA 4DSTA 3Q0IA 2JZNA 3LK6A 1X1TA 2FSGA 3L9XA 2HCFA 2HQRA 2JFNA 5HGJA 5T8KC 2KM1A 2P5SA 4EFLA 4M0EA 1TNDA 3EEIA 5JAIA 2QDKA 1TMGE 2W8BA 3P32A 5TS2A 1U81A 1TCVA 2H0AA 1GRRA 1P62B 3D9QX 3HCEA 3IP3A 4Q3EA 3OT1B 2W2VA 1D2EA 2H54A 2VCEA 2ZXEA 2AJLI 3DEYX 4LA4A 4WPGA 2HWYA 1P2TA 2VF7A 3K0BA 4HGOA 3MLEA 3RSQA 4RD2A 1NKVA 3Q5DA 3H5LA 1MX1A 3LZDA 4HDSB 4RZ3A 3RHSA 1M1XB 2DFDA 3ULKA 1XB2A 4BTVA 3H13A 1AO3A 1T2FA 4IIJB 1KYVA 5LIRA 2P62A 3DE5X 1MG5A 4P4LA 3R75A 3RF7A 1U2GA 3T15A 1SOVA 3ZTTA 4EKGA 2HHHB 4EVRA 1G5HA 4B79A 2QYHA 1UQTA 4V39A 4D98A 2JFOA 2CHVA 3KJNA 2ZLBA 1QZUA 1Y7PA 4KLNA 3SEQA 4PZLA 2H4YA 1EWYA 4A2QA 3GELA 4QGBA 1G3IA 2R68A 3QIVA 3Q7TA 5K51A 5ER9A 3SZRA 3WMEA 5CP8A 1TEZA 1PFUA 3LDAA 3UQZA 1YIDA 2IXEA 2VH1A 3K8ZA 3E9ZA 1PT6A 4P4TA 5CXUA