2FJ7D

Crystal structure of nucleosome core particle containing a poly (da.dt) sequence element
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
93
structure length
93
Chain Sequence
b'RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleosome Core Particles Containing a Poly(dA.dT) Sequence Element Exhibit a Locally Distorted DNA Structure.
pubmed doi rcsb
molecule keywords 147 bp DNA containing 16 bp poly dA element
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2fj7D00
5B0ZA 5B33D 4J8VD 3AZMB 3W96D 3AZNC 4H9RA 5AVCA 3W99A 3MGRD 1WWSA 3AZID 3UTBA 3AZKD 3B6FB 5G49B 4UUZA 5CP6D 3MGSC 4Z66A 2HIOD 2BYMA 3VH5A 4J8WB 1P3AA 3KUYD 5CPID 4EO5C 1P3MC 4WU8A 2JSSA 3W97D 3C1CB 5DNMD 3AV2B 1KX5B 3W96C 3MGRC 3AZIC 1HTAA 3AZKC 4H9NA 4NE6A 3KXBC 1ID3C 4QLCB 1N1JA 2YFVB 3VH6A 5CP6C 2HIOC 3AFAA 3AZLA 3TU4B 3REJD 3UTBD 2NQBB 4Z5TD 4CSRB 4J8XB 2NZDD 3KUYC 4YS3A 4R8PB 3VH5W 3MNNB 5DNMC 1P3AD 3AV1B 5B0YA 3RELB 3AZJB 3KSYA 3NQJB 5B2IB 5AV8D 3LJAA 1KX4A 5B1LD 3REJC 3UTBC 5KDMA 4Z5TC 3MGQB 2NZDC 3WTPD 5B40A 1B67A 5GT3D 3X1UD 5E5AA 4HGAC 1F66A 3LELA 3V9RA 4KGCA 3AZFB 5AY8D 5B24B 3X1SD 1P3AC 3MGPB 5F99A 4YS3D 3UTAB 3UT9B 1ZLAA 4ZUXA 3A6NA 1BH9B 3R45B 1U35D 5B1MD 2CV5D 5AV8C 2PYOA 5JRGB 4G92B 3X1VB 3LZ0B 3AN2A 5B0YD 5B1LC 3KWQA 5AV9A 3WTPC 1KX4D 5GT3C 3X1UC 5CPJD 3AZNA 5DNNB 3B6GD 5AY8C 3X1SC 4YS3C 3O62B 3X1TC 1P3FA 1S32B 4NE3A 3MGSA 1U35C 5B1MC 5F99D 1TZYB 2CV5C 1JFIA 4WU9C 5CPKB 1P34D 3AZEB 1P3MA 5B0YC 2FJ7B 1P3GB 4DRBA 1KX3D 3REKB 1AOID 5CPJC 3W96A 5GSUB 3B6GC 4AWLB 3AZIA 5B31D 5B2JB 1P3PD 3AZKA 3KXBA 1ID3A 4WV4B 2YFWA 3AYWA 3MVDB 5CP6A 3C1BD 3AZHB 1P3OB 2HIOA 4LD9A 1P3FD 2AROD 1EQZD 1M18C 4J8UB 1P34C 3KUYA 3MGSD 1TAFB 3LZ1C 5DNMA 1KX3C 3WKJB 5B32B 4Z2MG 5AVBB 1AOIC 4YM6A 5GT0B 5B32G 5B31C 1P3KB 1P3PC 4KHAB 4J8WD 1P3IB 3MNNA 2LY8A 4CAYB 5JA4B 3C1BC 4JJNB 3B0CT 3REJA 3REHB 4XUJB 2AROC 4Z5TA 1P3FC 3KXBD 1ID3D 1EQZC 3W98B 2NZDA 3C1CD 3AYWD 3AV2D 4LD9D 4H9PB 5AV6B 4WZSB 4DRAA 1M19B 4H9QA 3REIB 5BNVB 5AV8A 4YM6D 4J8WC 3TU4D 2NQBD 4J8XD 5B1LA 4EO5B 5C3IC 3WTPA 3B0BA 3MNND 3C1CC 3AYWC 3AV2C 3X1UA 5GT3A 1P3BB 4XZQB 5B33B 4J8VB 1KX5C 4LD9C 3AV1D 1P3LB 3AZGA 5AY8A 3X1SA 3MGRB 3X1TA 5B2ID 2F8NB 4QLCC 3B0DB 2L5AA 3WAAB 5GXQB 3NQUB 2IO5B 1U35A 5AV5B 5B1MA 2F8NG 3TU4C 2CV5A 2NQBC 1BH8A 4YM6C 5CHLB 4WU9A 3WA9B 4J8XC 5CPIB 1HQ3B 4R8PC 4ZBJB 4X23B 4KUDB 3MNNC 3AZFD 3W97B 5B24D 5CPJA 3UTAD 3UT9D 3AV1C 1H3OA 3B6GA 1R4VA 3RELC 3AZJC 3VH6W 5B0ZB 5B2IC 5JRGD 1M1AA 3X1VD 3LZ0D 3AZGD 4H9RB 5AVCB 3W99B 5BO0A 3X1TD 1M18A 3MGQC 3UTBB 5BNXA 1P34A 4UUZB 4WNNA 3LZ1A 4Z66B 2BYMB 5DNND 4WU9D 3AZHA 3AZFC 1KX3A 5B24C 3MGPC 1AOIA 2HUEB 3O62D 1P3AB 3UTAC 3UT9C 4WU8B 5B31A 1P3PA 4G91B 1TZYD 5JRGC 4G92C 5CPKD 3X1VC 3LZ0C 3C1BA 3AZGC 3AZED 4H9OA 5FUGA 2AROA 1EQZA 1P3GD 2BYKA 1M1AD 4H9NB 2F8NK 1N1JB 3REKD 3AZMA 3AFAB 5DNNC 3AZLB 1M18D 4NE5A 4XUJA 3O62C 3B6FA 4YS3B 3LZ1D 2CWEA 5G49A 3MVDD 3AZHD 1P3OD 1TZYC 4J8WA 2RVQD 4J8UD 5CPKC 3AZEC 3VH5T 5B0YB 1P3GC 3C1CA 1M1AC 3AV2A 3WKJD 1WWIA 5B32D 3LJAB 5AVBD 1KX4B 3REKC 5GT0D 1KX5A 5BT1D 4AWLC 1KU5A 5KDMB 1P3KD 5B40B 3AZMD 1P3ID 5E5AB 4QLCA 3MVDC 2YFVA 4JJND 3AZHC 1P3OC 3LELB 3V9RB 1F66B 4KGCB 3TU4A 2NQBA 3REHD 4XUJD 4CSRA 5F99B 4J8XA 3B6FD 2RVQC 4J8UC 3W98D 4M6BA 1ZLAB 4ZUXB 3A6NB 4R8PA 2PYOB 3WKJC 5B32C 5AV6D 5AVBC 5GT0C 4E45A 3AN2B 1M19D 3AV1A 5BT1C 3KWQB 3RELA 3AZJA 5AV9B 1P3KC 3NQJA 5B2IA 3REID 3AZMC 1P3IC 5BS7A 1KX5D 4JJNC 3AZNB 3REHC 4XUJC 3B6FC 3MGQA 3W98C 1P3FB 4QLCD 1P3BD 4XZQD 3MGSB 1P3LD 3AZFA 1JFIB 5B24A 5AV6C 3MGPA 3UTAA 1M19C 3UT9A 1P3MB 2F8ND 4R8PD 1BH9A 3WAAD 5GXQD 3R45A 5AV5D 3REIC 5JRGA 3WA9D 3X1VA 3LZ0A 3W96B 3RELD 3AZJD 3AZIB 1HQ3D 4X23D 3AZKB 4H9SC 4KUDD 3KXBB 1ID3B 5C3IB 2YFWB 3AYWB 1P3BC 4XZQC 5B33C 5CP6B 4J8VC 2HIOB 5DNNA 1P3LC 4LD9B 3MGQD 3O62A 5B0ZD 3KUYB 1S32A 3B0DC 3WAAC 5GXQC 2IO5C 3W99D 5AV5C 5AVCD 3MGPD 5DNMB 1TZYA 3WA9C 4YM6B 5CPKA 3AZEA 4Z2MH 5CPIC 1HQ3C 4X23C 4ZBJC 4Z66D 1P3GA 2FJ7A 5BS7C 4KUDC 3W97C 3REKA 5GSUA 4WU8D 3REJB 4Z5TB 5B2JA 2NZDB 5B0ZC 3MVDA 4HGAB 1P3OA 5AVCC 3W99C 1A7WA 4J8UA 1S32D 1TAFA 1F1EA 4Z66C 4H9QB 3AFAD 3AZLD 5AV8B 3WKJA 5B32A 5AVBA 4NFTA 2HUEC 5GT0A 2FJ7D 5B1LB 4WU8C 3B0CW 1P3KA 4G91C 4KHAA 3WTPB 5GT3B 3X1UB 1P3IA 4CAYA 5GSUD 5JA4A 4JJNA 5B2JD 3WTPE 5AY8B 3X1SB 3REHA 3AZGB 3W98A 3X1TB 1Q9CA 1S32C 3LJAD 1B6WA 3AFAC 1U35B 5B1MB 3AZLC 4H9PA 2CV5B 1BH8B 4WU9B 5AV6A 2F8NH 5B40D 1M19A 2FJ7C 5E5AD 1F66D 3LELD 4KGCD 3REIA 5BNVA 5GSUC 5CPJB 1ZLAD 1EQZB 1H3OB 3B6GB 5B2JC 4ZUXD 3A6ND 4H9SA 2PYOD 3LJAC 1M1AB 1KX4C 1P3BA 4XZQA 5B33A 4J8VA 3AN2D 1P3LA 5BO0B 4E44A 3VH6T 3KWQD 5AV9D 1M18B 3MGRA 5BNXB 1P34B 5B40C 1ULYA 2F8NA 5E5AC 4WNNB 3LZ1B 5GXQA 3WAAA 3AZND 3NQUA 3LELC 1F66C 5AV5A 4KGCC 1KX3B 3WA9A 5F99C 1AOIB 1ZLAC 4ZUXC 3A6NC 5CPIA 5B31B 1HQ3A 4X23A 1P3PB 4KUDA 3W97A 1BFMA 2PYOC 5B31G 3C1BB 3AN2C 1P3MD 4H9OB 5FUGB 2AROB 3KWQC 5AV9C 2BYKB
chains in the Genus database with same CATH superfamily
5B0ZA 5B33D 4J8VD 3AZMB 3W96D 3AZNC 4H9RA 5AVCA 3W99A 3MGRD 1WWSA 3AZID 3UTBA 3AZKD 3B6FB 5G49B 3A1KA 4UUZA 5CP6D 3MGSC 4Z66A 2HIOD 2BYMA 2Y2IA 3VH5A 4J8WB 1P3AA 3KUYD 5CPID 4EO5C 1P3MC 2ZY5A 4WU8A 2JSSA 3W97D 3A1IA 3C1CB 5DNMD 3AV2B 1KX5B 3W96C 2J8PA 3MGRC 3AZIC 1HTAA 3AZKC 4H9NA 4NE6A 3KXBC 1ID3C 4QLCB 1N1JA 2YFVB 3VH6A 5CP6C 2HIOC 3AFAA 3AZLA 3TU4B 3REJD 3UTBD 2NQBB 4Z5TD 4CSRB 4J8XB 2NZDD 3KUYC 4YS3A 2XD5A 4R8PB 3VH5W 3MNNB 5DNMC 1P3AD 3AV1B 3IP4C 5B0YA 3RELB 3AZJB 3KSYA 3NQJB 5B2IB 5AV8D 3LJAA 1KX4A 5B1LD 3REJC 3UTBC 5KDMA 4Z5TC 3MGQB 2NZDC 3WTPD 5B40A 1B67A 5GT3D 3X1UD 5E5AA 4HGAC 1F66A 3LELA 3V9RA 4KGCA 3AZFB 5AY8D 5B24B 3X1SD 1P3AC 2DQNC 3MGPB 5F99A 4YS3D 3UTAB 3UT9B 1ZLAA 4ZUXA 3A6NA 1BH9B 3R45B 1U35D 5B1MD 2CV5D 5AV8C 2PYOA 5JRGB 4G92B 3X1VB 3LZ0B 2JCHA 3AN2A 5B0YD 5B1LC 3KWQA 5AV9A 3WTPC 1KX4D 5GT3C 3X1UC 5CPJD 3AZNA 5DNNB 3B6GD 5AY8C 3X1SC 4YS3C 2ZY3A 3O62B 3X1TC 1P3FA 1S32B 4NE3A 3MGSA 2XD1A 1U35C 5B1MC 5F99D 1TZYB 2CV5C 1JFIA 4WU9C 5CPKB 1P34D 3AZEB 1P3MA 5B0YC 2FJ7B 1P3GB 4DRBA 1KX3D 3REKB 1AOID 5CPJC 3W96A 5GSUB 3B6GC 4AWLB 3AZIA 5B31D 5B2JB 1P3PD 3AZKA 3KXBA 1ID3A 4WV4B 2YFWA 3AYWA 3MVDB 5CP6A 3C1BD 3AZHB 1P3OB 2HIOA 4LD9A 1P3FD 2AROD 1EQZD 1M18C 4J8UB 1P34C 3KUYA 3MGSD 1TAFB 3LZ1C 5DNMA 1KX3C 3WKJB 5B32B 4Z2MG 5AVBB 2ZM5A 4YM6A 5GT0B 1AOIC 5B32G 5B31C 1P3KB 3H0LC 1P3PC 4KHAB 4J8WD 1P3IB 2Y2GA 3MNNA 2LY8A 4CAYB 5JA4B 3C1BC 4JJNB 3B0CT 3REJA 3REHB 4XUJB 2AROC 4Z5TA 1P3FC 3KXBD 1ID3D 1EQZC 3W98B 2NZDA 2VQRA 3C1CD 3AYWD 3AV2D 4LD9D 3EPHA 4H9PB 2UWXA 5AV6B 2F2AC 4WZSB 4DRAA 1M19B 4H9QA 3REIB 5BNVB 5AV8A 4YM6D 4J8WC 3TU4D 2NQBD 4J8XD 5B1LA 3P5JB 4EO5B 5C3IC 3WTPA 3B0BA 3MNND 3C1CC 3AYWC 3AV2C 5GT3A 3X1UA 1P3BB 4XZQB 5B33B 4J8VB 1KX5C 4LD9C 3AV1D 1P3LB 2Y2HA 3AZGA 5AY8A 3X1SA 3MGRB 3X1TA 5B2ID 2F8NB 4QLCC 3B0DB 2L5AA 3WAAB 5GXQB 2Y2JA 2IO5B 3NQUB 5AV5B 5B1MA 1U35A 2F8NG 3TU4C 2CV5A 2NQBC 1BH8A 4YM6C 5CHLB 4WU9A 3WA9B 4J8XC 2W8SA 5CPIB 1HQ3B 4R8PC 4ZBJB 4X23B 4KUDB 3MNNC 3AZFD 3W97B 5B24D 5CPJA 3UTAD 3UT9D 3AV1C 1H3OA 3B6GA 1R4VA 3RELC 3AZJC 3VH6W 5B0ZB 5B2IC 5JRGD 1M1AA 3X1VD 3LZ0D 2ZY2A 2G5IC 3AZGD 4H9RB 5AVCB 3W99B 5BO0A 3X1TD 3AL0C 1M18A 3MGQC 3UTBB 5BNXA 1P34A 4UUZB 4WNNA 3LZ1A 4Z66B 2BYMB 5DNND 4WU9D 3AZHA 3AZFC 1KX3A 5B24C 3MGPC 3H0MC 1AOIA 2HUEB 3O62D 1P3AB 3UTAC 3UT9C 4WU8B 5B31A 3H0RC 1P3PA 4G91B 1TZYD 5JRGC 4G92C 5CPKD 3X1VC 3LZ0C 3C1BA 3AZGC 3AZED 4H9OA 5FUGA 2AROA 1EQZA 1P3GD 2BYKA 1M1AD 4H9NB 2F8NK 1N1JB 3REKD 3AZMA 3AFAB 5DNNC 3AZLB 1M18D 4NE5A 4XUJA 3O62C 3B6FA 4YS3B 2BG1A 3LZ1D 2CWEA 5G49A 3MVDD 3AZHD 1P3OD 1TZYC 4J8WA 2RVQD 4J8UD 5CPKC 3AZEC 3VH5T 5B0YB 1P3GC 3C1CA 1M1AC 3AV2A 3WKJD 1WWIA 5B32D 3LJAB 5AVBD 1KX4B 3REKC 5GT0D 1KX5A 5BT1D 4AWLC 1KU5A 5KDMB 2DF4C 1P3KD 3F6TA 5B40B 3AZMD 1P3ID 5E5AB 4QLCA 3MVDC 2YFVA 4JJND 3AZHC 1P3OC 3LELB 3V9RB 1F66B 4KGCB 3TU4A 2NQBA 3REHD 4XUJD 4CSRA 5F99B 4J8XA 3B6FD 2RVQC 4J8UC 3W98D 4M6BA 1ZLAB 4ZUXB 3A6NB 4R8PA 2JE5A 2Y2OA 2PYOB 3WKJC 5B32C 5AV6D 5AVBC 5GT0C 4E45A 3AN2B 1M19D 3AV1A 5BT1C 3KWQB 3EPKA 3RELA 5AV9B 3AZJA 1P3KC 3NQJA 5B2IA 3REID 3AZMC 1P3IC 5BS7A 1KX5D 4JJNC 4DQYB 3AZNB 3REHC 4XUJC 3B6FC 3MGQA 3W98C 1P3FB 4QLCD 1P3BD 4XZQD 3MGSB 1P3LD 3FDDA 3AZFA 5B24A 1JFIB 5AV6C 3MGPA 3UTAA 1M19C 3UT9A 1P3MB 2F8ND 4R8PD 1BH9A 3WAAD 5GXQD 3R45A 5AV5D 3REIC 5JRGA 3WA9D 3X1VA 2RIQA 3LZ0A 3W96B 3RELD 3AZJD 3AZIB 1HQ3D 4X23D 3AZKB 4H9SC 4KUDD 3KXBB 1ID3B 5C3IB 2YFWB 3AYWB 1P3BC 4XZQC 5B33C 5CP6B 4J8VC 2HIOB 2Y2PA 5DNNA 1P3LC 4LD9B 3MGQD 3O62A 5B0ZD 3KUYB 1S32A 3B0DC 3WAAC 5GXQC 2IO5C 3W99D 5AV5C 5AVCD 3MGPD 5DNMB 1TZYA 3WA9C 4YM6B 5CPKA 3AZEA 3EPJA 2Y2KA 4Z2MH 5CPIC 1HQ3C 4X23C 4ZBJC 4Z66D 1P3GA 2FJ7A 5BS7C 4KUDC 3W97C 3REKA 5GSUA 4WU8D 3REJB 4Z5TB 5B2JA 2NZDB 5B0ZC 3MVDA 4HGAB 1P3OA 5AVCC 3W99C 1A7WA 4J8UA 1S32D 3EG5B 1TAFA 1F1EA 4Z66C 4H9QB 3AFAD 3AZLD 5AV8B 3WKJA 5B32A 5AVBA 4NFTA 2HUEC 5GT0A 4WJ3C 2FJ7D 5B1LB 4WU8C 3B0CW 1P3KA 4G91C 4KHAA 3WTPB 5GT3B 3X1UB 1P3IA 4CAYA 5GSUD 5JA4A 4JJNA 5B2JD 3WTPE 5AY8B 3X1SB 3REHA 3AZGB 2Y2NA 3W98A 3X1TB 1Q9CA 1S32C 3LJAD 1B6WA 2Y2QA 3AFAC 1U35B 5B1MB 3AZLC 4H9PA 2CV5B 1BH8B 4WU9B 5AV6A 2F8NH 5B40D 3EPLA 1M19A 2FJ7C 5E5AD 2Y2LA 1F66D 2FFFB 3LELD 2Y2MA 4KGCD 3REIA 5BNVA 5GSUC 5CPJB 1ZLAD 1EQZB 1H3OB 3B6GB 5B2JC 4ZUXD 3A6ND 4H9SA 2PYOD 3LJAC 1M1AB 1KX4C 1P3BA 4XZQA 5B33A 4J8VA 3AN2D 1P3LA 5BO0B 4E44A 3VH6T 3KWQD 3KFUG 5AV9D 1Z2CB 3MGRA 1M18B 5BNXB 1W2EA 1P34B 2G5HC 5B40C 1ULYA 2F8NA 5E5AC 4WNNB 3LZ1B 5GXQA 3WAAA 3AZND 3NQUA 3LELC 1F66C 5AV5A 4UPKA 4KGCC 1KX3B 3WA9A 5F99C 2ZY4A 1AOIB 1PZRA 1ZLAC 4ZUXC 3A6NC 5CPIA 5B31B 1HQ3A 4X23A 1P3PB 1T3UA 4KUDA 3W97A 1BFMA 2PYOC 5B31G 3C1BB 3AN2C 1P3MD 4H9OB 5FUGB 2AROB 3KWQC 5AV9C 2BYKB
chains in the Genus database with same CATH topology
5B0ZA 5B33D 4J8VD 3AZMB 3W96D 3AZNC 4H9RA 5AVCA 3W99A 3MGRD 1WWSA 3AZID 3UTBA 3AZKD 3B6FB 5G49B 3A1KA 4UUZA 5CP6D 3MGSC 4Z66A 2HIOD 2BYMA 2Y2IA 3VH5A 4J8WB 1P3AA 3KUYD 5CPID 4EO5C 1P3MC 2ZY5A 4WU8A 2JSSA 3W97D 3A1IA 3C1CB 5DNMD 3AV2B 1KX5B 3W96C 2J8PA 3MGRC 3AZIC 1HTAA 3AZKC 4H9NA 4NE6A 3KXBC 1ID3C 4QLCB 1N1JA 2YFVB 3VH6A 5CP6C 2HIOC 3AFAA 3AZLA 3TU4B 3REJD 3UTBD 2NQBB 4Z5TD 4CSRB 4J8XB 2NZDD 3KUYC 4YS3A 2XD5A 4R8PB 3VH5W 3MNNB 5DNMC 1P3AD 3AV1B 3IP4C 5B0YA 3RELB 3AZJB 3KSYA 3NQJB 5B2IB 5AV8D 3LJAA 1KX4A 5B1LD 3REJC 3UTBC 5KDMA 4Z5TC 3MGQB 2NZDC 3WTPD 5B40A 1B67A 5GT3D 3X1UD 5E5AA 4HGAC 1F66A 3LELA 3V9RA 4KGCA 3AZFB 5AY8D 5B24B 3X1SD 1P3AC 2DQNC 3MGPB 5F99A 4YS3D 3UTAB 3UT9B 1ZLAA 4ZUXA 3A6NA 1BH9B 3R45B 1U35D 5B1MD 2CV5D 5AV8C 2PYOA 5JRGB 4G92B 3X1VB 3LZ0B 2JCHA 3AN2A 5B0YD 5B1LC 3KWQA 5AV9A 3WTPC 1KX4D 5GT3C 3X1UC 5CPJD 3AZNA 5DNNB 3B6GD 5AY8C 3X1SC 4YS3C 2ZY3A 3O62B 3X1TC 1P3FA 1S32B 4NE3A 3MGSA 2XD1A 1U35C 5B1MC 5F99D 1TZYB 2CV5C 1JFIA 4WU9C 5CPKB 1P34D 3AZEB 1P3MA 5B0YC 2FJ7B 1P3GB 4DRBA 1KX3D 3REKB 1AOID 5CPJC 3W96A 5GSUB 3B6GC 4AWLB 3AZIA 5B31D 5B2JB 1P3PD 3AZKA 3KXBA 1ID3A 4WV4B 2YFWA 3AYWA 3MVDB 5CP6A 3C1BD 3AZHB 1P3OB 2HIOA 4LD9A 1P3FD 2AROD 1EQZD 1M18C 4J8UB 1P34C 3KUYA 3MGSD 1TAFB 3LZ1C 5DNMA 1KX3C 3WKJB 5B32B 4Z2MG 5AVBB 2ZM5A 4YM6A 5GT0B 1AOIC 5B32G 5B31C 1P3KB 3H0LC 1P3PC 4KHAB 4J8WD 1P3IB 2Y2GA 3MNNA 2LY8A 4CAYB 5JA4B 3C1BC 4JJNB 3B0CT 3REJA 3REHB 4XUJB 2AROC 4Z5TA 1P3FC 3KXBD 1ID3D 1EQZC 3W98B 2NZDA 2VQRA 3C1CD 3AYWD 3AV2D 4LD9D 3EPHA 4H9PB 2UWXA 5AV6B 2F2AC 4WZSB 4DRAA 1M19B 4H9QA 3REIB 5BNVB 5AV8A 4YM6D 4J8WC 3TU4D 2NQBD 4J8XD 5B1LA 3P5JB 4EO5B 5C3IC 3WTPA 3B0BA 3MNND 3C1CC 3AYWC 3AV2C 5GT3A 3X1UA 1P3BB 4XZQB 5B33B 4J8VB 1KX5C 4LD9C 3AV1D 1P3LB 2Y2HA 3AZGA 5AY8A 3X1SA 3MGRB 3X1TA 5B2ID 2F8NB 4QLCC 3B0DB 2L5AA 3WAAB 5GXQB 2Y2JA 2IO5B 3NQUB 5AV5B 5B1MA 1U35A 2F8NG 3TU4C 2CV5A 2NQBC 1BH8A 4YM6C 5CHLB 4WU9A 3WA9B 4J8XC 2W8SA 5CPIB 1HQ3B 4R8PC 4ZBJB 4X23B 4KUDB 3MNNC 3AZFD 3W97B 5B24D 5CPJA 3UTAD 3UT9D 3AV1C 1H3OA 3B6GA 1R4VA 3RELC 3AZJC 3VH6W 5B0ZB 5B2IC 5JRGD 1M1AA 3X1VD 3LZ0D 2ZY2A 2G5IC 3AZGD 4H9RB 5AVCB 3W99B 5BO0A 3X1TD 3AL0C 1M18A 3MGQC 3UTBB 5BNXA 1P34A 4UUZB 4WNNA 3LZ1A 4Z66B 2BYMB 5DNND 4WU9D 3AZHA 3AZFC 1KX3A 5B24C 3MGPC 3H0MC 1AOIA 2HUEB 3O62D 1P3AB 3UTAC 3UT9C 4WU8B 5B31A 3H0RC 1P3PA 4G91B 1TZYD 5JRGC 4G92C 5CPKD 3X1VC 3LZ0C 3C1BA 3AZGC 3AZED 4H9OA 5FUGA 2AROA 1EQZA 1P3GD 2BYKA 1M1AD 4H9NB 2F8NK 1N1JB 3REKD 3AZMA 3AFAB 5DNNC 3AZLB 1M18D 4NE5A 4XUJA 3O62C 3B6FA 4YS3B 2BG1A 3LZ1D 2CWEA 5G49A 3MVDD 3AZHD 1P3OD 1TZYC 4J8WA 2RVQD 4J8UD 5CPKC 3AZEC 3VH5T 5B0YB 1P3GC 3C1CA 1M1AC 3AV2A 3WKJD 1WWIA 5B32D 3LJAB 5AVBD 1KX4B 3REKC 5GT0D 1KX5A 5BT1D 4AWLC 1KU5A 5KDMB 2DF4C 1P3KD 3F6TA 5B40B 3AZMD 1P3ID 5E5AB 4QLCA 3MVDC 2YFVA 4JJND 3AZHC 1P3OC 3LELB 3V9RB 1F66B 4KGCB 3TU4A 2NQBA 3REHD 4XUJD 4CSRA 5F99B 4J8XA 3B6FD 2RVQC 4J8UC 3W98D 4M6BA 1ZLAB 4ZUXB 3A6NB 4R8PA 2JE5A 2Y2OA 2PYOB 3WKJC 5B32C 5AV6D 5AVBC 5GT0C 4E45A 3AN2B 1M19D 3AV1A 5BT1C 3KWQB 3EPKA 3RELA 5AV9B 3AZJA 1P3KC 3NQJA 5B2IA 3REID 3AZMC 1P3IC 5BS7A 1KX5D 4JJNC 4DQYB 3AZNB 3REHC 4XUJC 3B6FC 3MGQA 3W98C 1P3FB 4QLCD 1P3BD 4XZQD 3MGSB 1P3LD 3FDDA 3AZFA 5B24A 1JFIB 5AV6C 3MGPA 3UTAA 1M19C 3UT9A 1P3MB 2F8ND 4R8PD 1BH9A 3WAAD 5GXQD 3R45A 5AV5D 3REIC 5JRGA 3WA9D 3X1VA 2RIQA 3LZ0A 3W96B 3RELD 3AZJD 3AZIB 1HQ3D 4X23D 3AZKB 4H9SC 4KUDD 3KXBB 1ID3B 5C3IB 2YFWB 3AYWB 1P3BC 4XZQC 5B33C 5CP6B 4J8VC 2HIOB 2Y2PA 5DNNA 1P3LC 4LD9B 3MGQD 3O62A 5B0ZD 3KUYB 1S32A 3B0DC 3WAAC 5GXQC 2IO5C 3W99D 5AV5C 5AVCD 3MGPD 5DNMB 1TZYA 3WA9C 4YM6B 5CPKA 3AZEA 3EPJA 2Y2KA 4Z2MH 5CPIC 1HQ3C 4X23C 4ZBJC 4Z66D 1P3GA 2FJ7A 5BS7C 4KUDC 3W97C 3REKA 5GSUA 4WU8D 3REJB 4Z5TB 5B2JA 2NZDB 5B0ZC 3MVDA 4HGAB 1P3OA 5AVCC 3W99C 1A7WA 4J8UA 1S32D 3EG5B 1TAFA 1F1EA 4Z66C 4H9QB 3AFAD 3AZLD 5AV8B 3WKJA 5B32A 5AVBA 4NFTA 2HUEC 5GT0A 4WJ3C 2FJ7D 5B1LB 4WU8C 3B0CW 1P3KA 4G91C 4KHAA 3WTPB 5GT3B 3X1UB 1P3IA 4CAYA 5GSUD 5JA4A 4JJNA 5B2JD 3WTPE 5AY8B 3X1SB 3REHA 3AZGB 2Y2NA 3W98A 3X1TB 1Q9CA 1S32C 3LJAD 1B6WA 2Y2QA 3AFAC 1U35B 5B1MB 3AZLC 4H9PA 2CV5B 1BH8B 4WU9B 5AV6A 2F8NH 5B40D 3EPLA 1M19A 2FJ7C 5E5AD 2Y2LA 1F66D 2FFFB 3LELD 2Y2MA 4KGCD 3REIA 5BNVA 5GSUC 5CPJB 1ZLAD 1EQZB 1H3OB 3B6GB 5B2JC 4ZUXD 3A6ND 4H9SA 2PYOD 3LJAC 1M1AB 1KX4C 1P3BA 4XZQA 5B33A 4J8VA 3AN2D 1P3LA 5BO0B 4E44A 3VH6T 3KWQD 3KFUG 5AV9D 1Z2CB 3MGRA 1M18B 5BNXB 1W2EA 1P34B 2G5HC 5B40C 1ULYA 2F8NA 5E5AC 4WNNB 3LZ1B 5GXQA 3WAAA 3AZND 3NQUA 3LELC 1F66C 5AV5A 4UPKA 4KGCC 1KX3B 3WA9A 5F99C 2ZY4A 1AOIB 1PZRA 1ZLAC 4ZUXC 3A6NC 5CPIA 5B31B 1HQ3A 4X23A 1P3PB 1T3UA 4KUDA 3W97A 1BFMA 2PYOC 5B31G 3C1BB 3AN2C 1P3MD 4H9OB 5FUGB 2AROB 3KWQC 5AV9C 2BYKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Z A;  5B33 D;  4J8V D;  3AZM B;  3W96 D;  3AZN C;  4H9R A;  5AVC A;  3W99 A;  3MGR D;  1WWS A;  3AZI D;  3UTB A;  3AZK D;  3B6F B;  5G49 B;  4UUZ A;  5CP6 D;  3MGS C;  4Z66 A;  2HIO D;  2BYM A;  3VH5 A;  4J8W B;  1P3A A;  3KUY D;  5CPI D;  4EO5 C;  1P3M C;  4WU8 A;  2JSS A;  3W97 D;  3C1C B;  5DNM D;  3AV2 B;  1KX5 B;  3W96 C;  3MGR C;  3AZI C;  1HTA A;  3AZK C;  4H9N A;  4NE6 A;  3KXB C;  1ID3 C;  4QLC B;  1N1J A;  2YFV B;  3VH6 A;  5CP6 C;  2HIO C;  3AFA A;  3AZL A;  3TU4 B;  3REJ D;  3UTB D;  2NQB B;  4Z5T D;  4CSR B;  4J8X B;  2NZD D;  3KUY C;  4YS3 A;  4R8P B;  3VH5 W;  3MNN B;  5DNM C;  1P3A D;  3AV1 B;  5B0Y A;  3REL B;  3AZJ B;  3KSY A;  3NQJ B;  5B2I B;  5AV8 D;  3LJA A;  1KX4 A;  5B1L D;  3REJ C;  3UTB C;  5KDM A;  4Z5T C;  3MGQ B;  2NZD C;  3WTP D;  5B40 A;  1B67 A;  5GT3 D;  3X1U D;  5E5A A;  4HGA C;  1F66 A;  3LEL A;  3V9R A;  4KGC A;  3AZF B;  5AY8 D;  5B24 B;  3X1S D;  1P3A C;  3MGP B;  5F99 A;  4YS3 D;  3UTA B;  3UT9 B;  1ZLA A;  4ZUX A;  3A6N A;  1BH9 B;  3R45 B;  1U35 D;  5B1M D;  2CV5 D;  5AV8 C;  2PYO A;  5JRG B;  4G92 B;  3X1V B;  3LZ0 B;  3AN2 A;  5B0Y D;  5B1L C;  3KWQ A;  5AV9 A;  3WTP C;  1KX4 D;  5GT3 C;  3X1U C;  5CPJ D;  3AZN A;  5DNN B;  3B6G D;  5AY8 C;  3X1S C;  4YS3 C;  3O62 B;  3X1T C;  1P3F A;  1S32 B;  4NE3 A;  3MGS A;  1U35 C;  5B1M C;  5F99 D;  1TZY B;  2CV5 C;  1JFI A;  4WU9 C;  5CPK B;  1P34 D;  3AZE B;  1P3M A;  5B0Y C;  2FJ7 B;  1P3G B;  4DRB A;  1KX3 D;  3REK B;  1AOI D;  5CPJ C;  3W96 A;  5GSU B;  3B6G C;  4AWL B;  3AZI A;  5B31 D;  5B2J B;  1P3P D;  3AZK A;  3KXB A;  1ID3 A;  4WV4 B;  2YFW A;  3AYW A;  3MVD B;  5CP6 A;  3C1B D;  3AZH B;  1P3O B;  2HIO A;  4LD9 A;  1P3F D;  2ARO D;  1EQZ D;  1M18 C;  4J8U B;  1P34 C;  3KUY A;  3MGS D;  1TAF B;  3LZ1 C;  5DNM A;  1KX3 C;  3WKJ B;  5B32 B;  4Z2M G;  5AVB B;  1AOI C;  4YM6 A;  5GT0 B;  5B32 G;  5B31 C;  1P3K B;  1P3P C;  4KHA B;  4J8W D;  1P3I B;  3MNN A;  2LY8 A;  4CAY B;  5JA4 B;  3C1B C;  4JJN B;  3B0C T;  3REJ A;  3REH B;  4XUJ B;  2ARO C;  4Z5T A;  1P3F C;  3KXB D;  1ID3 D;  1EQZ C;  3W98 B;  2NZD A;  3C1C D;  3AYW D;  3AV2 D;  4LD9 D;  4H9P B;  5AV6 B;  4WZS B;  4DRA A;  1M19 B;  4H9Q A;  3REI B;  5BNV B;  5AV8 A;  4YM6 D;  4J8W C;  3TU4 D;  2NQB D;  4J8X D;  5B1L A;  4EO5 B;  5C3I C;  3WTP A;  3B0B A;  3MNN D;  3C1C C;  3AYW C;  3AV2 C;  3X1U A;  5GT3 A;  1P3B B;  4XZQ B;  5B33 B;  4J8V B;  1KX5 C;  4LD9 C;  3AV1 D;  1P3L B;  3AZG A;  5AY8 A;  3X1S A;  3MGR B;  3X1T A;  5B2I D;  2F8N B;  4QLC C;  3B0D B;  2L5A A;  3WAA B;  5GXQ B;  3NQU B;  2IO5 B;  1U35 A;  5AV5 B;  5B1M A;  2F8N G;  3TU4 C;  2CV5 A;  2NQB C;  1BH8 A;  4YM6 C;  5CHL B;  4WU9 A;  3WA9 B;  4J8X C;  5CPI B;  1HQ3 B;  4R8P C;  4ZBJ B;  4X23 B;  4KUD B;  3MNN C;  3AZF D;  3W97 B;  5B24 D;  5CPJ A;  3UTA D;  3UT9 D;  3AV1 C;  1H3O A;  3B6G A;  1R4V A;  3REL C;  3AZJ C;  3VH6 W;  5B0Z B;  5B2I C;  5JRG D;  1M1A A;  3X1V D;  3LZ0 D;  3AZG D;  4H9R B;  5AVC B;  3W99 B;  5BO0 A;  3X1T D;  1M18 A;  3MGQ C;  3UTB B;  5BNX A;  1P34 A;  4UUZ B;  4WNN A;  3LZ1 A;  4Z66 B;  2BYM B;  5DNN D;  4WU9 D;  3AZH A;  3AZF C;  1KX3 A;  5B24 C;  3MGP C;  1AOI A;  2HUE B;  3O62 D;  1P3A B;  3UTA C;  3UT9 C;  4WU8 B;  5B31 A;  1P3P A;  4G91 B;  1TZY D;  5JRG C;  4G92 C;  5CPK D;  3X1V C;  3LZ0 C;  3C1B A;  3AZG C;  3AZE D;  4H9O A;  5FUG A;  2ARO A;  1EQZ A;  1P3G D;  2BYK A;  1M1A D;  4H9N B;  2F8N K;  1N1J B;  3REK D;  3AZM A;  3AFA B;  5DNN C;  3AZL B;  1M18 D;  4NE5 A;  4XUJ A;  3O62 C;  3B6F A;  4YS3 B;  3LZ1 D;  2CWE A;  5G49 A;  3MVD D;  3AZH D;  1P3O D;  1TZY C;  4J8W A;  2RVQ D;  4J8U D;  5CPK C;  3AZE C;  3VH5 T;  5B0Y B;  1P3G C;  3C1C A;  1M1A C;  3AV2 A;  3WKJ D;  1WWI A;  5B32 D;  3LJA B;  5AVB D;  1KX4 B;  3REK C;  5GT0 D;  1KX5 A;  5BT1 D;  4AWL C;  1KU5 A;  5KDM B;  1P3K D;  5B40 B;  3AZM D;  1P3I D;  5E5A B;  4QLC A;  3MVD C;  2YFV A;  4JJN D;  3AZH C;  1P3O C;  3LEL B;  3V9R B;  1F66 B;  4KGC B;  3TU4 A;  2NQB A;  3REH D;  4XUJ D;  4CSR A;  5F99 B;  4J8X A;  3B6F D;  2RVQ C;  4J8U C;  3W98 D;  4M6B A;  1ZLA B;  4ZUX B;  3A6N B;  4R8P A;  2PYO B;  3WKJ C;  5B32 C;  5AV6 D;  5AVB C;  5GT0 C;  4E45 A;  3AN2 B;  1M19 D;  3AV1 A;  5BT1 C;  3KWQ B;  3REL A;  3AZJ A;  5AV9 B;  1P3K C;  3NQJ A;  5B2I A;  3REI D;  3AZM C;  1P3I C;  5BS7 A;  1KX5 D;  4JJN C;  3AZN B;  3REH C;  4XUJ C;  3B6F C;  3MGQ A;  3W98 C;  1P3F B;  4QLC D;  1P3B D;  4XZQ D;  3MGS B;  1P3L D;  3AZF A;  1JFI B;  5B24 A;  5AV6 C;  3MGP A;  3UTA A;  1M19 C;  3UT9 A;  1P3M B;  2F8N D;  4R8P D;  1BH9 A;  3WAA D;  5GXQ D;  3R45 A;  5AV5 D;  3REI C;  5JRG A;  3WA9 D;  3X1V A;  3LZ0 A;  3W96 B;  3REL D;  3AZJ D;  3AZI B;  1HQ3 D;  4X23 D;  3AZK B;  4H9S C;  4KUD D;  3KXB B;  1ID3 B;  5C3I B;  2YFW B;  3AYW B;  1P3B C;  4XZQ C;  5B33 C;  5CP6 B;  4J8V C;  2HIO B;  5DNN A;  1P3L C;  4LD9 B;  3MGQ D;  3O62 A;  5B0Z D;  3KUY B;  1S32 A;  3B0D C;  3WAA C;  5GXQ C;  2IO5 C;  3W99 D;  5AV5 C;  5AVC D;  3MGP D;  5DNM B;  1TZY A;  3WA9 C;  4YM6 B;  5CPK A;  3AZE A;  4Z2M H;  5CPI C;  1HQ3 C;  4X23 C;  4ZBJ C;  4Z66 D;  1P3G A;  2FJ7 A;  5BS7 C;  4KUD C;  3W97 C;  3REK A;  5GSU A;  4WU8 D;  3REJ B;  4Z5T B;  5B2J A;  2NZD B;  5B0Z C;  3MVD A;  4HGA B;  1P3O A;  5AVC C;  3W99 C;  1A7W A;  4J8U A;  1S32 D;  1TAF A;  1F1E A;  4Z66 C;  4H9Q B;  3AFA D;  3AZL D;  5AV8 B;  3WKJ A;  5B32 A;  5AVB A;  4NFT A;  2HUE C;  5GT0 A;  2FJ7 D;  5B1L B;  4WU8 C;  3B0C W;  1P3K A;  4G91 C;  4KHA A;  3WTP B;  5GT3 B;  3X1U B;  1P3I A;  4CAY A;  5GSU D;  5JA4 A;  4JJN A;  5B2J D;  3WTP E;  5AY8 B;  3X1S B;  3REH A;  3AZG B;  3W98 A;  3X1T B;  1Q9C A;  1S32 C;  3LJA D;  1B6W A;  3AFA C;  1U35 B;  5B1M B;  3AZL C;  4H9P A;  2CV5 B;  1BH8 B;  4WU9 B;  5AV6 A;  2F8N H;  5B40 D;  1M19 A;  2FJ7 C;  5E5A D;  1F66 D;  3LEL D;  4KGC D;  3REI A;  5BNV A;  5GSU C;  5CPJ B;  1ZLA D;  1EQZ B;  1H3O B;  3B6G B;  5B2J C;  4ZUX D;  3A6N D;  4H9S A;  2PYO D;  3LJA C;  1M1A B;  1KX4 C;  1P3B A;  4XZQ A;  5B33 A;  4J8V A;  3AN2 D;  1P3L A;  5BO0 B;  4E44 A;  3VH6 T;  3KWQ D;  5AV9 D;  1M18 B;  3MGR A;  5BNX B;  1P34 B;  5B40 C;  1ULY A;  2F8N A;  5E5A C;  4WNN B;  3LZ1 B;  5GXQ A;  3WAA A;  3AZN D;  3NQU A;  3LEL C;  1F66 C;  5AV5 A;  4KGC C;  1KX3 B;  3WA9 A;  5F99 C;  1AOI B;  1ZLA C;  4ZUX C;  3A6N C;  5CPI A;  5B31 B;  1HQ3 A;  4X23 A;  1P3P B;  4KUD A;  3W97 A;  1BFM A;  2PYO C;  5B31 G;  3C1B B;  3AN2 C;  1P3M D;  4H9O B;  5FUG B;  2ARO B;  3KWQ C;  5AV9 C;  2BYK B; 
#chains in the Genus database with same CATH topology
 5B0Z A;  5B33 D;  4J8V D;  3AZM B;  3W96 D;  3AZN C;  4H9R A;  5AVC A;  3W99 A;  3MGR D;  1WWS A;  3AZI D;  3UTB A;  3AZK D;  3B6F B;  5G49 B;  3A1K A;  4UUZ A;  5CP6 D;  3MGS C;  4Z66 A;  2HIO D;  2BYM A;  2Y2I A;  3VH5 A;  4J8W B;  1P3A A;  3KUY D;  5CPI D;  4EO5 C;  1P3M C;  2ZY5 A;  4WU8 A;  2JSS A;  3W97 D;  3A1I A;  3C1C B;  5DNM D;  3AV2 B;  1KX5 B;  3W96 C;  2J8P A;  3MGR C;  3AZI C;  1HTA A;  3AZK C;  4H9N A;  4NE6 A;  3KXB C;  1ID3 C;  4QLC B;  1N1J A;  2YFV B;  3VH6 A;  5CP6 C;  2HIO C;  3AFA A;  3AZL A;  3TU4 B;  3REJ D;  3UTB D;  2NQB B;  4Z5T D;  4CSR B;  4J8X B;  2NZD D;  3KUY C;  4YS3 A;  2XD5 A;  4R8P B;  3VH5 W;  3MNN B;  5DNM C;  1P3A D;  3AV1 B;  3IP4 C;  5B0Y A;  3REL B;  3AZJ B;  3KSY A;  3NQJ B;  5B2I B;  5AV8 D;  3LJA A;  1KX4 A;  5B1L D;  3REJ C;  3UTB C;  5KDM A;  4Z5T C;  3MGQ B;  2NZD C;  3WTP D;  5B40 A;  1B67 A;  5GT3 D;  3X1U D;  5E5A A;  4HGA C;  1F66 A;  3LEL A;  3V9R A;  4KGC A;  3AZF B;  5AY8 D;  5B24 B;  3X1S D;  1P3A C;  2DQN C;  3MGP B;  5F99 A;  4YS3 D;  3UTA B;  3UT9 B;  1ZLA A;  4ZUX A;  3A6N A;  1BH9 B;  3R45 B;  1U35 D;  5B1M D;  2CV5 D;  5AV8 C;  2PYO A;  5JRG B;  4G92 B;  3X1V B;  3LZ0 B;  2JCH A;  3AN2 A;  5B0Y D;  5B1L C;  3KWQ A;  5AV9 A;  3WTP C;  1KX4 D;  5GT3 C;  3X1U C;  5CPJ D;  3AZN A;  5DNN B;  3B6G D;  5AY8 C;  3X1S C;  4YS3 C;  2ZY3 A;  3O62 B;  3X1T C;  1P3F A;  1S32 B;  4NE3 A;  3MGS A;  2XD1 A;  1U35 C;  5B1M C;  5F99 D;  1TZY B;  2CV5 C;  1JFI A;  4WU9 C;  5CPK B;  1P34 D;  3AZE B;  1P3M A;  5B0Y C;  2FJ7 B;  1P3G B;  4DRB A;  1KX3 D;  3REK B;  1AOI D;  5CPJ C;  3W96 A;  5GSU B;  3B6G C;  4AWL B;  3AZI A;  5B31 D;  5B2J B;  1P3P D;  3AZK A;  3KXB A;  1ID3 A;  4WV4 B;  2YFW A;  3AYW A;  3MVD B;  5CP6 A;  3C1B D;  3AZH B;  1P3O B;  2HIO A;  4LD9 A;  1P3F D;  2ARO D;  1EQZ D;  1M18 C;  4J8U B;  1P34 C;  3KUY A;  3MGS D;  1TAF B;  3LZ1 C;  5DNM A;  1KX3 C;  3WKJ B;  5B32 B;  4Z2M G;  5AVB B;  2ZM5 A;  4YM6 A;  5GT0 B;  1AOI C;  5B32 G;  5B31 C;  1P3K B;  3H0L C;  1P3P C;  4KHA B;  4J8W D;  1P3I B;  2Y2G A;  3MNN A;  2LY8 A;  4CAY B;  5JA4 B;  3C1B C;  4JJN B;  3B0C T;  3REJ A;  3REH B;  4XUJ B;  2ARO C;  4Z5T A;  1P3F C;  3KXB D;  1ID3 D;  1EQZ C;  3W98 B;  2NZD A;  2VQR A;  3C1C D;  3AYW D;  3AV2 D;  4LD9 D;  3EPH A;  4H9P B;  2UWX A;  5AV6 B;  2F2A C;  4WZS B;  4DRA A;  1M19 B;  4H9Q A;  3REI B;  5BNV B;  5AV8 A;  4YM6 D;  4J8W C;  3TU4 D;  2NQB D;  4J8X D;  5B1L A;  3P5J B;  4EO5 B;  5C3I C;  3WTP A;  3B0B A;  3MNN D;  3C1C C;  3AYW C;  3AV2 C;  5GT3 A;  3X1U A;  1P3B B;  4XZQ B;  5B33 B;  4J8V B;  1KX5 C;  4LD9 C;  3AV1 D;  1P3L B;  2Y2H A;  3AZG A;  5AY8 A;  3X1S A;  3MGR B;  3X1T A;  5B2I D;  2F8N B;  4QLC C;  3B0D B;  2L5A A;  3WAA B;  5GXQ B;  2Y2J A;  2IO5 B;  3NQU B;  5AV5 B;  5B1M A;  1U35 A;  2F8N G;  3TU4 C;  2CV5 A;  2NQB C;  1BH8 A;  4YM6 C;  5CHL B;  4WU9 A;  3WA9 B;  4J8X C;  2W8S A;  5CPI B;  1HQ3 B;  4R8P C;  4ZBJ B;  4X23 B;  4KUD B;  3MNN C;  3AZF D;  3W97 B;  5B24 D;  5CPJ A;  3UTA D;  3UT9 D;  3AV1 C;  1H3O A;  3B6G A;  1R4V A;  3REL C;  3AZJ C;  3VH6 W;  5B0Z B;  5B2I C;  5JRG D;  1M1A A;  3X1V D;  3LZ0 D;  2ZY2 A;  2G5I C;  3AZG D;  4H9R B;  5AVC B;  3W99 B;  5BO0 A;  3X1T D;  3AL0 C;  1M18 A;  3MGQ C;  3UTB B;  5BNX A;  1P34 A;  4UUZ B;  4WNN A;  3LZ1 A;  4Z66 B;  2BYM B;  5DNN D;  4WU9 D;  3AZH A;  3AZF C;  1KX3 A;  5B24 C;  3MGP C;  3H0M C;  1AOI A;  2HUE B;  3O62 D;  1P3A B;  3UTA C;  3UT9 C;  4WU8 B;  5B31 A;  3H0R C;  1P3P A;  4G91 B;  1TZY D;  5JRG C;  4G92 C;  5CPK D;  3X1V C;  3LZ0 C;  3C1B A;  3AZG C;  3AZE D;  4H9O A;  5FUG A;  2ARO A;  1EQZ A;  1P3G D;  2BYK A;  1M1A D;  4H9N B;  2F8N K;  1N1J B;  3REK D;  3AZM A;  3AFA B;  5DNN C;  3AZL B;  1M18 D;  4NE5 A;  4XUJ A;  3O62 C;  3B6F A;  4YS3 B;  2BG1 A;  3LZ1 D;  2CWE A;  5G49 A;  3MVD D;  3AZH D;  1P3O D;  1TZY C;  4J8W A;  2RVQ D;  4J8U D;  5CPK C;  3AZE C;  3VH5 T;  5B0Y B;  1P3G C;  3C1C A;  1M1A C;  3AV2 A;  3WKJ D;  1WWI A;  5B32 D;  3LJA B;  5AVB D;  1KX4 B;  3REK C;  5GT0 D;  1KX5 A;  5BT1 D;  4AWL C;  1KU5 A;  5KDM B;  2DF4 C;  1P3K D;  3F6T A;  5B40 B;  3AZM D;  1P3I D;  5E5A B;  4QLC A;  3MVD C;  2YFV A;  4JJN D;  3AZH C;  1P3O C;  3LEL B;  3V9R B;  1F66 B;  4KGC B;  3TU4 A;  2NQB A;  3REH D;  4XUJ D;  4CSR A;  5F99 B;  4J8X A;  3B6F D;  2RVQ C;  4J8U C;  3W98 D;  4M6B A;  1ZLA B;  4ZUX B;  3A6N B;  4R8P A;  2JE5 A;  2Y2O A;  2PYO B;  3WKJ C;  5B32 C;  5AV6 D;  5AVB C;  5GT0 C;  4E45 A;  3AN2 B;  1M19 D;  3AV1 A;  5BT1 C;  3KWQ B;  3EPK A;  3REL A;  5AV9 B;  3AZJ A;  1P3K C;  3NQJ A;  5B2I A;  3REI D;  3AZM C;  1P3I C;  5BS7 A;  1KX5 D;  4JJN C;  4DQY B;  3AZN B;  3REH C;  4XUJ C;  3B6F C;  3MGQ A;  3W98 C;  1P3F B;  4QLC D;  1P3B D;  4XZQ D;  3MGS B;  1P3L D;  3FDD A;  3AZF A;  5B24 A;  1JFI B;  5AV6 C;  3MGP A;  3UTA A;  1M19 C;  3UT9 A;  1P3M B;  2F8N D;  4R8P D;  1BH9 A;  3WAA D;  5GXQ D;  3R45 A;  5AV5 D;  3REI C;  5JRG A;  3WA9 D;  3X1V A;  2RIQ A;  3LZ0 A;  3W96 B;  3REL D;  3AZJ D;  3AZI B;  1HQ3 D;  4X23 D;  3AZK B;  4H9S C;  4KUD D;  3KXB B;  1ID3 B;  5C3I B;  2YFW B;  3AYW B;  1P3B C;  4XZQ C;  5B33 C;  5CP6 B;  4J8V C;  2HIO B;  2Y2P A;  5DNN A;  1P3L C;  4LD9 B;  3MGQ D;  3O62 A;  5B0Z D;  3KUY B;  1S32 A;  3B0D C;  3WAA C;  5GXQ C;  2IO5 C;  3W99 D;  5AV5 C;  5AVC D;  3MGP D;  5DNM B;  1TZY A;  3WA9 C;  4YM6 B;  5CPK A;  3AZE A;  3EPJ A;  2Y2K A;  4Z2M H;  5CPI C;  1HQ3 C;  4X23 C;  4ZBJ C;  4Z66 D;  1P3G A;  2FJ7 A;  5BS7 C;  4KUD C;  3W97 C;  3REK A;  5GSU A;  4WU8 D;  3REJ B;  4Z5T B;  5B2J A;  2NZD B;  5B0Z C;  3MVD A;  4HGA B;  1P3O A;  5AVC C;  3W99 C;  1A7W A;  4J8U A;  1S32 D;  3EG5 B;  1TAF A;  1F1E A;  4Z66 C;  4H9Q B;  3AFA D;  3AZL D;  5AV8 B;  3WKJ A;  5B32 A;  5AVB A;  4NFT A;  2HUE C;  5GT0 A;  4WJ3 C;  2FJ7 D;  5B1L B;  4WU8 C;  3B0C W;  1P3K A;  4G91 C;  4KHA A;  3WTP B;  5GT3 B;  3X1U B;  1P3I A;  4CAY A;  5GSU D;  5JA4 A;  4JJN A;  5B2J D;  3WTP E;  5AY8 B;  3X1S B;  3REH A;  3AZG B;  2Y2N A;  3W98 A;  3X1T B;  1Q9C A;  1S32 C;  3LJA D;  1B6W A;  2Y2Q A;  3AFA C;  1U35 B;  5B1M B;  3AZL C;  4H9P A;  2CV5 B;  1BH8 B;  4WU9 B;  5AV6 A;  2F8N H;  5B40 D;  3EPL A;  1M19 A;  2FJ7 C;  5E5A D;  2Y2L A;  1F66 D;  2FFF B;  3LEL D;  2Y2M A;  4KGC D;  3REI A;  5BNV A;  5GSU C;  5CPJ B;  1ZLA D;  1EQZ B;  1H3O B;  3B6G B;  5B2J C;  4ZUX D;  3A6N D;  4H9S A;  2PYO D;  3LJA C;  1M1A B;  1KX4 C;  1P3B A;  4XZQ A;  5B33 A;  4J8V A;  3AN2 D;  1P3L A;  5BO0 B;  4E44 A;  3VH6 T;  3KWQ D;  3KFU G;  5AV9 D;  1Z2C B;  3MGR A;  1M18 B;  5BNX B;  1W2E A;  1P34 B;  2G5H C;  5B40 C;  1ULY A;  2F8N A;  5E5A C;  4WNN B;  3LZ1 B;  5GXQ A;  3WAA A;  3AZN D;  3NQU A;  3LEL C;  1F66 C;  5AV5 A;  4UPK A;  4KGC C;  1KX3 B;  3WA9 A;  5F99 C;  2ZY4 A;  1AOI B;  1PZR A;  1ZLA C;  4ZUX C;  3A6N C;  5CPI A;  5B31 B;  1HQ3 A;  4X23 A;  1P3P B;  1T3U A;  4KUD A;  3W97 A;  1BFM A;  2PYO C;  5B31 G;  3C1B B;  3AN2 C;  1P3M D;  4H9O B;  5FUG B;  2ARO B;  3KWQ C;  5AV9 C;  2BYK B; 
#chains in the Genus database with same CATH homology
 5B0Z A;  5B33 D;  4J8V D;  3AZM B;  3W96 D;  3AZN C;  4H9R A;  5AVC A;  3W99 A;  3MGR D;  1WWS A;  3AZI D;  3UTB A;  3AZK D;  3B6F B;  5G49 B;  3A1K A;  4UUZ A;  5CP6 D;  3MGS C;  4Z66 A;  2HIO D;  2BYM A;  2Y2I A;  3VH5 A;  4J8W B;  1P3A A;  3KUY D;  5CPI D;  4EO5 C;  1P3M C;  2ZY5 A;  4WU8 A;  2JSS A;  3W97 D;  3A1I A;  3C1C B;  5DNM D;  3AV2 B;  1KX5 B;  3W96 C;  2J8P A;  3MGR C;  3AZI C;  1HTA A;  3AZK C;  4H9N A;  4NE6 A;  3KXB C;  1ID3 C;  4QLC B;  1N1J A;  2YFV B;  3VH6 A;  5CP6 C;  2HIO C;  3AFA A;  3AZL A;  3TU4 B;  3REJ D;  3UTB D;  2NQB B;  4Z5T D;  4CSR B;  4J8X B;  2NZD D;  3KUY C;  4YS3 A;  2XD5 A;  4R8P B;  3VH5 W;  3MNN B;  5DNM C;  1P3A D;  3AV1 B;  3IP4 C;  5B0Y A;  3REL B;  3AZJ B;  3KSY A;  3NQJ B;  5B2I B;  5AV8 D;  3LJA A;  1KX4 A;  5B1L D;  3REJ C;  3UTB C;  5KDM A;  4Z5T C;  3MGQ B;  2NZD C;  3WTP D;  5B40 A;  1B67 A;  5GT3 D;  3X1U D;  5E5A A;  4HGA C;  1F66 A;  3LEL A;  3V9R A;  4KGC A;  3AZF B;  5AY8 D;  5B24 B;  3X1S D;  1P3A C;  2DQN C;  3MGP B;  5F99 A;  4YS3 D;  3UTA B;  3UT9 B;  1ZLA A;  4ZUX A;  3A6N A;  1BH9 B;  3R45 B;  1U35 D;  5B1M D;  2CV5 D;  5AV8 C;  2PYO A;  5JRG B;  4G92 B;  3X1V B;  3LZ0 B;  2JCH A;  3AN2 A;  5B0Y D;  5B1L C;  3KWQ A;  5AV9 A;  3WTP C;  1KX4 D;  5GT3 C;  3X1U C;  5CPJ D;  3AZN A;  5DNN B;  3B6G D;  5AY8 C;  3X1S C;  4YS3 C;  2ZY3 A;  3O62 B;  3X1T C;  1P3F A;  1S32 B;  4NE3 A;  3MGS A;  2XD1 A;  1U35 C;  5B1M C;  5F99 D;  1TZY B;  2CV5 C;  1JFI A;  4WU9 C;  5CPK B;  1P34 D;  3AZE B;  1P3M A;  5B0Y C;  2FJ7 B;  1P3G B;  4DRB A;  1KX3 D;  3REK B;  1AOI D;  5CPJ C;  3W96 A;  5GSU B;  3B6G C;  4AWL B;  3AZI A;  5B31 D;  5B2J B;  1P3P D;  3AZK A;  3KXB A;  1ID3 A;  4WV4 B;  2YFW A;  3AYW A;  3MVD B;  5CP6 A;  3C1B D;  3AZH B;  1P3O B;  2HIO A;  4LD9 A;  1P3F D;  2ARO D;  1EQZ D;  1M18 C;  4J8U B;  1P34 C;  3KUY A;  3MGS D;  1TAF B;  3LZ1 C;  5DNM A;  1KX3 C;  3WKJ B;  5B32 B;  4Z2M G;  5AVB B;  2ZM5 A;  4YM6 A;  5GT0 B;  1AOI C;  5B32 G;  5B31 C;  1P3K B;  3H0L C;  1P3P C;  4KHA B;  4J8W D;  1P3I B;  2Y2G A;  3MNN A;  2LY8 A;  4CAY B;  5JA4 B;  3C1B C;  4JJN B;  3B0C T;  3REJ A;  3REH B;  4XUJ B;  2ARO C;  4Z5T A;  1P3F C;  3KXB D;  1ID3 D;  1EQZ C;  3W98 B;  2NZD A;  2VQR A;  3C1C D;  3AYW D;  3AV2 D;  4LD9 D;  3EPH A;  4H9P B;  2UWX A;  5AV6 B;  2F2A C;  4WZS B;  4DRA A;  1M19 B;  4H9Q A;  3REI B;  5BNV B;  5AV8 A;  4YM6 D;  4J8W C;  3TU4 D;  2NQB D;  4J8X D;  5B1L A;  3P5J B;  4EO5 B;  5C3I C;  3WTP A;  3B0B A;  3MNN D;  3C1C C;  3AYW C;  3AV2 C;  5GT3 A;  3X1U A;  1P3B B;  4XZQ B;  5B33 B;  4J8V B;  1KX5 C;  4LD9 C;  3AV1 D;  1P3L B;  2Y2H A;  3AZG A;  5AY8 A;  3X1S A;  3MGR B;  3X1T A;  5B2I D;  2F8N B;  4QLC C;  3B0D B;  2L5A A;  3WAA B;  5GXQ B;  2Y2J A;  2IO5 B;  3NQU B;  5AV5 B;  5B1M A;  1U35 A;  2F8N G;  3TU4 C;  2CV5 A;  2NQB C;  1BH8 A;  4YM6 C;  5CHL B;  4WU9 A;  3WA9 B;  4J8X C;  2W8S A;  5CPI B;  1HQ3 B;  4R8P C;  4ZBJ B;  4X23 B;  4KUD B;  3MNN C;  3AZF D;  3W97 B;  5B24 D;  5CPJ A;  3UTA D;  3UT9 D;  3AV1 C;  1H3O A;  3B6G A;  1R4V A;  3REL C;  3AZJ C;  3VH6 W;  5B0Z B;  5B2I C;  5JRG D;  1M1A A;  3X1V D;  3LZ0 D;  2ZY2 A;  2G5I C;  3AZG D;  4H9R B;  5AVC B;  3W99 B;  5BO0 A;  3X1T D;  3AL0 C;  1M18 A;  3MGQ C;  3UTB B;  5BNX A;  1P34 A;  4UUZ B;  4WNN A;  3LZ1 A;  4Z66 B;  2BYM B;  5DNN D;  4WU9 D;  3AZH A;  3AZF C;  1KX3 A;  5B24 C;  3MGP C;  3H0M C;  1AOI A;  2HUE B;  3O62 D;  1P3A B;  3UTA C;  3UT9 C;  4WU8 B;  5B31 A;  3H0R C;  1P3P A;  4G91 B;  1TZY D;  5JRG C;  4G92 C;  5CPK D;  3X1V C;  3LZ0 C;  3C1B A;  3AZG C;  3AZE D;  4H9O A;  5FUG A;  2ARO A;  1EQZ A;  1P3G D;  2BYK A;  1M1A D;  4H9N B;  2F8N K;  1N1J B;  3REK D;  3AZM A;  3AFA B;  5DNN C;  3AZL B;  1M18 D;  4NE5 A;  4XUJ A;  3O62 C;  3B6F A;  4YS3 B;  2BG1 A;  3LZ1 D;  2CWE A;  5G49 A;  3MVD D;  3AZH D;  1P3O D;  1TZY C;  4J8W A;  2RVQ D;  4J8U D;  5CPK C;  3AZE C;  3VH5 T;  5B0Y B;  1P3G C;  3C1C A;  1M1A C;  3AV2 A;  3WKJ D;  1WWI A;  5B32 D;  3LJA B;  5AVB D;  1KX4 B;  3REK C;  5GT0 D;  1KX5 A;  5BT1 D;  4AWL C;  1KU5 A;  5KDM B;  2DF4 C;  1P3K D;  3F6T A;  5B40 B;  3AZM D;  1P3I D;  5E5A B;  4QLC A;  3MVD C;  2YFV A;  4JJN D;  3AZH C;  1P3O C;  3LEL B;  3V9R B;  1F66 B;  4KGC B;  3TU4 A;  2NQB A;  3REH D;  4XUJ D;  4CSR A;  5F99 B;  4J8X A;  3B6F D;  2RVQ C;  4J8U C;  3W98 D;  4M6B A;  1ZLA B;  4ZUX B;  3A6N B;  4R8P A;  2JE5 A;  2Y2O A;  2PYO B;  3WKJ C;  5B32 C;  5AV6 D;  5AVB C;  5GT0 C;  4E45 A;  3AN2 B;  1M19 D;  3AV1 A;  5BT1 C;  3KWQ B;  3EPK A;  3REL A;  5AV9 B;  3AZJ A;  1P3K C;  3NQJ A;  5B2I A;  3REI D;  3AZM C;  1P3I C;  5BS7 A;  1KX5 D;  4JJN C;  4DQY B;  3AZN B;  3REH C;  4XUJ C;  3B6F C;  3MGQ A;  3W98 C;  1P3F B;  4QLC D;  1P3B D;  4XZQ D;  3MGS B;  1P3L D;  3FDD A;  3AZF A;  5B24 A;  1JFI B;  5AV6 C;  3MGP A;  3UTA A;  1M19 C;  3UT9 A;  1P3M B;  2F8N D;  4R8P D;  1BH9 A;  3WAA D;  5GXQ D;  3R45 A;  5AV5 D;  3REI C;  5JRG A;  3WA9 D;  3X1V A;  2RIQ A;  3LZ0 A;  3W96 B;  3REL D;  3AZJ D;  3AZI B;  1HQ3 D;  4X23 D;  3AZK B;  4H9S C;  4KUD D;  3KXB B;  1ID3 B;  5C3I B;  2YFW B;  3AYW B;  1P3B C;  4XZQ C;  5B33 C;  5CP6 B;  4J8V C;  2HIO B;  2Y2P A;  5DNN A;  1P3L C;  4LD9 B;  3MGQ D;  3O62 A;  5B0Z D;  3KUY B;  1S32 A;  3B0D C;  3WAA C;  5GXQ C;  2IO5 C;  3W99 D;  5AV5 C;  5AVC D;  3MGP D;  5DNM B;  1TZY A;  3WA9 C;  4YM6 B;  5CPK A;  3AZE A;  3EPJ A;  2Y2K A;  4Z2M H;  5CPI C;  1HQ3 C;  4X23 C;  4ZBJ C;  4Z66 D;  1P3G A;  2FJ7 A;  5BS7 C;  4KUD C;  3W97 C;  3REK A;  5GSU A;  4WU8 D;  3REJ B;  4Z5T B;  5B2J A;  2NZD B;  5B0Z C;  3MVD A;  4HGA B;  1P3O A;  5AVC C;  3W99 C;  1A7W A;  4J8U A;  1S32 D;  3EG5 B;  1TAF A;  1F1E A;  4Z66 C;  4H9Q B;  3AFA D;  3AZL D;  5AV8 B;  3WKJ A;  5B32 A;  5AVB A;  4NFT A;  2HUE C;  5GT0 A;  4WJ3 C;  2FJ7 D;  5B1L B;  4WU8 C;  3B0C W;  1P3K A;  4G91 C;  4KHA A;  3WTP B;  5GT3 B;  3X1U B;  1P3I A;  4CAY A;  5GSU D;  5JA4 A;  4JJN A;  5B2J D;  3WTP E;  5AY8 B;  3X1S B;  3REH A;  3AZG B;  2Y2N A;  3W98 A;  3X1T B;  1Q9C A;  1S32 C;  3LJA D;  1B6W A;  2Y2Q A;  3AFA C;  1U35 B;  5B1M B;  3AZL C;  4H9P A;  2CV5 B;  1BH8 B;  4WU9 B;  5AV6 A;  2F8N H;  5B40 D;  3EPL A;  1M19 A;  2FJ7 C;  5E5A D;  2Y2L A;  1F66 D;  2FFF B;  3LEL D;  2Y2M A;  4KGC D;  3REI A;  5BNV A;  5GSU C;  5CPJ B;  1ZLA D;  1EQZ B;  1H3O B;  3B6G B;  5B2J C;  4ZUX D;  3A6N D;  4H9S A;  2PYO D;  3LJA C;  1M1A B;  1KX4 C;  1P3B A;  4XZQ A;  5B33 A;  4J8V A;  3AN2 D;  1P3L A;  5BO0 B;  4E44 A;  3VH6 T;  3KWQ D;  3KFU G;  5AV9 D;  1Z2C B;  3MGR A;  1M18 B;  5BNX B;  1W2E A;  1P34 B;  2G5H C;  5B40 C;  1ULY A;  2F8N A;  5E5A C;  4WNN B;  3LZ1 B;  5GXQ A;  3WAA A;  3AZN D;  3NQU A;  3LEL C;  1F66 C;  5AV5 A;  4UPK A;  4KGC C;  1KX3 B;  3WA9 A;  5F99 C;  2ZY4 A;  1AOI B;  1PZR A;  1ZLA C;  4ZUX C;  3A6N C;  5CPI A;  5B31 B;  1HQ3 A;  4X23 A;  1P3P B;  1T3U A;  4KUD A;  3W97 A;  1BFM A;  2PYO C;  5B31 G;  3C1B B;  3AN2 C;  1P3M D;  4H9O B;  5FUG B;  2ARO B;  3KWQ C;  5AV9 C;  2BYK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...