2FJ7D

Crystal structure of nucleosome core particle containing a poly (da.dt) sequence element
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
93
structure length
93
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 147 bp DNA containing 16 bp poly dA element
publication title Nucleosome Core Particles Containing a Poly(dA.dT) Sequence Element Exhibit a Locally Distorted DNA Structure.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2fj7D00
1KX3C 3MGSC 4H9NA 3LZ1B 4WU9B 3WAAA 1P3AB 5F99A 4E44A 5GT0D 2NQBD 3B6GB 3AZLA 4ZUXC 1P3LA 5BNXB 1HQ3B 3REJB 1P3MB 4Z2MH 4YM6C 4KUDD 1S32B 5B33D 5AV6D 4LD9C 5BO0A 2YFVA 3AZMC 5B31A 4WU8A 3KWQC 5DNMC 4J8XC 3AV1D 3WKJD 2IO5C 3MGQA 5AVBC 1P34B 4KHAA 4R8PB 3X1VB 3WA9C 2CWEA 3X1SC 1TZYA 3NQJB 4J8WC 5B0ZC 1F1EA 1P3GC 3B6FB 3WAAD 5F99D 5GXQA 1N1JA 5JRGC 3MGRC 2HIOB 4JJNB 3AN2B 3B0DB 3AZNB 3AZLD 5CPIC 3AZKA 3REKA 3MGSA 3UT9B 1P3LD 1P3BA 1ZLAC 3MGPB 5B2JB 3VH6T 5B31D 5B40C 3W96A 3AZGD 5B32A 3C1CB 4WZSB 4WU8D 4YS3C 3VH6A 5AV9C 1M19C 1P3IB 3MGQD 5KDMB 1P3OB 2RVQD 3MVDB 5B24C 2F8NB 3AV2B 3KUYB 1TZYD 1ID3A 3KWQA 5GXQD 3AZKD 5AVBA 3MGSD 3REKD 5GT3C 3AZFC 1B67A 4G92C 5CP6B 1P3BD 2PYOB 5GT0C 3X1SA 3AZIA 1M18A 1P3PC 3W96D 3UTBA 5AY8B 1KX4A 3UTAB 3R45A 5BNVA 3KXBB 5B33C 5AV6C 1EQZC 3W98B 5B2IA 5CPJA 4X23A 3AV1C 3WKJC 1P3KB 2NZDB 1ID3D 4WNNA 3KWQD 5DNMD 5C3IB 3TU4A 1F66A 3AZHB 3AZJB 5AVBD 4XUJA 2F8NH 3RELA 5B24A 5F99C 1KU5A 5JA4A 3VH5T 3X1SD 3AZID 1M18D 3W99B 5B1LA 2CV5C 1P3LC 4Z2MG 4NE5A 3UTBD 1KX4D 4H9QA 5BS7A 3X1TA 5GT3A 3AFAA 5DNNB 3AZFA 2NQBB 5B31C 3MNNA 3A6NA 5CPKC 4XZQB 4WU8C 4X23D 4H9RB 1P3PA 4NE6A 5B40D 1KX5B 4QLCB 4KUDB 3MGQC 3X1UB 5AVCA 2RVQC 5E5AC 5G49B 4Z5TA 4WU9C 3TU4D 1F66D 2AROA 4XUJD 3O62B 3RELD 1Q9CA 4H9PA 5B24D 3REHB 5GXQC 1H3OB 4J8VB 4NFTA 3REKC 5B1LD 5AV5A 4J8UA 2FJ7A 1WWSA 3WTPB 1P3BC 5B0YB 3X1TD 4UUZA 5GT3D 3AFAD 3AZFD 3AZLB 1BH8A 3W96C 3MNND 5B32C 5B1MC 3W97A 4Z66C 1P3PD 2CV5A 5GSUB 5AVCD 1U35B 4Z5TD 3AZGB 1M1AB 2AROD 5B32G 2BYMB 1EQZD 3AYWA 3REIB 5CPKA 1ID3C 4CAYB 2JSSA 3C1BC 4KGCB 1AOIB 5E5AA 3LZ1A 4J8UD 4WU9A 2FJ7D 3LJAB 1N1JB 3AZIC 1M18C 4H9OB 3B6GA 3AZEC 3AZKB 1KX3B 3UTBC 1KX4C 5BNXA 1HQ3A 3W97D 3REJA 1P3MA 2CV5D 1BH9B 1S32A 1HTAA 5B2IC 4ZBJC 5CPJC 4X23C 3AYWD 4ZUXB 5B1MA 5CPKD 4Z66A 4G91B 2HUEC 4YM6B 3TU4C 1F66C 2F8NG 3NQUB 4LD9B 1R4VA 3AZMB 5BT1C 5E5AD 4XUJC 4R8PA 3RELC 3LZ1D 4WU9D 3NQJA 3B6FA 3KWQB 5DNMB 4J8XB 2IO5B 2HIOA 4JJNA 3B6GD 5B1LC 3AZNA 5AVBB 3UT9A 5AV8C 3C1BA 5BS7C 3REJD 1P3MD 3X1TC 3AFAC 3WA9B 3X1SB 1S32D 4J8WB 5B0ZB 3MGPA 5B2JA 2BYKB 3MNNC 3A6NC 1P3GB 5JRGB 3MGRB 3C1CA 4AWLC 3AZEA 5CPIB 5B32D 5B1MD 5C3IC 1JFIB 5FUGB 5AVCC 4Z66D 5KDMA 4Z5TC 1P3OA 3MVDA 4EO5C 2AROC 1ZLAB 3LZ0C 2F8NA 3AV2A 5B40B 4E45A 3B6FD 4YS3B 5AV9B 1M19B 2HIOD 4JJND 4HGAC 3AZND 3UT9D 5AV5C 4J8UC 2FJ7C 3C1BD 1P3FC 5B24B 3LELC 5CP6A 4DRAA 4M6BA 2PYOA 3MGPD 5B2JD 1KX5C 3W97C 3C1CD 5AY8A 3UTAA 4DRBA 3AZED 5AV8A 5GT3B 3KXBA 3AZFB 4G92B 1P3OD 4WV4B 5GT0B 3MVDD 5B2ID 5CPJD 3AYWC 2F8ND 1P3KA 3AV2D 1TAFB 2NZDA 5B33B 5AV6B 3AZJA 1EQZB 4CSRB 3LZ1C 1P3AC 3AV1B 5CP6D 3WKJB 3LZ0A 5BT1D 2PYOD 3B6GC 3W99A 1HQ3C 4H9NB 3REJC 1P3MC 5AY8D 3UTAD 5AV8D 1S32C 3WAAB 3KXBD 5DNNA 1P3FA 3LELA 5F99B 4XZQA 4H9RA 3A6ND 3KSYA 2CV5B 1P3LB 1KX5A 1B6WA 4QLCA 2NZDD 3X1UA 1P34C 5G49A 5CHLB 2YFVB 5BO0B 4R8PC 5B31B 3X1VC 3AZJD 2YFWA 3O62A 3V9RA 4WU8B 3B6FC 3REHA 3LZ0D 1H3OA 2HIOC 4JJNC 4J8VA 3AN2C 3B0DC 3MGQB 3W99D 3AZNC 3UT9C 5E5AB 4KHAB 3WTPA 5B0YA 5AV5D 1TZYB 3MGPC 5DNND 5B2JC 1P3AA 1P3FD 3LELD 5GXQB 3C1CC 4XZQD 3REKB 3MGSB 4G91C 1P3IC 1KX5D 4QLCD 3X1UD 5GSUA 1P3OC 1P3BB 1U35A 3MVDC 3AZGA 1M1AA 2BYMA 3AV2C 3KUYC 3W96B 5B32B 5B1MB 3O62D 3REIA 4Z66B 4CAYA 3REHD 4J8VD 4KGCA 4H9SC 1AOIA 1P34A 5CP6C 2LY8A 3WTPD 3LJAA 3X1VA 2PYOC 5B0YD 1ID3B 2F8NK 1P3AD 1WWIA 4H9OA 1KX3A 4NE3A 5AY8C 3AN2A 3C1BB 3UTAC 3KXBC 1HQ3D 1BH9A 3W98C 5GSUD 1U35D 3AZIB 1M18B 1M1AD 1P3KC 3AZEB 4ZUXA 3UTBB 2NZDC 3REID 1KX4B 1BFMA 3R45B 3VH6W 5BNVB 1A7WA 1P3IA 4YM6A 3AZHC 3AZJC 4KGCD 5B2IB 3NQUA 1ULYA 4ZBJB 3AZMA 5CPJB 1AOID 1P34D 4LD9A 4X23B 3LJAD 4R8PD 3X1VD 4J8XA 5DNMA 3KUYA 3W99C 4WNNB 1KX3D 2HUEB 3TU4B 3AN2D 1F66B 4H9SA 4XUJB 5DNNC 3RELB 3WA9A 2NQBC 4J8WA 5JA4B 5B0ZA 1P3GA 2BYKA 4XZQC 5JRGA 3MGRA 3WTPE 5B1LB 5CPIA 4QLCC 4ZUXD 5AV8B 4KUDC 1JFIA 3X1UC 5FUGA 4H9QB 3X1TB 3AFAB 1P3ID 4YM6D 1ZLAA 3W98A 4LD9D 3MNNB 3A6NB 3AZMD 3O62C 5B40A 3REHC 1P3PB 4AWLB 4YS3A 4J8XD 3KUYD 4J8VC 5AV9A 1M19A 5AVCB 4Z5TB 3WAAC 4EO5B 3WTPC 2AROB 3AZHA 5B0YC 3LZ0B 3WA9D 2L5AA 4H9PB 4J8WD 3AZLC 5B0ZD 1P3GD 5JRGD 3MGRD 3B0CT 3VH5A 4HGAB 5CPID 3VH5W 5AV5B 4J8UB 2FJ7B 5GSUC 1P3FB 3LELB 1U35C 4UUZB 3AZGC 1M1AC 3B0CW 5GT0A 1ZLAD 2NQBA 3W98D 1BH8B 3REIC 1TAFA 3W97B 1P3KD 4YS3D 4KUDA 5AV9D 3B0BA 5B31G 1M19D 5B33A 5AV6A 1AOIC 4KGCC 1EQZA 4CSRA 1TZYC 2YFWB 3V9RB 3LJAC 3AZHD 3AV1A 3AYWB 3WKJA 5CPKB 3AZKC
chains in the Genus database with same CATH superfamily
1KX3C 3MGSC 2W8SA 4H9NA 3EPJA 2G5IC 3LZ1B 4WU9B 3WAAA 1P3AB 5F99A 4E44A 2ZY3A 1PZRA 5GT0D 2NQBD 4DQYB 3B6GB 3AZLA 4ZUXC 1P3LA 5BNXB 1HQ3B 3REJB 1P3MB 3F6TA 2DF4C 4Z2MH 4YM6C 4KUDD 1S32B 5B33D 5AV6D 4LD9C 5BO0A 2YFVA 3AZMC 5B31A 4WU8A 3KWQC 5DNMC 4J8XC 3AV1D 3WKJD 2IO5C 3MGQA 5AVBC 1P34B 3AL0C 4KHAA 4R8PB 3X1VB 3WA9C 2CWEA 3X1SC 1TZYA 3NQJB 4J8WC 5B0ZC 1F1EA 1P3GC 3B6FB 3WAAD 5F99D 5GXQA 1N1JA 5JRGC 3MGRC 2HIOB 4JJNB 3AN2B 3B0DB 3AZNB 3AZLD 5CPIC 3AZKA 3REKA 3MGSA 3UT9B 1P3LD 1P3BA 1ZLAC 2JCHA 3MGPB 5B2JB 3VH6T 5B31D 5B40C 3W96A 3AZGD 5B32A 3C1CB 4WZSB 4WU8D 4YS3C 3VH6A 5AV9C 1M19C 1P3IB 3MGQD 2JE5A 5KDMB 1P3OB 2RVQD 2DQNC 3MVDB 5B24C 2F8NB 3AV2B 3KUYB 1TZYD 1ID3A 3KWQA 5GXQD 3AZKD 5AVBA 3MGSD 3REKD 5GT3C 3FDDA 3AZFC 1B67A 2Y2OA 4G92C 5CP6B 1P3BD 2PYOB 5GT0C 3X1SA 3AZIA 1M18A 2ZM5A 1P3PC 3W96D 3UTBA 5AY8B 1KX4A 3UTAB 3R45A 5BNVA 3IP4C 3KXBB 5B33C 5AV6C 1EQZC 3W98B 5B2IA 5CPJA 4X23A 3AV1C 3WKJC 1P3KB 3H0MC 2NZDB 1ID3D 4WNNA 3KWQD 5DNMD 5C3IB 3TU4A 1F66A 3AZHB 3AZJB 5AVBD 4XUJA 2F8NH 3RELA 5B24A 5F99C 1KU5A 5JA4A 3VH5T 3X1SD 3AZID 1M18D 3W99B 5B1LA 2CV5C 1P3LC 4Z2MG 3EPHA 4NE5A 3UTBD 1KX4D 4H9QA 5BS7A 3X1TA 5GT3A 3AFAA 5DNNB 3AZFA 2NQBB 5B31C 3MNNA 3A6NA 5CPKC 4XZQB 4WU8C 4X23D 4H9RB 1P3PA 4NE6A 5B40D 1KX5B 4QLCB 4KUDB 3MGQC 3X1UB 5AVCA 2RVQC 5E5AC 5G49B 4Z5TA 4WU9C 3TU4D 1F66D 2AROA 4XUJD 3O62B 1W2EA 3RELD 1Q9CA 4H9PA 5B24D 3REHB 5GXQC 1H3OB 4WJ3C 4J8VB 4NFTA 3REKC 5B1LD 5AV5A 4J8UA 2FJ7A 1WWSA 3WTPB 1P3BC 5B0YB 3X1TD 4UUZA 5GT3D 3AFAD 3H0RC 3AZFD 3AZLB 1BH8A 3W96C 3MNND 5B32C 5B1MC 3W97A 4Z66C 1P3PD 2CV5A 5GSUB 5AVCD 1U35B 4Z5TD 3AZGB 1M1AB 2AROD 5B32G 2BYMB 1EQZD 3AYWA 3REIB 5CPKA 1ID3C 4CAYB 2JSSA 3C1BC 4KGCB 1AOIB 5E5AA 3LZ1A 4J8UD 4WU9A 2FJ7D 3LJAB 3A1IA 1N1JB 3AZIC 1M18C 4H9OB 3B6GA 3AZEC 3AZKB 1KX3B 3UTBC 1KX4C 5BNXA 1HQ3A 3W97D 3REJA 1P3MA 2CV5D 1BH9B 1S32A 1HTAA 5B2IC 4ZBJC 5CPJC 4X23C 3AYWD 4ZUXB 5B1MA 5CPKD 4Z66A 4G91B 2HUEC 4YM6B 3TU4C 1F66C 2F8NG 2ZY5A 3NQUB 4LD9B 1R4VA 3AZMB 5BT1C 5E5AD 4XUJC 2XD5A 4R8PA 3RELC 3LZ1D 4WU9D 3NQJA 3B6FA 3KWQB 5DNMB 4J8XB 2IO5B 2HIOA 4JJNA 3B6GD 5B1LC 3AZNA 5AVBB 3UT9A 5AV8C 3P5JB 2Y2KA 3C1BA 5BS7C 3REJD 1P3MD 3X1TC 3AFAC 3WA9B 2Y2NA 2Y2JA 3X1SB 1S32D 4J8WB 5B0ZB 3MGPA 5B2JA 2BYKB 3MNNC 3A6NC 1P3GB 5JRGB 3MGRB 3C1CA 4AWLC 3AZEA 5CPIB 5B32D 5B1MD 5C3IC 1JFIB 5FUGB 5AVCC 4Z66D 2BG1A 5KDMA 4Z5TC 1P3OA 3MVDA 4EO5C 2AROC 1ZLAB 3LZ0C 2F8NA 3AV2A 5B40B 4E45A 3B6FD 4YS3B 5AV9B 1M19B 2HIOD 4JJND 4HGAC 3AZND 3UT9D 5AV5C 4J8UC 2FJ7C 3C1BD 1P3FC 5B24B 3LELC 5CP6A 4DRAA 4M6BA 2PYOA 3MGPD 5B2JD 1KX5C 2Y2IA 3W97C 3C1CD 5AY8A 3UTAA 4DRBA 3AZED 3A1KA 5AV8A 5GT3B 3KXBA 3AZFB 4G92B 1P3OD 4WV4B 5GT0B 3MVDD 5B2ID 5CPJD 3AYWC 2F8ND 1P3KA 3AV2D 1TAFB 3EPKA 2NZDA 5B33B 5AV6B 3AZJA 1EQZB 4CSRB 3LZ1C 1P3AC 3AV1B 5CP6D 2FFFB 3LZ0A 5BT1D 3WKJB 2PYOD 3B6GC 3W99A 1HQ3C 4H9NB 3REJC 1P3MC 5AY8D 3UTAD 5AV8D 1S32C 3WAAB 3KXBD 5DNNA 1P3FA 3LELA 5F99B 4XZQA 4H9RA 3A6ND 3KSYA 2CV5B 1P3LB 1KX5A 1B6WA 4QLCA 2NZDD 3X1UA 1P34C 2Y2MA 2VQRA 5G49A 5CHLB 2YFVB 5BO0B 2J8PA 4R8PC 5B31B 3X1VC 3AZJD 2YFWA 3O62A 3V9RA 4WU8B 3B6FC 3REHA 3LZ0D 1H3OA 2HIOC 4JJNC 2Y2GA 2Y2LA 4J8VA 3B0DC 3MGQB 3AN2C 3W99D 3AZNC 3H0LC 3UT9C 5E5AB 4KHAB 3WTPA 5B0YA 5AV5D 1TZYB 3MGPC 5DNND 5B2JC 1P3AA 1P3FD 3LELD 5GXQB 3C1CC 4XZQD 2ZY2A 3MGSB 3REKB 4G91C 1P3IC 1KX5D 4QLCD 3X1UD 5GSUA 1P3OC 1P3BB 1U35A 3MVDC 3AZGA 1M1AA 2BYMA 3AV2C 3KUYC 3W96B 5B32B 5B1MB 3O62D 3REIA 4Z66B 4CAYA 3REHD 4J8VD 2UWXA 4KGCA 4H9SC 1AOIA 1P34A 5CP6C 2LY8A 3WTPD 3LJAA 3X1VA 2PYOC 5B0YD 1ID3B 2F8NK 1P3AD 1WWIA 4H9OA 1KX3A 4NE3A 5AY8C 3AN2A 3C1BB 3UTAC 3KXBC 1HQ3D 1BH9A 3W98C 5GSUD 2RIQA 1U35D 3AZIB 1M18B 1M1AD 1P3KC 3AZEB 4ZUXA 3UTBB 2NZDC 3REID 1KX4B 1BFMA 3R45B 3VH6W 5BNVB 1A7WA 2Y2QA 4UPKA 1P3IA 4YM6A 3AZHC 3AZJC 2Y2PA 4KGCD 5B2IB 3NQUA 1ULYA 4ZBJB 3AZMA 5CPJB 1AOID 1P34D 4LD9A 4X23B 3LJAD 4R8PD 3X1VD 4J8XA 5DNMA 3KUYA 3W99C 3EG5B 4WNNB 1KX3D 2HUEB 3TU4B 3AN2D 1F66B 4H9SA 4XUJB 5DNNC 3RELB 3WA9A 2NQBC 4J8WA 5JA4B 5B0ZA 2Y2HA 2BYKA 1P3GA 4XZQC 5JRGA 3MGRA 3WTPE 5B1LB 5CPIA 4QLCC 4ZUXD 5AV8B 4KUDC 1JFIA 3X1UC 5FUGA 4H9QB 1T3UA 3X1TB 3AFAB 1P3ID 4YM6D 1ZLAA 3W98A 4LD9D 3MNNB 3A6NB 3AZMD 3O62C 5B40A 2F2AC 3REHC 1P3PB 4AWLB 4YS3A 4J8XD 3KUYD 2ZY4A 4J8VC 5AV9A 1M19A 5AVCB 4Z5TB 3WAAC 4EO5B 2AROB 3WTPC 3AZHA 5B0YC 3LZ0B 3WA9D 2L5AA 4H9PB 4J8WD 3AZLC 5B0ZD 1P3GD 5JRGD 3MGRD 3B0CT 3VH5A 4HGAB 3EPLA 5CPID 3VH5W 5AV5B 4J8UB 1Z2CB 2FJ7B 5GSUC 1P3FB 3LELB 1U35C 4UUZB 3AZGC 1M1AC 3B0CW 5GT0A 1ZLAD 2NQBA 3W98D 1BH8B 3REIC 1TAFA 3W97B 2G5HC 1P3KD 4YS3D 4KUDA 5AV9D 3B0BA 5B31G 1M19D 5B33A 5AV6A 1AOIC 4KGCC 1EQZA 4CSRA 3KFUG 1TZYC 2YFWB 3V9RB 3LJAC 3AZHD 3AV1A 3AYWB 3WKJA 5CPKB 2XD1A 3AZKC
chains in the Genus database with same CATH topology
1KX3C 3MGSC 2W8SA 4H9NA 3EPJA 2G5IC 3LZ1B 4WU9B 3WAAA 1P3AB 5F99A 4E44A 2ZY3A 1PZRA 5GT0D 2NQBD 4DQYB 3B6GB 3AZLA 4ZUXC 1P3LA 5BNXB 1HQ3B 3REJB 1P3MB 3F6TA 2DF4C 4Z2MH 4YM6C 4KUDD 1S32B 5B33D 5AV6D 4LD9C 5BO0A 2YFVA 3AZMC 5B31A 4WU8A 3KWQC 5DNMC 4J8XC 3AV1D 3WKJD 2IO5C 3MGQA 5AVBC 1P34B 3AL0C 4KHAA 4R8PB 3X1VB 3WA9C 2CWEA 3X1SC 1TZYA 3NQJB 4J8WC 5B0ZC 1F1EA 1P3GC 3B6FB 3WAAD 5F99D 5GXQA 1N1JA 5JRGC 3MGRC 2HIOB 4JJNB 3AN2B 3B0DB 3AZNB 3AZLD 5CPIC 3AZKA 3REKA 3MGSA 3UT9B 1P3LD 1P3BA 1ZLAC 2JCHA 3MGPB 5B2JB 3VH6T 5B31D 5B40C 3W96A 3AZGD 5B32A 3C1CB 4WZSB 4WU8D 4YS3C 3VH6A 5AV9C 1M19C 1P3IB 3MGQD 2JE5A 5KDMB 1P3OB 2RVQD 2DQNC 3MVDB 5B24C 2F8NB 3AV2B 3KUYB 1TZYD 1ID3A 3KWQA 5GXQD 3AZKD 5AVBA 3MGSD 3REKD 5GT3C 3FDDA 3AZFC 1B67A 2Y2OA 4G92C 5CP6B 1P3BD 2PYOB 5GT0C 3X1SA 3AZIA 1M18A 2ZM5A 1P3PC 3W96D 3UTBA 5AY8B 1KX4A 3UTAB 3R45A 5BNVA 3IP4C 3KXBB 5B33C 5AV6C 1EQZC 3W98B 5B2IA 5CPJA 4X23A 3AV1C 3WKJC 1P3KB 3H0MC 2NZDB 1ID3D 4WNNA 3KWQD 5DNMD 5C3IB 3TU4A 1F66A 3AZHB 3AZJB 5AVBD 4XUJA 2F8NH 3RELA 5B24A 5F99C 1KU5A 5JA4A 3VH5T 3X1SD 3AZID 1M18D 3W99B 5B1LA 2CV5C 1P3LC 4Z2MG 3EPHA 4NE5A 3UTBD 1KX4D 4H9QA 5BS7A 3X1TA 5GT3A 3AFAA 5DNNB 3AZFA 2NQBB 5B31C 3MNNA 3A6NA 5CPKC 4XZQB 4WU8C 4X23D 4H9RB 1P3PA 4NE6A 5B40D 1KX5B 4QLCB 4KUDB 3MGQC 3X1UB 5AVCA 2RVQC 5E5AC 5G49B 4Z5TA 4WU9C 3TU4D 1F66D 2AROA 4XUJD 3O62B 1W2EA 3RELD 1Q9CA 4H9PA 5B24D 3REHB 5GXQC 1H3OB 4WJ3C 4J8VB 4NFTA 3REKC 5B1LD 5AV5A 4J8UA 2FJ7A 1WWSA 3WTPB 1P3BC 5B0YB 3X1TD 4UUZA 5GT3D 3AFAD 3H0RC 3AZFD 3AZLB 1BH8A 3W96C 3MNND 5B32C 5B1MC 3W97A 4Z66C 1P3PD 2CV5A 5GSUB 5AVCD 1U35B 4Z5TD 3AZGB 1M1AB 2AROD 5B32G 2BYMB 1EQZD 3AYWA 3REIB 5CPKA 1ID3C 4CAYB 2JSSA 3C1BC 4KGCB 1AOIB 5E5AA 3LZ1A 4J8UD 4WU9A 2FJ7D 3LJAB 3A1IA 1N1JB 3AZIC 1M18C 4H9OB 3B6GA 3AZEC 3AZKB 1KX3B 3UTBC 1KX4C 5BNXA 1HQ3A 3W97D 3REJA 1P3MA 2CV5D 1BH9B 1S32A 1HTAA 5B2IC 4ZBJC 5CPJC 4X23C 3AYWD 4ZUXB 5B1MA 5CPKD 4Z66A 4G91B 2HUEC 4YM6B 3TU4C 1F66C 2F8NG 2ZY5A 3NQUB 4LD9B 1R4VA 3AZMB 5BT1C 5E5AD 4XUJC 2XD5A 4R8PA 3RELC 3LZ1D 4WU9D 3NQJA 3B6FA 3KWQB 5DNMB 4J8XB 2IO5B 2HIOA 4JJNA 3B6GD 5B1LC 3AZNA 5AVBB 3UT9A 5AV8C 3P5JB 2Y2KA 3C1BA 5BS7C 3REJD 1P3MD 3X1TC 3AFAC 3WA9B 2Y2NA 2Y2JA 3X1SB 1S32D 4J8WB 5B0ZB 3MGPA 5B2JA 2BYKB 3MNNC 3A6NC 1P3GB 5JRGB 3MGRB 3C1CA 4AWLC 3AZEA 5CPIB 5B32D 5B1MD 5C3IC 1JFIB 5FUGB 5AVCC 4Z66D 2BG1A 5KDMA 4Z5TC 1P3OA 3MVDA 4EO5C 2AROC 1ZLAB 3LZ0C 2F8NA 3AV2A 5B40B 4E45A 3B6FD 4YS3B 5AV9B 1M19B 2HIOD 4JJND 4HGAC 3AZND 3UT9D 5AV5C 4J8UC 2FJ7C 3C1BD 1P3FC 5B24B 3LELC 5CP6A 4DRAA 4M6BA 2PYOA 3MGPD 5B2JD 1KX5C 2Y2IA 3W97C 3C1CD 5AY8A 3UTAA 4DRBA 3AZED 3A1KA 5AV8A 5GT3B 3KXBA 3AZFB 4G92B 1P3OD 4WV4B 5GT0B 3MVDD 5B2ID 5CPJD 3AYWC 2F8ND 1P3KA 3AV2D 1TAFB 3EPKA 2NZDA 5B33B 5AV6B 3AZJA 1EQZB 4CSRB 3LZ1C 1P3AC 3AV1B 5CP6D 2FFFB 3LZ0A 5BT1D 3WKJB 2PYOD 3B6GC 3W99A 1HQ3C 4H9NB 3REJC 1P3MC 5AY8D 3UTAD 5AV8D 1S32C 3WAAB 3KXBD 5DNNA 1P3FA 3LELA 5F99B 4XZQA 4H9RA 3A6ND 3KSYA 2CV5B 1P3LB 1KX5A 1B6WA 4QLCA 2NZDD 3X1UA 1P34C 2Y2MA 2VQRA 5G49A 5CHLB 2YFVB 5BO0B 2J8PA 4R8PC 5B31B 3X1VC 3AZJD 2YFWA 3O62A 3V9RA 4WU8B 3B6FC 3REHA 3LZ0D 1H3OA 2HIOC 4JJNC 2Y2GA 2Y2LA 4J8VA 3B0DC 3MGQB 3AN2C 3W99D 3AZNC 3H0LC 3UT9C 5E5AB 4KHAB 3WTPA 5B0YA 5AV5D 1TZYB 3MGPC 5DNND 5B2JC 1P3AA 1P3FD 3LELD 5GXQB 3C1CC 4XZQD 2ZY2A 3MGSB 3REKB 4G91C 1P3IC 1KX5D 4QLCD 3X1UD 5GSUA 1P3OC 1P3BB 1U35A 3MVDC 3AZGA 1M1AA 2BYMA 3AV2C 3KUYC 3W96B 5B32B 5B1MB 3O62D 3REIA 4Z66B 4CAYA 3REHD 4J8VD 2UWXA 4KGCA 4H9SC 1AOIA 1P34A 5CP6C 2LY8A 3WTPD 3LJAA 3X1VA 2PYOC 5B0YD 1ID3B 2F8NK 1P3AD 1WWIA 4H9OA 1KX3A 4NE3A 5AY8C 3AN2A 3C1BB 3UTAC 3KXBC 1HQ3D 1BH9A 3W98C 5GSUD 2RIQA 1U35D 3AZIB 1M18B 1M1AD 1P3KC 3AZEB 4ZUXA 3UTBB 2NZDC 3REID 1KX4B 1BFMA 3R45B 3VH6W 5BNVB 1A7WA 2Y2QA 4UPKA 1P3IA 4YM6A 3AZHC 3AZJC 2Y2PA 4KGCD 5B2IB 3NQUA 1ULYA 4ZBJB 3AZMA 5CPJB 1AOID 1P34D 4LD9A 4X23B 3LJAD 4R8PD 3X1VD 4J8XA 5DNMA 3KUYA 3W99C 3EG5B 4WNNB 1KX3D 2HUEB 3TU4B 3AN2D 1F66B 4H9SA 4XUJB 5DNNC 3RELB 3WA9A 2NQBC 4J8WA 5JA4B 5B0ZA 2Y2HA 2BYKA 1P3GA 4XZQC 5JRGA 3MGRA 3WTPE 5B1LB 5CPIA 4QLCC 4ZUXD 5AV8B 4KUDC 1JFIA 3X1UC 5FUGA 4H9QB 1T3UA 3X1TB 3AFAB 1P3ID 4YM6D 1ZLAA 3W98A 4LD9D 3MNNB 3A6NB 3AZMD 3O62C 5B40A 2F2AC 3REHC 1P3PB 4AWLB 4YS3A 4J8XD 3KUYD 2ZY4A 4J8VC 5AV9A 1M19A 5AVCB 4Z5TB 3WAAC 4EO5B 2AROB 3WTPC 3AZHA 5B0YC 3LZ0B 3WA9D 2L5AA 4H9PB 4J8WD 3AZLC 5B0ZD 1P3GD 5JRGD 3MGRD 3B0CT 3VH5A 4HGAB 3EPLA 5CPID 3VH5W 5AV5B 4J8UB 1Z2CB 2FJ7B 5GSUC 1P3FB 3LELB 1U35C 4UUZB 3AZGC 1M1AC 3B0CW 5GT0A 1ZLAD 2NQBA 3W98D 1BH8B 3REIC 1TAFA 3W97B 2G5HC 1P3KD 4YS3D 4KUDA 5AV9D 3B0BA 5B31G 1M19D 5B33A 5AV6A 1AOIC 4KGCC 1EQZA 4CSRA 3KFUG 1TZYC 2YFWB 3V9RB 3LJAC 3AZHD 3AV1A 3AYWB 3WKJA 5CPKB 2XD1A 3AZKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KX3 C;  3MGS C;  4H9N A;  3LZ1 B;  4WU9 B;  3WAA A;  1P3A B;  5F99 A;  4E44 A;  5GT0 D;  2NQB D;  3B6G B;  3AZL A;  4ZUX C;  1P3L A;  5BNX B;  1HQ3 B;  3REJ B;  1P3M B;  4Z2M H;  4YM6 C;  4KUD D;  1S32 B;  5B33 D;  5AV6 D;  4LD9 C;  5BO0 A;  2YFV A;  3AZM C;  5B31 A;  4WU8 A;  3KWQ C;  5DNM C;  4J8X C;  3AV1 D;  3WKJ D;  2IO5 C;  3MGQ A;  5AVB C;  1P34 B;  4KHA A;  4R8P B;  3X1V B;  3WA9 C;  2CWE A;  3X1S C;  1TZY A;  3NQJ B;  4J8W C;  5B0Z C;  1F1E A;  1P3G C;  3B6F B;  3WAA D;  5F99 D;  5GXQ A;  1N1J A;  5JRG C;  3MGR C;  2HIO B;  4JJN B;  3AN2 B;  3B0D B;  3AZN B;  3AZL D;  5CPI C;  3AZK A;  3REK A;  3MGS A;  3UT9 B;  1P3L D;  1P3B A;  1ZLA C;  3MGP B;  5B2J B;  3VH6 T;  5B31 D;  5B40 C;  3W96 A;  3AZG D;  5B32 A;  3C1C B;  4WZS B;  4WU8 D;  4YS3 C;  3VH6 A;  5AV9 C;  1M19 C;  1P3I B;  3MGQ D;  5KDM B;  1P3O B;  2RVQ D;  3MVD B;  5B24 C;  2F8N B;  3AV2 B;  3KUY B;  1TZY D;  1ID3 A;  3KWQ A;  5GXQ D;  3AZK D;  5AVB A;  3MGS D;  3REK D;  5GT3 C;  3AZF C;  1B67 A;  4G92 C;  5CP6 B;  1P3B D;  2PYO B;  5GT0 C;  3X1S A;  3AZI A;  1M18 A;  1P3P C;  3W96 D;  3UTB A;  5AY8 B;  1KX4 A;  3UTA B;  3R45 A;  5BNV A;  3KXB B;  5B33 C;  5AV6 C;  1EQZ C;  3W98 B;  5B2I A;  5CPJ A;  4X23 A;  3AV1 C;  3WKJ C;  1P3K B;  2NZD B;  1ID3 D;  4WNN A;  3KWQ D;  5DNM D;  5C3I B;  3TU4 A;  1F66 A;  3AZH B;  3AZJ B;  5AVB D;  4XUJ A;  2F8N H;  3REL A;  5B24 A;  5F99 C;  1KU5 A;  5JA4 A;  3VH5 T;  3X1S D;  3AZI D;  1M18 D;  3W99 B;  5B1L A;  2CV5 C;  1P3L C;  4Z2M G;  4NE5 A;  3UTB D;  1KX4 D;  4H9Q A;  5BS7 A;  3X1T A;  5GT3 A;  3AFA A;  5DNN B;  3AZF A;  2NQB B;  5B31 C;  3MNN A;  3A6N A;  5CPK C;  4XZQ B;  4WU8 C;  4X23 D;  4H9R B;  1P3P A;  4NE6 A;  5B40 D;  1KX5 B;  4QLC B;  4KUD B;  3MGQ C;  3X1U B;  5AVC A;  2RVQ C;  5E5A C;  5G49 B;  4Z5T A;  4WU9 C;  3TU4 D;  1F66 D;  2ARO A;  4XUJ D;  3O62 B;  3REL D;  1Q9C A;  4H9P A;  5B24 D;  3REH B;  5GXQ C;  1H3O B;  4J8V B;  4NFT A;  3REK C;  5B1L D;  5AV5 A;  4J8U A;  2FJ7 A;  1WWS A;  3WTP B;  1P3B C;  5B0Y B;  3X1T D;  4UUZ A;  5GT3 D;  3AFA D;  3AZF D;  3AZL B;  1BH8 A;  3W96 C;  3MNN D;  5B32 C;  5B1M C;  3W97 A;  4Z66 C;  1P3P D;  2CV5 A;  5GSU B;  5AVC D;  1U35 B;  4Z5T D;  3AZG B;  1M1A B;  2ARO D;  5B32 G;  2BYM B;  1EQZ D;  3AYW A;  3REI B;  5CPK A;  1ID3 C;  4CAY B;  2JSS A;  3C1B C;  4KGC B;  1AOI B;  5E5A A;  3LZ1 A;  4J8U D;  4WU9 A;  2FJ7 D;  3LJA B;  1N1J B;  3AZI C;  1M18 C;  4H9O B;  3B6G A;  3AZE C;  3AZK B;  1KX3 B;  3UTB C;  1KX4 C;  5BNX A;  1HQ3 A;  3W97 D;  3REJ A;  1P3M A;  2CV5 D;  1BH9 B;  1S32 A;  1HTA A;  5B2I C;  4ZBJ C;  5CPJ C;  4X23 C;  3AYW D;  4ZUX B;  5B1M A;  5CPK D;  4Z66 A;  4G91 B;  2HUE C;  4YM6 B;  3TU4 C;  1F66 C;  2F8N G;  3NQU B;  4LD9 B;  1R4V A;  3AZM B;  5BT1 C;  5E5A D;  4XUJ C;  4R8P A;  3REL C;  3LZ1 D;  4WU9 D;  3NQJ A;  3B6F A;  3KWQ B;  5DNM B;  4J8X B;  2IO5 B;  2HIO A;  4JJN A;  3B6G D;  5B1L C;  3AZN A;  5AVB B;  3UT9 A;  5AV8 C;  3C1B A;  5BS7 C;  3REJ D;  1P3M D;  3X1T C;  3AFA C;  3WA9 B;  3X1S B;  1S32 D;  4J8W B;  5B0Z B;  3MGP A;  5B2J A;  2BYK B;  3MNN C;  3A6N C;  1P3G B;  5JRG B;  3MGR B;  3C1C A;  4AWL C;  3AZE A;  5CPI B;  5B32 D;  5B1M D;  5C3I C;  1JFI B;  5FUG B;  5AVC C;  4Z66 D;  5KDM A;  4Z5T C;  1P3O A;  3MVD A;  4EO5 C;  2ARO C;  1ZLA B;  3LZ0 C;  2F8N A;  3AV2 A;  5B40 B;  4E45 A;  3B6F D;  4YS3 B;  5AV9 B;  1M19 B;  2HIO D;  4JJN D;  4HGA C;  3AZN D;  3UT9 D;  5AV5 C;  4J8U C;  2FJ7 C;  3C1B D;  1P3F C;  5B24 B;  3LEL C;  5CP6 A;  4DRA A;  4M6B A;  2PYO A;  3MGP D;  5B2J D;  1KX5 C;  3W97 C;  3C1C D;  5AY8 A;  3UTA A;  4DRB A;  3AZE D;  5AV8 A;  5GT3 B;  3KXB A;  3AZF B;  4G92 B;  1P3O D;  4WV4 B;  5GT0 B;  3MVD D;  5B2I D;  5CPJ D;  3AYW C;  2F8N D;  1P3K A;  3AV2 D;  1TAF B;  2NZD A;  5B33 B;  5AV6 B;  3AZJ A;  1EQZ B;  4CSR B;  3LZ1 C;  1P3A C;  3AV1 B;  5CP6 D;  3WKJ B;  3LZ0 A;  5BT1 D;  2PYO D;  3B6G C;  3W99 A;  1HQ3 C;  4H9N B;  3REJ C;  1P3M C;  5AY8 D;  3UTA D;  5AV8 D;  1S32 C;  3WAA B;  3KXB D;  5DNN A;  1P3F A;  3LEL A;  5F99 B;  4XZQ A;  4H9R A;  3A6N D;  3KSY A;  2CV5 B;  1P3L B;  1KX5 A;  1B6W A;  4QLC A;  2NZD D;  3X1U A;  1P34 C;  5G49 A;  5CHL B;  2YFV B;  5BO0 B;  4R8P C;  5B31 B;  3X1V C;  3AZJ D;  2YFW A;  3O62 A;  3V9R A;  4WU8 B;  3B6F C;  3REH A;  3LZ0 D;  1H3O A;  2HIO C;  4JJN C;  4J8V A;  3AN2 C;  3B0D C;  3MGQ B;  3W99 D;  3AZN C;  3UT9 C;  5E5A B;  4KHA B;  3WTP A;  5B0Y A;  5AV5 D;  1TZY B;  3MGP C;  5DNN D;  5B2J C;  1P3A A;  1P3F D;  3LEL D;  5GXQ B;  3C1C C;  4XZQ D;  3REK B;  3MGS B;  4G91 C;  1P3I C;  1KX5 D;  4QLC D;  3X1U D;  5GSU A;  1P3O C;  1P3B B;  1U35 A;  3MVD C;  3AZG A;  1M1A A;  2BYM A;  3AV2 C;  3KUY C;  3W96 B;  5B32 B;  5B1M B;  3O62 D;  3REI A;  4Z66 B;  4CAY A;  3REH D;  4J8V D;  4KGC A;  4H9S C;  1AOI A;  1P34 A;  5CP6 C;  2LY8 A;  3WTP D;  3LJA A;  3X1V A;  2PYO C;  5B0Y D;  1ID3 B;  2F8N K;  1P3A D;  1WWI A;  4H9O A;  1KX3 A;  4NE3 A;  5AY8 C;  3AN2 A;  3C1B B;  3UTA C;  3KXB C;  1HQ3 D;  1BH9 A;  3W98 C;  5GSU D;  1U35 D;  3AZI B;  1M18 B;  1M1A D;  1P3K C;  3AZE B;  4ZUX A;  3UTB B;  2NZD C;  3REI D;  1KX4 B;  1BFM A;  3R45 B;  3VH6 W;  5BNV B;  1A7W A;  1P3I A;  4YM6 A;  3AZH C;  3AZJ C;  4KGC D;  5B2I B;  3NQU A;  1ULY A;  4ZBJ B;  3AZM A;  5CPJ B;  1AOI D;  1P34 D;  4LD9 A;  4X23 B;  3LJA D;  4R8P D;  3X1V D;  4J8X A;  5DNM A;  3KUY A;  3W99 C;  4WNN B;  1KX3 D;  2HUE B;  3TU4 B;  3AN2 D;  1F66 B;  4H9S A;  4XUJ B;  5DNN C;  3REL B;  3WA9 A;  2NQB C;  4J8W A;  5JA4 B;  5B0Z A;  1P3G A;  2BYK A;  4XZQ C;  5JRG A;  3MGR A;  3WTP E;  5B1L B;  5CPI A;  4QLC C;  4ZUX D;  5AV8 B;  4KUD C;  1JFI A;  3X1U C;  5FUG A;  4H9Q B;  3X1T B;  3AFA B;  1P3I D;  4YM6 D;  1ZLA A;  3W98 A;  4LD9 D;  3MNN B;  3A6N B;  3AZM D;  3O62 C;  5B40 A;  3REH C;  1P3P B;  4AWL B;  4YS3 A;  4J8X D;  3KUY D;  4J8V C;  5AV9 A;  1M19 A;  5AVC B;  4Z5T B;  3WAA C;  4EO5 B;  3WTP C;  2ARO B;  3AZH A;  5B0Y C;  3LZ0 B;  3WA9 D;  2L5A A;  4H9P B;  4J8W D;  3AZL C;  5B0Z D;  1P3G D;  5JRG D;  3MGR D;  3B0C T;  3VH5 A;  4HGA B;  5CPI D;  3VH5 W;  5AV5 B;  4J8U B;  2FJ7 B;  5GSU C;  1P3F B;  3LEL B;  1U35 C;  4UUZ B;  3AZG C;  1M1A C;  3B0C W;  5GT0 A;  1ZLA D;  2NQB A;  3W98 D;  1BH8 B;  3REI C;  1TAF A;  3W97 B;  1P3K D;  4YS3 D;  4KUD A;  5AV9 D;  3B0B A;  5B31 G;  1M19 D;  5B33 A;  5AV6 A;  1AOI C;  4KGC C;  1EQZ A;  4CSR A;  1TZY C;  2YFW B;  3V9R B;  3LJA C;  3AZH D;  3AV1 A;  3AYW B;  3WKJ A;  5CPK B;  3AZK C; 
#chains in the Genus database with same CATH topology
 1KX3 C;  3MGS C;  2W8S A;  4H9N A;  3EPJ A;  2G5I C;  3LZ1 B;  4WU9 B;  3WAA A;  1P3A B;  5F99 A;  4E44 A;  2ZY3 A;  1PZR A;  5GT0 D;  2NQB D;  4DQY B;  3B6G B;  3AZL A;  4ZUX C;  1P3L A;  5BNX B;  1HQ3 B;  3REJ B;  1P3M B;  3F6T A;  2DF4 C;  4Z2M H;  4YM6 C;  4KUD D;  1S32 B;  5B33 D;  5AV6 D;  4LD9 C;  5BO0 A;  2YFV A;  3AZM C;  5B31 A;  4WU8 A;  3KWQ C;  5DNM C;  4J8X C;  3AV1 D;  3WKJ D;  2IO5 C;  3MGQ A;  5AVB C;  1P34 B;  3AL0 C;  4KHA A;  4R8P B;  3X1V B;  3WA9 C;  2CWE A;  3X1S C;  1TZY A;  3NQJ B;  4J8W C;  5B0Z C;  1F1E A;  1P3G C;  3B6F B;  3WAA D;  5F99 D;  5GXQ A;  1N1J A;  5JRG C;  3MGR C;  2HIO B;  4JJN B;  3AN2 B;  3B0D B;  3AZN B;  3AZL D;  5CPI C;  3AZK A;  3REK A;  3MGS A;  3UT9 B;  1P3L D;  1P3B A;  1ZLA C;  2JCH A;  3MGP B;  5B2J B;  3VH6 T;  5B31 D;  5B40 C;  3W96 A;  3AZG D;  5B32 A;  3C1C B;  4WZS B;  4WU8 D;  4YS3 C;  3VH6 A;  5AV9 C;  1M19 C;  1P3I B;  3MGQ D;  2JE5 A;  5KDM B;  1P3O B;  2RVQ D;  2DQN C;  3MVD B;  5B24 C;  2F8N B;  3AV2 B;  3KUY B;  1TZY D;  1ID3 A;  3KWQ A;  5GXQ D;  3AZK D;  5AVB A;  3MGS D;  3REK D;  5GT3 C;  3FDD A;  3AZF C;  1B67 A;  2Y2O A;  4G92 C;  5CP6 B;  1P3B D;  2PYO B;  5GT0 C;  3X1S A;  3AZI A;  1M18 A;  2ZM5 A;  1P3P C;  3W96 D;  3UTB A;  5AY8 B;  1KX4 A;  3UTA B;  3R45 A;  5BNV A;  3IP4 C;  3KXB B;  5B33 C;  5AV6 C;  1EQZ C;  3W98 B;  5B2I A;  5CPJ A;  4X23 A;  3AV1 C;  3WKJ C;  1P3K B;  3H0M C;  2NZD B;  1ID3 D;  4WNN A;  3KWQ D;  5DNM D;  5C3I B;  3TU4 A;  1F66 A;  3AZH B;  3AZJ B;  5AVB D;  4XUJ A;  2F8N H;  3REL A;  5B24 A;  5F99 C;  1KU5 A;  5JA4 A;  3VH5 T;  3X1S D;  3AZI D;  1M18 D;  3W99 B;  5B1L A;  2CV5 C;  1P3L C;  4Z2M G;  3EPH A;  4NE5 A;  3UTB D;  1KX4 D;  4H9Q A;  5BS7 A;  3X1T A;  5GT3 A;  3AFA A;  5DNN B;  3AZF A;  2NQB B;  5B31 C;  3MNN A;  3A6N A;  5CPK C;  4XZQ B;  4WU8 C;  4X23 D;  4H9R B;  1P3P A;  4NE6 A;  5B40 D;  1KX5 B;  4QLC B;  4KUD B;  3MGQ C;  3X1U B;  5AVC A;  2RVQ C;  5E5A C;  5G49 B;  4Z5T A;  4WU9 C;  3TU4 D;  1F66 D;  2ARO A;  4XUJ D;  3O62 B;  1W2E A;  3REL D;  1Q9C A;  4H9P A;  5B24 D;  3REH B;  5GXQ C;  1H3O B;  4WJ3 C;  4J8V B;  4NFT A;  3REK C;  5B1L D;  5AV5 A;  4J8U A;  2FJ7 A;  1WWS A;  3WTP B;  1P3B C;  5B0Y B;  3X1T D;  4UUZ A;  5GT3 D;  3AFA D;  3H0R C;  3AZF D;  3AZL B;  1BH8 A;  3W96 C;  3MNN D;  5B32 C;  5B1M C;  3W97 A;  4Z66 C;  1P3P D;  2CV5 A;  5GSU B;  5AVC D;  1U35 B;  4Z5T D;  3AZG B;  1M1A B;  2ARO D;  5B32 G;  2BYM B;  1EQZ D;  3AYW A;  3REI B;  5CPK A;  1ID3 C;  4CAY B;  2JSS A;  3C1B C;  4KGC B;  1AOI B;  5E5A A;  3LZ1 A;  4J8U D;  4WU9 A;  2FJ7 D;  3LJA B;  3A1I A;  1N1J B;  3AZI C;  1M18 C;  4H9O B;  3B6G A;  3AZE C;  3AZK B;  1KX3 B;  3UTB C;  1KX4 C;  5BNX A;  1HQ3 A;  3W97 D;  3REJ A;  1P3M A;  2CV5 D;  1BH9 B;  1S32 A;  1HTA A;  5B2I C;  4ZBJ C;  5CPJ C;  4X23 C;  3AYW D;  4ZUX B;  5B1M A;  5CPK D;  4Z66 A;  4G91 B;  2HUE C;  4YM6 B;  3TU4 C;  1F66 C;  2F8N G;  2ZY5 A;  3NQU B;  4LD9 B;  1R4V A;  3AZM B;  5BT1 C;  5E5A D;  4XUJ C;  2XD5 A;  4R8P A;  3REL C;  3LZ1 D;  4WU9 D;  3NQJ A;  3B6F A;  3KWQ B;  5DNM B;  4J8X B;  2IO5 B;  2HIO A;  4JJN A;  3B6G D;  5B1L C;  3AZN A;  5AVB B;  3UT9 A;  5AV8 C;  3P5J B;  2Y2K A;  3C1B A;  5BS7 C;  3REJ D;  1P3M D;  3X1T C;  3AFA C;  3WA9 B;  2Y2N A;  2Y2J A;  3X1S B;  1S32 D;  4J8W B;  5B0Z B;  3MGP A;  5B2J A;  2BYK B;  3MNN C;  3A6N C;  1P3G B;  5JRG B;  3MGR B;  3C1C A;  4AWL C;  3AZE A;  5CPI B;  5B32 D;  5B1M D;  5C3I C;  1JFI B;  5FUG B;  5AVC C;  4Z66 D;  2BG1 A;  5KDM A;  4Z5T C;  1P3O A;  3MVD A;  4EO5 C;  2ARO C;  1ZLA B;  3LZ0 C;  2F8N A;  3AV2 A;  5B40 B;  4E45 A;  3B6F D;  4YS3 B;  5AV9 B;  1M19 B;  2HIO D;  4JJN D;  4HGA C;  3AZN D;  3UT9 D;  5AV5 C;  4J8U C;  2FJ7 C;  3C1B D;  1P3F C;  5B24 B;  3LEL C;  5CP6 A;  4DRA A;  4M6B A;  2PYO A;  3MGP D;  5B2J D;  1KX5 C;  2Y2I A;  3W97 C;  3C1C D;  5AY8 A;  3UTA A;  4DRB A;  3AZE D;  3A1K A;  5AV8 A;  5GT3 B;  3KXB A;  3AZF B;  4G92 B;  1P3O D;  4WV4 B;  5GT0 B;  3MVD D;  5B2I D;  5CPJ D;  3AYW C;  2F8N D;  1P3K A;  3AV2 D;  1TAF B;  3EPK A;  2NZD A;  5B33 B;  5AV6 B;  3AZJ A;  1EQZ B;  4CSR B;  3LZ1 C;  1P3A C;  3AV1 B;  5CP6 D;  2FFF B;  3LZ0 A;  5BT1 D;  3WKJ B;  2PYO D;  3B6G C;  3W99 A;  1HQ3 C;  4H9N B;  3REJ C;  1P3M C;  5AY8 D;  3UTA D;  5AV8 D;  1S32 C;  3WAA B;  3KXB D;  5DNN A;  1P3F A;  3LEL A;  5F99 B;  4XZQ A;  4H9R A;  3A6N D;  3KSY A;  2CV5 B;  1P3L B;  1KX5 A;  1B6W A;  4QLC A;  2NZD D;  3X1U A;  1P34 C;  2Y2M A;  2VQR A;  5G49 A;  5CHL B;  2YFV B;  5BO0 B;  2J8P A;  4R8P C;  5B31 B;  3X1V C;  3AZJ D;  2YFW A;  3O62 A;  3V9R A;  4WU8 B;  3B6F C;  3REH A;  3LZ0 D;  1H3O A;  2HIO C;  4JJN C;  2Y2G A;  2Y2L A;  4J8V A;  3B0D C;  3MGQ B;  3AN2 C;  3W99 D;  3AZN C;  3H0L C;  3UT9 C;  5E5A B;  4KHA B;  3WTP A;  5B0Y A;  5AV5 D;  1TZY B;  3MGP C;  5DNN D;  5B2J C;  1P3A A;  1P3F D;  3LEL D;  5GXQ B;  3C1C C;  4XZQ D;  2ZY2 A;  3MGS B;  3REK B;  4G91 C;  1P3I C;  1KX5 D;  4QLC D;  3X1U D;  5GSU A;  1P3O C;  1P3B B;  1U35 A;  3MVD C;  3AZG A;  1M1A A;  2BYM A;  3AV2 C;  3KUY C;  3W96 B;  5B32 B;  5B1M B;  3O62 D;  3REI A;  4Z66 B;  4CAY A;  3REH D;  4J8V D;  2UWX A;  4KGC A;  4H9S C;  1AOI A;  1P34 A;  5CP6 C;  2LY8 A;  3WTP D;  3LJA A;  3X1V A;  2PYO C;  5B0Y D;  1ID3 B;  2F8N K;  1P3A D;  1WWI A;  4H9O A;  1KX3 A;  4NE3 A;  5AY8 C;  3AN2 A;  3C1B B;  3UTA C;  3KXB C;  1HQ3 D;  1BH9 A;  3W98 C;  5GSU D;  2RIQ A;  1U35 D;  3AZI B;  1M18 B;  1M1A D;  1P3K C;  3AZE B;  4ZUX A;  3UTB B;  2NZD C;  3REI D;  1KX4 B;  1BFM A;  3R45 B;  3VH6 W;  5BNV B;  1A7W A;  2Y2Q A;  4UPK A;  1P3I A;  4YM6 A;  3AZH C;  3AZJ C;  2Y2P A;  4KGC D;  5B2I B;  3NQU A;  1ULY A;  4ZBJ B;  3AZM A;  5CPJ B;  1AOI D;  1P34 D;  4LD9 A;  4X23 B;  3LJA D;  4R8P D;  3X1V D;  4J8X A;  5DNM A;  3KUY A;  3W99 C;  3EG5 B;  4WNN B;  1KX3 D;  2HUE B;  3TU4 B;  3AN2 D;  1F66 B;  4H9S A;  4XUJ B;  5DNN C;  3REL B;  3WA9 A;  2NQB C;  4J8W A;  5JA4 B;  5B0Z A;  2Y2H A;  2BYK A;  1P3G A;  4XZQ C;  5JRG A;  3MGR A;  3WTP E;  5B1L B;  5CPI A;  4QLC C;  4ZUX D;  5AV8 B;  4KUD C;  1JFI A;  3X1U C;  5FUG A;  4H9Q B;  1T3U A;  3X1T B;  3AFA B;  1P3I D;  4YM6 D;  1ZLA A;  3W98 A;  4LD9 D;  3MNN B;  3A6N B;  3AZM D;  3O62 C;  5B40 A;  2F2A C;  3REH C;  1P3P B;  4AWL B;  4YS3 A;  4J8X D;  3KUY D;  2ZY4 A;  4J8V C;  5AV9 A;  1M19 A;  5AVC B;  4Z5T B;  3WAA C;  4EO5 B;  2ARO B;  3WTP C;  3AZH A;  5B0Y C;  3LZ0 B;  3WA9 D;  2L5A A;  4H9P B;  4J8W D;  3AZL C;  5B0Z D;  1P3G D;  5JRG D;  3MGR D;  3B0C T;  3VH5 A;  4HGA B;  3EPL A;  5CPI D;  3VH5 W;  5AV5 B;  4J8U B;  1Z2C B;  2FJ7 B;  5GSU C;  1P3F B;  3LEL B;  1U35 C;  4UUZ B;  3AZG C;  1M1A C;  3B0C W;  5GT0 A;  1ZLA D;  2NQB A;  3W98 D;  1BH8 B;  3REI C;  1TAF A;  3W97 B;  2G5H C;  1P3K D;  4YS3 D;  4KUD A;  5AV9 D;  3B0B A;  5B31 G;  1M19 D;  5B33 A;  5AV6 A;  1AOI C;  4KGC C;  1EQZ A;  4CSR A;  3KFU G;  1TZY C;  2YFW B;  3V9R B;  3LJA C;  3AZH D;  3AV1 A;  3AYW B;  3WKJ A;  5CPK B;  2XD1 A;  3AZK C; 
#chains in the Genus database with same CATH homology
 1KX3 C;  3MGS C;  2W8S A;  4H9N A;  3EPJ A;  2G5I C;  3LZ1 B;  4WU9 B;  3WAA A;  1P3A B;  5F99 A;  4E44 A;  2ZY3 A;  1PZR A;  5GT0 D;  2NQB D;  4DQY B;  3B6G B;  3AZL A;  4ZUX C;  1P3L A;  5BNX B;  1HQ3 B;  3REJ B;  1P3M B;  3F6T A;  2DF4 C;  4Z2M H;  4YM6 C;  4KUD D;  1S32 B;  5B33 D;  5AV6 D;  4LD9 C;  5BO0 A;  2YFV A;  3AZM C;  5B31 A;  4WU8 A;  3KWQ C;  5DNM C;  4J8X C;  3AV1 D;  3WKJ D;  2IO5 C;  3MGQ A;  5AVB C;  1P34 B;  3AL0 C;  4KHA A;  4R8P B;  3X1V B;  3WA9 C;  2CWE A;  3X1S C;  1TZY A;  3NQJ B;  4J8W C;  5B0Z C;  1F1E A;  1P3G C;  3B6F B;  3WAA D;  5F99 D;  5GXQ A;  1N1J A;  5JRG C;  3MGR C;  2HIO B;  4JJN B;  3AN2 B;  3B0D B;  3AZN B;  3AZL D;  5CPI C;  3AZK A;  3REK A;  3MGS A;  3UT9 B;  1P3L D;  1P3B A;  1ZLA C;  2JCH A;  3MGP B;  5B2J B;  3VH6 T;  5B31 D;  5B40 C;  3W96 A;  3AZG D;  5B32 A;  3C1C B;  4WZS B;  4WU8 D;  4YS3 C;  3VH6 A;  5AV9 C;  1M19 C;  1P3I B;  3MGQ D;  2JE5 A;  5KDM B;  1P3O B;  2RVQ D;  2DQN C;  3MVD B;  5B24 C;  2F8N B;  3AV2 B;  3KUY B;  1TZY D;  1ID3 A;  3KWQ A;  5GXQ D;  3AZK D;  5AVB A;  3MGS D;  3REK D;  5GT3 C;  3FDD A;  3AZF C;  1B67 A;  2Y2O A;  4G92 C;  5CP6 B;  1P3B D;  2PYO B;  5GT0 C;  3X1S A;  3AZI A;  1M18 A;  2ZM5 A;  1P3P C;  3W96 D;  3UTB A;  5AY8 B;  1KX4 A;  3UTA B;  3R45 A;  5BNV A;  3IP4 C;  3KXB B;  5B33 C;  5AV6 C;  1EQZ C;  3W98 B;  5B2I A;  5CPJ A;  4X23 A;  3AV1 C;  3WKJ C;  1P3K B;  3H0M C;  2NZD B;  1ID3 D;  4WNN A;  3KWQ D;  5DNM D;  5C3I B;  3TU4 A;  1F66 A;  3AZH B;  3AZJ B;  5AVB D;  4XUJ A;  2F8N H;  3REL A;  5B24 A;  5F99 C;  1KU5 A;  5JA4 A;  3VH5 T;  3X1S D;  3AZI D;  1M18 D;  3W99 B;  5B1L A;  2CV5 C;  1P3L C;  4Z2M G;  3EPH A;  4NE5 A;  3UTB D;  1KX4 D;  4H9Q A;  5BS7 A;  3X1T A;  5GT3 A;  3AFA A;  5DNN B;  3AZF A;  2NQB B;  5B31 C;  3MNN A;  3A6N A;  5CPK C;  4XZQ B;  4WU8 C;  4X23 D;  4H9R B;  1P3P A;  4NE6 A;  5B40 D;  1KX5 B;  4QLC B;  4KUD B;  3MGQ C;  3X1U B;  5AVC A;  2RVQ C;  5E5A C;  5G49 B;  4Z5T A;  4WU9 C;  3TU4 D;  1F66 D;  2ARO A;  4XUJ D;  3O62 B;  1W2E A;  3REL D;  1Q9C A;  4H9P A;  5B24 D;  3REH B;  5GXQ C;  1H3O B;  4WJ3 C;  4J8V B;  4NFT A;  3REK C;  5B1L D;  5AV5 A;  4J8U A;  2FJ7 A;  1WWS A;  3WTP B;  1P3B C;  5B0Y B;  3X1T D;  4UUZ A;  5GT3 D;  3AFA D;  3H0R C;  3AZF D;  3AZL B;  1BH8 A;  3W96 C;  3MNN D;  5B32 C;  5B1M C;  3W97 A;  4Z66 C;  1P3P D;  2CV5 A;  5GSU B;  5AVC D;  1U35 B;  4Z5T D;  3AZG B;  1M1A B;  2ARO D;  5B32 G;  2BYM B;  1EQZ D;  3AYW A;  3REI B;  5CPK A;  1ID3 C;  4CAY B;  2JSS A;  3C1B C;  4KGC B;  1AOI B;  5E5A A;  3LZ1 A;  4J8U D;  4WU9 A;  2FJ7 D;  3LJA B;  3A1I A;  1N1J B;  3AZI C;  1M18 C;  4H9O B;  3B6G A;  3AZE C;  3AZK B;  1KX3 B;  3UTB C;  1KX4 C;  5BNX A;  1HQ3 A;  3W97 D;  3REJ A;  1P3M A;  2CV5 D;  1BH9 B;  1S32 A;  1HTA A;  5B2I C;  4ZBJ C;  5CPJ C;  4X23 C;  3AYW D;  4ZUX B;  5B1M A;  5CPK D;  4Z66 A;  4G91 B;  2HUE C;  4YM6 B;  3TU4 C;  1F66 C;  2F8N G;  2ZY5 A;  3NQU B;  4LD9 B;  1R4V A;  3AZM B;  5BT1 C;  5E5A D;  4XUJ C;  2XD5 A;  4R8P A;  3REL C;  3LZ1 D;  4WU9 D;  3NQJ A;  3B6F A;  3KWQ B;  5DNM B;  4J8X B;  2IO5 B;  2HIO A;  4JJN A;  3B6G D;  5B1L C;  3AZN A;  5AVB B;  3UT9 A;  5AV8 C;  3P5J B;  2Y2K A;  3C1B A;  5BS7 C;  3REJ D;  1P3M D;  3X1T C;  3AFA C;  3WA9 B;  2Y2N A;  2Y2J A;  3X1S B;  1S32 D;  4J8W B;  5B0Z B;  3MGP A;  5B2J A;  2BYK B;  3MNN C;  3A6N C;  1P3G B;  5JRG B;  3MGR B;  3C1C A;  4AWL C;  3AZE A;  5CPI B;  5B32 D;  5B1M D;  5C3I C;  1JFI B;  5FUG B;  5AVC C;  4Z66 D;  2BG1 A;  5KDM A;  4Z5T C;  1P3O A;  3MVD A;  4EO5 C;  2ARO C;  1ZLA B;  3LZ0 C;  2F8N A;  3AV2 A;  5B40 B;  4E45 A;  3B6F D;  4YS3 B;  5AV9 B;  1M19 B;  2HIO D;  4JJN D;  4HGA C;  3AZN D;  3UT9 D;  5AV5 C;  4J8U C;  2FJ7 C;  3C1B D;  1P3F C;  5B24 B;  3LEL C;  5CP6 A;  4DRA A;  4M6B A;  2PYO A;  3MGP D;  5B2J D;  1KX5 C;  2Y2I A;  3W97 C;  3C1C D;  5AY8 A;  3UTA A;  4DRB A;  3AZE D;  3A1K A;  5AV8 A;  5GT3 B;  3KXB A;  3AZF B;  4G92 B;  1P3O D;  4WV4 B;  5GT0 B;  3MVD D;  5B2I D;  5CPJ D;  3AYW C;  2F8N D;  1P3K A;  3AV2 D;  1TAF B;  3EPK A;  2NZD A;  5B33 B;  5AV6 B;  3AZJ A;  1EQZ B;  4CSR B;  3LZ1 C;  1P3A C;  3AV1 B;  5CP6 D;  2FFF B;  3LZ0 A;  5BT1 D;  3WKJ B;  2PYO D;  3B6G C;  3W99 A;  1HQ3 C;  4H9N B;  3REJ C;  1P3M C;  5AY8 D;  3UTA D;  5AV8 D;  1S32 C;  3WAA B;  3KXB D;  5DNN A;  1P3F A;  3LEL A;  5F99 B;  4XZQ A;  4H9R A;  3A6N D;  3KSY A;  2CV5 B;  1P3L B;  1KX5 A;  1B6W A;  4QLC A;  2NZD D;  3X1U A;  1P34 C;  2Y2M A;  2VQR A;  5G49 A;  5CHL B;  2YFV B;  5BO0 B;  2J8P A;  4R8P C;  5B31 B;  3X1V C;  3AZJ D;  2YFW A;  3O62 A;  3V9R A;  4WU8 B;  3B6F C;  3REH A;  3LZ0 D;  1H3O A;  2HIO C;  4JJN C;  2Y2G A;  2Y2L A;  4J8V A;  3B0D C;  3MGQ B;  3AN2 C;  3W99 D;  3AZN C;  3H0L C;  3UT9 C;  5E5A B;  4KHA B;  3WTP A;  5B0Y A;  5AV5 D;  1TZY B;  3MGP C;  5DNN D;  5B2J C;  1P3A A;  1P3F D;  3LEL D;  5GXQ B;  3C1C C;  4XZQ D;  2ZY2 A;  3MGS B;  3REK B;  4G91 C;  1P3I C;  1KX5 D;  4QLC D;  3X1U D;  5GSU A;  1P3O C;  1P3B B;  1U35 A;  3MVD C;  3AZG A;  1M1A A;  2BYM A;  3AV2 C;  3KUY C;  3W96 B;  5B32 B;  5B1M B;  3O62 D;  3REI A;  4Z66 B;  4CAY A;  3REH D;  4J8V D;  2UWX A;  4KGC A;  4H9S C;  1AOI A;  1P34 A;  5CP6 C;  2LY8 A;  3WTP D;  3LJA A;  3X1V A;  2PYO C;  5B0Y D;  1ID3 B;  2F8N K;  1P3A D;  1WWI A;  4H9O A;  1KX3 A;  4NE3 A;  5AY8 C;  3AN2 A;  3C1B B;  3UTA C;  3KXB C;  1HQ3 D;  1BH9 A;  3W98 C;  5GSU D;  2RIQ A;  1U35 D;  3AZI B;  1M18 B;  1M1A D;  1P3K C;  3AZE B;  4ZUX A;  3UTB B;  2NZD C;  3REI D;  1KX4 B;  1BFM A;  3R45 B;  3VH6 W;  5BNV B;  1A7W A;  2Y2Q A;  4UPK A;  1P3I A;  4YM6 A;  3AZH C;  3AZJ C;  2Y2P A;  4KGC D;  5B2I B;  3NQU A;  1ULY A;  4ZBJ B;  3AZM A;  5CPJ B;  1AOI D;  1P34 D;  4LD9 A;  4X23 B;  3LJA D;  4R8P D;  3X1V D;  4J8X A;  5DNM A;  3KUY A;  3W99 C;  3EG5 B;  4WNN B;  1KX3 D;  2HUE B;  3TU4 B;  3AN2 D;  1F66 B;  4H9S A;  4XUJ B;  5DNN C;  3REL B;  3WA9 A;  2NQB C;  4J8W A;  5JA4 B;  5B0Z A;  2Y2H A;  2BYK A;  1P3G A;  4XZQ C;  5JRG A;  3MGR A;  3WTP E;  5B1L B;  5CPI A;  4QLC C;  4ZUX D;  5AV8 B;  4KUD C;  1JFI A;  3X1U C;  5FUG A;  4H9Q B;  1T3U A;  3X1T B;  3AFA B;  1P3I D;  4YM6 D;  1ZLA A;  3W98 A;  4LD9 D;  3MNN B;  3A6N B;  3AZM D;  3O62 C;  5B40 A;  2F2A C;  3REH C;  1P3P B;  4AWL B;  4YS3 A;  4J8X D;  3KUY D;  2ZY4 A;  4J8V C;  5AV9 A;  1M19 A;  5AVC B;  4Z5T B;  3WAA C;  4EO5 B;  2ARO B;  3WTP C;  3AZH A;  5B0Y C;  3LZ0 B;  3WA9 D;  2L5A A;  4H9P B;  4J8W D;  3AZL C;  5B0Z D;  1P3G D;  5JRG D;  3MGR D;  3B0C T;  3VH5 A;  4HGA B;  3EPL A;  5CPI D;  3VH5 W;  5AV5 B;  4J8U B;  1Z2C B;  2FJ7 B;  5GSU C;  1P3F B;  3LEL B;  1U35 C;  4UUZ B;  3AZG C;  1M1A C;  3B0C W;  5GT0 A;  1ZLA D;  2NQB A;  3W98 D;  1BH8 B;  3REI C;  1TAF A;  3W97 B;  2G5H C;  1P3K D;  4YS3 D;  4KUD A;  5AV9 D;  3B0B A;  5B31 G;  1M19 D;  5B33 A;  5AV6 A;  1AOI C;  4KGC C;  1EQZ A;  4CSR A;  3KFU G;  1TZY C;  2YFW B;  3V9R B;  3LJA C;  3AZH D;  3AV1 A;  3AYW B;  3WKJ A;  5CPK B;  2XD1 A;  3AZK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...