2FJAB

Adenosine 5'-phosphosulfate reductase in complex with substrate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
149
structure length
149
Chain Sequence
PSFVNPEKCDGCKALERTACEYICPNDLMTLDKEKMKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTVKYRNGKVLRFKFAIRTTPWGSIQPFEGFPEPTEEALKSELLAGEPEIIGTSEFPQVKKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reaction mechanism of the iron-sulfur flavoenzyme adenosine-5'-phosphosulfate reductase based on the structural characterization of different enzymatic states
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords adenylylsulfate reductase, subunit A
total genus 21
structure length 149
sequence length 149
chains with identical sequence D
ec nomenclature ec 1.8.99.2: Adenylyl-sulfate reductase.
pdb deposition date 2006-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF12139 APS-reductase_C Adenosine-5'-phosphosulfate reductase beta subunit
B PF12800 Fer4_4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fjaB01
3.30.720.40 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 2fjaB02
1B0PA 1B0VA 1FF2A 2FJBB 3MMBB 1FXDA 1SIZA 1FEHA 1BC6A 1H98A 3MM9A 1G3OA 1CLFA 5FD1A 1BLUA 1SIWB 2C3MA 1KEKA 1Y5LB 1BQXA 2V4JA 1D3WA 3OR2B 2C3PA 5L8RC 1Y4ZB 1RGVA 2Z8QA 1IQZA 1H7XA 2FD2A 2ZVSA 3MMBA 3MMCA 1GTHA 1FRMA 1JNZB 4Y28C 1PC5A 4XDDA 2C42A 1A6LA 3MM5A 1GT8A 1Y5IB 3OR1B 1FRXA 3MMAA 1JB0C 1FTCA 1FDNA 1H0HB 2VPYB 4KT0C 5CHCB 2WSFC 3MM6B 1AXQA 1FDDA 1K0TA 4CI0B 4L6V3 1FRJA 1FDAA 6FDRA 1H7WA 5BYQA 5CH7B 2UZAA 2WSEC 7FDRA 1R27B 2FGOA 2PMZD 4OMFG 3IR5B 2XSJA 2WAQD 2VKRA 4OV1A 2C3OA 2GMJA 3IR7B 1FERA 1GAOA 3IR6B 2FJEB 1DURA 3HKZD 3GYXB 1GTEA 2Y0SD 3EUNA 3MM7A 1F5CA 3MM8B 1F5BA 1FD2A 1PC4A 1JNRB 2C3YA 1KQGB 2PA8D 1C4CA 1F2GA 2IVFB 4ID8A 4DHVA 4YDDB 1BD6A 1FRHA 1SJ1A 2FDNA 2XSJB 2PDAA 2FJAB 1BWEA 3MM8A 1C4AA 1G6BA 3MM7B 4RKUC 3MMAB 3OR1A 5E7OB 4AYBD 1Y5NB 1IR0A 1Q16B 1FRKA 1FRIA 3C8YA 2C3UA 1WTFA 4XK8C 6FD1A 2VPZB 3EXYA 1XERA 3EGWB 3MMCB 2V2KA 1B0TA 1HFEL 2WB1D 3PNIA 2V4JB 1FCAA 2GMHA 1KQFB 1FDBA 1DAXA 7FD1A 5BYRA 5BYSA 3MM9B 2WSCC 1VJWA 2O01C 1ROFA 2VPXB 1FRLA 2VPWB 3MM5B 4XDCA 3MM6A 3OR2A 3LW5C 1DFDA 1FXRA 2FJDB
chains in the Genus database with same CATH superfamily
4I2PA 5J2PA 4CT9A 3IWLA 1B0PA 1QSYA 4TU9A 2BRKA 3QJPA 4DSLA 1RA7A 1SH2A 3M8SA 4X64J 5KFAA 2WONB 3VGUA 1SIZA 4YOEA 4B9UA 1GXUA 3G82A 4FYXB 3N01A 2J9CA 2NZCA 3HZGA 3MM9A 3QT6A 2IY5B 2G2OA 2DRAA 1WD6A 1Q78A 4ICLA 1JKHB 2DHXA 3IA0A 2RS8A 4ZVTB 5GMDA 1OY6A 1IKXB 3MUTP 4X4NA 4LFAF 3DM2A 1PAEX 3IXQA 2AJQA 2V5HG 2J9DA 2BR0A 5CYMA 5BR8F 3MURP 2BANB 1T9WA 3FKBA 3FEYB 1U6BA 1FESA 3LPYA 3MEEB 3DLEA 2OKQA 2QV6A 5IS2A 4PAAA 3KMSA 4N77A 1MMLA 1HKAA 1PILA 3FC9A 3R7NB 1OSCA 3DN9A 3N4WA 4IYQA 3BO3A 1RWXB 4K4YA 1AB8A 5A0YA 4WTOB 5AXNA 1T03A 2CA9A 1VC6A 4PQUB 2HNYB 1QAYA 4ZA1A 3QRQA 4KH0B 1YBUA 4EO6A 2AHOB 5EUHA 3EM1A 2ZE2A 2WW4A 4LSLB 3I0SB 4KGKA 1RT2B 3R97A 2AJ4A 3PRBA 4OZ1A 2UVVA 1APSA 5ETVA 3MR7A 4AL7A 1HNIB 4DL2A 1KTVA 1RT1B 2LKZA 2UZAA 2QMWA 2W1BA 3AA9A 3RGIA 5C5JA 1X0FA 1AW0A 3LP2B 4UTGA 1DY3A 2FGOA 3DOLB 3O8WA 3RRKA 3ZZZA 1JJ4A 4DSIA 1WORA 2R8GA 4JOUA 4K0KJ 2QG9B 1X5SA 1GFWB 2YVSA 2JLGA 1HBOB 2KYZA 2VG5B 4C8MA 3OD2A 2XCPA 3DRYA 2BM0A 1UFWA 3KK1A 2HMIB 4NCAA 2DGQA 4NLOA 3GYNA 4RW8B 1R8CA 3CEDA 2VG6B 4F50A 2W9CB 3T3FA 3NGSA 1UZHA 1FA0A 3EZOA 2GGPA 5I3UB 3AJ2A 2ZBCA 4DV0J 1SL0A 4B3OB 2BJEA 3IRXA 5EWFA 4LRFA 3HFVA 3OJUA 1S1TB 1UAWA 1F9FA 2NUUG 1CQMA 1KQKA 1YGYA 1QE1B 5A2QU 3A4TA 2FIUA 3W61A 4YN3B 2J6TA 4HYKA 4IQXA 5ETNA 3QSYB 5GADI 3NWGA 3HD1A 1KP6A 4I1TA 1WF0A 1SQEA 1F2GA 4DHVA 1H2VZ 2AWZA 3OXLA 4USVA 2BM1A 4DSEA 3JSBA 2CPYA 3KLGA 1RUSA 1TQLA 2GW8A 3NBPA 1TL3B 3L09A 3UE2A 4CLKA 5U47A 4USMA 1RT6B 1U6ZA 3ILOA 2H48B 3IM9A 4PG8A 3ENAA 3DDNA 1DHMA 4A8SA 2CQGA 2HMIA 1Y5NB 5D4PA 1NJWA 5SZTA 2IBKA 2HVEA 3T1YJ 1ZA2B 1RYSA 2XHWA 5KT6A 5A8RA 3WZ0A 2MQQA 1U2FA 3LALA 4M5DB 3VGTA 3M9MB 3UDEA 4DV2J 1VBXA 4F4WA 2F9DA 2ZZTA 3CXCR 1DQ9A 3C6UA 2UV8A 3HJVA 1XERA 3CCUS 1BE4A 4R0JA 3ENWA 4OZ2A 5CABA 3MAQA 1RAIB 1F9EB 2OGUA 4X65J 2W4PA 1LFPA 5IT0A 2YWHA 1N33F 5CD4A 1O5JA 4X65F 1FWLA 1YRTA 4IQMA 4ZCLA 3D9BA 1U1QA 1HBUB 2MKYA 1SL1A 1SQGA 2FJVA 1DTQA 1W26A 3BGLA 3OQ2A 3OR2A 4NXMJ 1SPBP 3P45B 4LRDA 1K8AT 5E33A 4IFYA 1HQEA 1X60A 1X4HA 2NXUA 2ZWPA 5KFZA 3J81j 3UFCX 2IVYA 4GVBB 4QIGA 3CD6S 2XI3A 4ZCMA 1CQNA 1PJ6A 2BANA 2K4NA 1NPKA 2JNJA 2P9EA 2X1FA 3M6WA 4LR7A 4Q5VA 4ED2A 2UUAF 1LXNA 1LFWA 1U2RA 4QU6A 4DLGA 1SJQA 1S1VA 1TELA 3BGFA 1VISA 3PR4A 2PEHA 1UPMB 3OHAA 4J9OA 1K1SA 2XBPA 1S7HA 3RB6A 2RF2A 2K8GA 8RUCA 2IC3A 1SL2A 1HI8A 2CADA 3ZXWA 3CC2S 2VHGA 4QU7A 1AZSA 1XJWB 5BR8J 4YB6A 3HULA 3TA1A 1M5VC 4DS5A 3K57A 3M6UA 4AKXB 3BKUA 3DOKA 2YTCA 2W9AA 3UCGA 3JAMY 1UVMA 5KG6A 1HNVA 2QMUB 3I5AA 3MM5A 1Y5IB 1V3ZA 4NCBA 5SUHA 2RHQB 3IGNA 4Q45A 1XQIA 4K5SA 1HQEB 3H42A 2BKPA 1HWIA 4H4KA 5M2RA 4PKDB 4OFZA 5D4OA 2E5IA 1J27A 2O5DA 3TVKA 3VGSA 4ZN1A 4DQIA 3DRSB 1TAUA 3OVSA 4DL6A 5H9EJ 4JI7J 3DRPB 4IOAQ 4N76A 4Q7AA 3MGJA 4IH7A 4WE1A 4WF9Q 1XMOF 5GAEU 1JQGA 1ZTTA 4ZVGA 1S72S 3NBPB 4ED0A 4C6AA 4HACB 3TYTA 4C7QA 3IR5B 4O3RA 4FXWA 3M2VB 4NA3A 1QUPA 2WVEA 1S57A 1PBAA 2WRMA 1DTTA 1HPZB 2VZ9A 4RW9B 4DN9A 2C3OA 2PIIA 4PG7A 5LXRA 4F4YA 2UUAJ 2MMYA 2N82B 4GC6A 2HK3A 3U1MA 4Y2IA 5A8RB 4YB1P 1LV5A 4LIWA 2H5JB 5LSOA 5GAHI 3Q23A 1914A 1IWGA 2EFOA 3BZQA 1VQ4S 4AQYJ 3T6JA 3T41A 3DMJB 3IO1A 3EUNA 3SCLE 1MNEA 2OI2A 3J81U 1UVIA 4LQ9A 1ZM2A 5EHHA 3FCHA 2YX1A 5EX3A 4JI8J 2NR0A 3DLKB 5C25B 2YX4A 1FRHA 2I2YA 1HBOA 1N88A 1RADB 1YJTA 2VG5A 3FSYA 1WG1A 1WC4A 2FY8A 4OYBA 1OMSA 3H8YA 4E8UA 1RYRA 4DDFA 1RHQB 3BKTA 3LWLA 3GFYA 4ZIVA 2ZHBA 2P2CB 4YFUA 1Q0NA 4I0WA 2HKEA 3POTB 2RD5C 3WC0A 2DNLA 4F25A 1S1TA 1SJRA 2RRBA 2PMWA 4QWEA 3M1VB 4FBTA 2XHCA 1VK8A 4O44B 1EETB 3GJQB 4N56A 2A6MA 3QRPA 2CJBA 1I1GA 2PA3A 3BQ0A 1N32F 1HL6A 3EXYA 1FNXH 3KWMA 1C2PA 3EGWB 3MMCB 4JUZA 3KK1B 3BN4A 3QMQA 3M8QA 4MYUA 2CPEA 5L1LA 4J9KA 3PNIA 4G1IA 2R42A 3LGNA 1VQPS 3I5BA 4ZPDA 3M4XA 2XQCA 4PZVA 3CF5Q 4LF9J 2DTJA 4XIFA 3DLJA 2R7TA 4RZRA 3I55S 2W4CA 2D41A 4NLSA 2EKYA 4JP8A 1U24A 5I3PA 4DPYA 1NHUA 4QWDA 4RLEA 1B64A 1VBKA 2IRXA 4O3OA 2W8LA 2QA2A 2EBGA 3DGPB 1E6VB 4GVLA 3RR7A 4LRAA 3CE8A 1FXDA 2L41A 3TAMA 5LT5A 3JSMB 4HDHA 4X4TA 3BBCA 1ZH5A 1NAQA 4P2MA 5B0AA 4ITSA 2V4QA 1NK5A 4F4XA 1QVGR 3KTQA 2MSSA 4A48A 1OWXA 3DLGB 3ZNJ1 1KEKA 3UQSA 4DR7J 2GHPA 2IFXA 1JLAA 3VAGA 5AOXB 3BO4A 3HVRA 1Q81T 4O3NA 4IRCA 2B4VA 1UKUA 3IBFB 5AE2A 4U7CA 4Y2AA 3Q22A 1HWLA 1WOOA 2VQEF 3ETMA 2RAQA 4OJHA 1OY9A 2IYGA 2ZNZA 2ERRA 3GP9A 1N5TA 4ANEA 3TANA 2VQEJ 3H5UA 5ETMA 4F26A 4DR6F 1HD1A 1A6LA 4OYPA 2Z57B 2HNZB 3H2UB 3IAS9 3M8QB 5IV4A 3VVUA 2CYYA 3N6LA 1HARA 4ZKAA 2KZMA 2IYIA 1FTCA 4P73A 5CHCB 2DD8S 4LFCF 2IJNA 3ZZPA 2XYHB 4DG1A 2XY7A 2DNHA 3THTA 4DLEA 4LF5F 4A8QA 1W2BR 4QZVB 2IBOA 2KU7A 3GSIA 3HHLA 1Z4UA 4A47A 2R8JA 1H7WA 1TUVA 2GNKA 2OFGX 1TL5A 2MEWA 1H2UX 2EEYA 2CKWA 3IFEA 2D3UA 5D4NA 3K8WA 2AKWB 3HDSA 5J2MB 1XMQF 2PT0A 1RA6A 1XR5A 3HM9A 1WEXA 2ZUAA 1T02A 4KYZA 3QJLA 1R31A 1U8SA 1WG4A 3JTNA 3KJQB 3QFHA 4Y2MA 3CDAA 5LSLA 2VKRA 8AT1B 3ITWA 4F67A 4V19J 4I2QB 2B9XA 1FERA 1GAOA 3PX4A 1T9UA 2AX1A 2XO7A 2BQRA 2LA4A 2Z58B 3OLAA 4ED8A 2JH3A 3M1VA 4AFFA 3FQKA 4LUBA 3P96A 1RLDA 2Q3PA 1N48A 1JLEA 5LL6d 3Q0AA 4J7CA 3CCLS 2D74B 2GO9A 3V81A 2YKQA 4FDFA 3X3UA 3NWRA 5HVHA 2QO3A 5IZHA 4XO0A 2PA8D 1SC3B 1C4CA 2AF6A 4RBVA 4FYYB 4NCGB 2WBMA 3MPYA 3W1YC 4DBQA 3NP5A 4ED3A 3QLHA 2MGZB 1U09A 4NLTA 2XGQA 2W7PA 4WP8A 4WPAA 2KG1A 4I69A 4DV6F 3PVXA 4NLDA 3MM8A 3NGTA 2NXCA 1OY8A 4ETXA 4RNNA 3CCSS 4A8MP 1RT4B 2GZOA 2CQBA 2IDLA 3KYLA 3PYFA 3EGNA 2KKHA 1ZAXA 1UL3A 4BC7A 2HFZA 2V63A 1S6UA 1VIOA 2J6UA 4MKYA 2VBXA 2E1CA 5L9NA 3H4BA 4USHA 5L1IA 3W2WB 3V4MA 4CLLA 3TZYA 1SKRA 2HHTA 4ANDA 1KLMB 1HHQA 3PEJA 2HHQA 3C14B 4NLRA 3W64A 4ZP7A 4OX9F 4DUYF 2EC2A 2DPIA 1JJHA 3QJJA 1EJ7L 5IC6B 4HLBA 3SSRA 1YI2S 4BC9A 3U02A 3FK4A 3P4UB 4WTYA 4ERDA 1R89A 5ETRA 1R8PA 3QWUA 1NK9A 1HR0F 4CO3A 4JV1A 3NOGA 9RUBA 3EGZA 4O23A 1YX2A 2M2BA 2KVQE 3MM9B 5DRKA 3ISNC 3BSOA 4A8FA 1X4GA 2ALZA 5D0RA 3IWNC 3W3SA 1RABB 1FRLA 2HNDB 2OPQA 4XDCA 4OQJA 3MM6A 3TAMB 5B0BA 4QQBA 1TTHB 1UEKA 3VCDA 1RLCL 3JAMU 4TLRA 3M9OB 3BQ2A 2IIHA 2GA7A 4JI6F 2C2DA 3WIVA 3NOCA 1X5OA 3OPKA 3TUIC 3SDEA 3GTYX 4M63A 4MT1A 4FF2A 3TEHB 2BABA 3CJQA 3NGRA 1X7VA 3VF0B 4ZS6A 4UT4A 5DM6Q 4EZ6A 4NRUA 1Q7YT 2R9LA 4RBTA 3CCRS 3M6XA 2ZEJA 2EBEA 1G3OA 3DRRA 2N7CA 3MPUB 3D2WA 1TU0B 3MR6A 2HHXA 5JXSA 2DNMA 4UOFA 1PYTA 2I0XA 1YK9A 1Y5LB 2V4JA 3T9ZA 2MQPA 3CCES 1VQYA 4C97A 3I0RA 1RSCA 5J2QB 3SBMA 2UUCJ 4OI1A 4RWXA 1IBLJ 2IMOA 2IA0A 1CS4A 2J6SA 4C3LA 1FFGB 4I2PB 2BRLA 2CQIA 4ID5B 5HBMA 4NLXA 1NB7A 4NRTA 3UD5A 5D6GA 3BV8A 5HVFA 4CO0A 1VQKS 2NREA 4JI5F 1KDNA 4HHUA 2EKNA 2C2NA 2OUGA 4WYWA 1JLCB 4CRJA 5GAHU 4TU8A 2HZVA 4DR4F 3CULA 1EP4A 2DK2A 2KN4A 2GO8A 1AROP 1PIEA 3DDKA 3HJFA 2HWHA 2GHVC 2F7VA 5E0OA 2WB4A 4FF3A 3P6YC 4ZVPB 2CWXA 1TR0A 3PG9A 1HBUA 2DNPA 2ZOMA 2VJVA 4EGLA 3PYEA 5HMZA 5A8KA 2YWEA 1IKYB 4A4JA 3FCWA 1VQ8S 4LRBA 1R0BG 1B3TA 2RILA 3QGIA 4R25A 1YBTA 4NEZA 2YNFA 1URNA 1YKWA 4LF1A 1TL1A 2WVCA 2FZGB 4DU8A 1B7FA 1ZM9A 2EG1A 3D1QA 4AUKA 2Q6BA 3IR7B 1RAGB 4X4QA 5KFRA 4RWWA 3M30B 2CNKB 4MH8A 2NCKL 4WBFA 1C0UB 1LEOA 1NU4A 4C0OC 1HQUB 3GG1A 3L9ZA 5IXUA 3KJVB 4JI1F 2G1DA 4XTTA 1RAAB 3S1TA 4WIQA 4RNFA 2LEBA 4IDKA 1WC1A 4L3NA 2QA4S 3IRXB 3EPIA 1MROA 3MM8B 1F5BA 4TYBA 4DCOB 4NXNF 4D3GA 2XMWA 2JHEA 3MOZA 1JNRB 3DOMB 4OHXA 1M5SA 3NMAA 1IKYA 3J7Z5 5A2QY 4FP9A 1QVFR 1NK4A 1HNXJ 3TJ9A 1X5TA 1GX5A 3PHEA 2RDDA 4ZVHA 4F2SA 2KT3A 2FDNA 1FJEB 4DV3F 1WHWA 3R6GB 1TK0A 5KFBA 5HMXA 1SV5B 3HT0A 4UZBA 1A9NB 1V3RA 2OLWA 4O4RA 3ICLA 3V6KA 1O0PA 1WHYA 1KTQA 2J0XA 3RBEA 4DV6J 1IKWA 3AA8A 2X1GA 3N6MA 4FS1A 3GYGA 2FGCA 3LUYA 2HHPA 2XZWA 4IG0A 3QYYA 4FYWB 4OHZA 1Y10A 3TX8A 3DDIA 1QSSA 2C3UA 5K8OA 2KYXA 1HHTP 1WTFA 3VGVA 4ZLJA 1UPPA 3L4BC 3SCKE 1K73T 3ZTPA 3CVKA 3JS9A 4WP3A 1B4SA 4O3SA 1S9EA 3GFZA 2UV8G 2IJRA 2C22A 1TK8A 2DHHA 2ZH7A 4E2FB 2F8HA 4M5IA 3DLEB 1UZDA 1IBKF 2V8PA 1S6PA 2LU2A 3AFGA 4AD6A 3FBFA 4LIRA 3JSYA 5G4DA 3PIPQ 4PUOA 1TUWA 5DO2A 3GQCA 3MM5B 1F6TA 1UVNA 1ACMB 2HG4A 4Q0BB 3SYZA 5IM0A 1XN9A 2DGTA 1XNQJ 3KLIB 5THWA 1NJZA 4GKKF 4NX9A 4QPTA 4DX8H 1NNDA 3N28A 2HNYA 4WZMA 3OMSA 3KK3A 2GMLA 1AZSB 2ASDA 3D6HB 4CYUB 2IC3B 2Y0BB 4J37A 3H40A 3PW7A 4PXBA 3NMRA 2I1RA 2OSRA 3UD4P 5HO4A 5I42A 3VV2B 2HBZB 4X4RA 3CCVS 3RB4A 3E3XA 1BWVA 1ICEB 4JI0F 1LXJA 3OFEA 2B6AA 2DNOA 2NPIA 4M5GA 4F2RA 2EK1A 1RWVB 3KUEA 1IBMJ 3DM2B 3OTBA 2JLFA 4OZNA 2E7VA 5A8WA 4MK8A 1IQZA 5KFKA 3CO0P 4PQAA 2R7XA 1JWWA 3C6UB 4F36A 3V6DA 2XGPA 3TEGA 3FCVA 2GJIA 2ZOFA 3N79A 1RTIA 4MFBB 2C42A 3QAUA 1Y3KA 3R3TA 1MMDA 5DDOC 1X8DA 1FRXA 5DM7Q 3KOAA 3U7JA 4OHYA 1TKTA 2C2KB 1JLQA 1NB2A 2VPYB 2G4BA 1TKDA 4ZITA 3OTCA 1WEYA 1FDDA 2DGXA 2F40A 1T05A 3GZ7A 3EDQB 2HHHF 4PUOB 1R0CB 4ZK7M 3M8PA 3D67A 2FC9A 2ILZA 3CMES 3VWSA 2E66A 1NK7A 2UVUA 2VBYA 4B9NA 1Z1ZA 1HMVB 4NYOA 2DIVA 3DFEA 2VBWA 2NYIA 3W63A 1JX4A 2VA2A 5J1EB 4DCJB 4ZLLA 4WWSA 4KJIA 4ECUA 2VC1A 1QD1A 4RO0A 1PAUB 4GRSA 1VQ7S 3VAMA 4OJ1A 3NLCA 4QW8A 5ITHA 1REVA 2E9TA 3AJDA 3DYAB 4OYMA 3G71S 4NMLA 5H9FJ 2VL1A 4KBIA 3HKZD 3SV4A 2VB6A 2OP5A 3IS9B 4W92B 3Q24A 4CLWA 3MOJB 2CQ0A 3U27A 1VR6A 1UW9A 5CZXA 4K50A 3HVTA 3MEKA 1E6YA 2YWKA 4ALZA 1KBRA 3X1LB 1RK8A 2E1PA 2HAIA 4C48A 3SQOP 4B17A 4YY3F 2B4OA 2GS8A 1A0OB 3LP1B 3L95X 4ID8A 5RUBA 2F1FA 2MJUA 2KFZA 1K44A 4WKRA 4B3SF 4K8RA 3HHLD 2PI4A 2YNFB 4XI9A 2XMMA 3D7SB 4JBCA 4LSLA 1HI1A 4PWUA 3KLHA 3NY0A 3K5NA 1BWEA 4RW8A 4P2XA 3DYAA 3L3CA 1G6BA 4YUDA 2Q43A 3GSDA 3H4DA 2VOOA 3D5MA 2A10A 1SQFA 4A8KA 1SXLA 3CTRA 3FBEA 1Q16B 1C0UA 4R5PA 3UD3P 1U49A 4Q8EA 4ILMA 1L5UA 3M30A 2HIYA 3LP2A 4DX7A 4PG6A 3TVYA 1IN0A 4QW9A 1PKUA 4X62J 2V50A 2PI5A 4LF6F 2RKIA 3KHGA 4RW6A 3KLFA 4DFMA 5HP1A 4DV1F 2JEFA 2GCFA 3ZTSA 1Q1KA 3Q8RB 4DV4J 1KKHA 1U1MA 3J7A1 4PEOA 4N39A 2FLOA 5E41A 3B8HA 3QSIA 4ES2A 2BA9A 3NCPA 2QEXS 4PG5A 2J7WA 5B0EA 2DITA 3OHBA 1PSDA 4Z7CA 1UVJA 4UYJA 1IBKJ 2IM0A 2RHSB 2VPXB 3T1HF 5KFUA 3IM8A 3NCRA 5T14A 1N36J 3HSGA 4PYDA 1VFJA 1KWMA 5KG0A 3VQSA 1TL4A 1ZAVA 2E29A 1B0VA 2YBVA 1EP4B 2DNYA 1S1VB 1UWAA 4GKJJ 3LOUA 3DGPA 3E01B 2ZDPA 3BF4A 4KO0A 2F4VF 1X4FA 1WEZA 2CJXB 1S0NA 1HWUA 1Y9OA 3HHDA 5HROB 1P9QC 2CIMA 4ID5A 2QLBB 5HBMB 4NLGA 1VRUB 1YJRA 4GO7X 3SXLA 3AXMA 4O4GB 2J8SA 4ER8A 1XBWA 4V1Ak 4ZVQB 1SH3A 1XEZA 3BKFA 2C2EA 4M95A 3KG1A 4KE5A 5KFLA 4JV5J 2YPZA 5DQIA 1BXNA 3KNGA 1RT5A 2M52A 1YJWS 4L72B 2PC6A 1NJIT 1JLFA 1S0OA 2KHDA 3NG8A 3KLIA 1E6VA 1U25A 2D7SA 3DLHA 5IM0B 5DG7A 4AY6A 2DB1A 2RSQA 1NH8A 2X5TA 2JL9A 1NDKA 4N8OA 2MQOA 1LW0A 3CD5A 1DARA 2KXFA 4ECRA 2ATLA 4LMZA 4BWMA 5D3GB 4CM0A 3OXFA 5CQGA 5ETKA 3UR3C 3ITHB 3AODA 3QFWA 1VYAA 3G8SA 1C1BA 3Q8QB 1N5YA 3OUYA 1VQOS 2XS7A 2BJ8A 5GADU 2OEMA 2LDIA 1CJTB 4YMEA 1UVLA 5IQ6A 2J0SD 5C25A 2HHWA 1U1PA 1N5VA 4W4MA 4MK7A 1WC5A 1S1UB 4DOZA 1GMWD 3LAKA 4J9LA 1YSJA 2XC9A 5CD4H 4CZCA 5B08A 4N3AA 3KDOA 4KIAA 3DMJA 1YG0A 4J90A 2RS2A 2CQ2A 2N7YA 4RBUA 1CEZA 1ELOA 3POTA 2ALYB 2F5GA 3D4JA 2FJXA 2FVRA 2DISA 1HR0J 4IUFA 4F8RA 3W9HA 2CDRB 3SZ2A 2J7KA 4QYRA 1Z2ZA 3QAEA 2DPJA 5D77A 2W2OP 2IM3A 3PRVA 2Y0SD 3MM7A 2QFJA 3IBWA 3RYLA 2UVWA 2QL5B 3GONA 3R8YA 4U6PA 3V6JA 1TL3A 2DBBA 3PJ9A 3A3OB 1WJ9A 2HZCA 2ZOGA 4Z7YA 2JOQA 1KQSR 4O0NA 1HIYA 5F41A 5B0DA 2C2OB 1D9FA 1IM4A 2ZHOA 3K2YA 3RW7A 3C15A 1G4CA 4ENOA 2VH7A 2FJAB 3RAQA 3PO5A 2E1MC 1BUXA 3RRHA 1K1QA 3T5KA 5KFXA 4JI2F 5KG3A 4Y65A 3J81Y 1WI6A 2CQPA 2K7JA 4MKBA 4FYVB 4CLUA 3OL7A 2ZWOA 1HNIA 4NLQA 3M8PB 1L3UA 4AYBD 2MQ8A 4HTIA 4I6AA 4B3TF 2XG8A 4Y2CA 4G1QA 4FPRA 2CZVC 2ZH1A 2RB7A 3M7VA 4CQ1A 4XK8C 1HQ2A 4FPIA 2CJYB 2MQLA 2N3LA 3DC2A 1WC6A 1FVSA 2QSFA 1XWLA 1Y00A 4X66J 1YHQS 2B0GA 1L3SA 1LWEB 1QUVA 2V8DA 4K4SA 4K0KF 5IC4B 3H5YA 2KXNB 1Q95G 3VAFA 1WOSA 4LF4J 3CGIA 3D3CJ 2V4JB 3BH7B 4NASA 2K1RA 2OMLA 1NBEB 4RW7B 2F63A 1GXTA 1S79A 3ITHA 2XULA 4UOGA 4RJVA 4UQGA 3CCTA 4B9TA 2HHUA 4ZVOB 1QDUB 1FXLA 4ED4A 4DS4A 1AUSL 1WC3A 1RWMB 3D1OA 2KRRA 2RE1A 2CJKA 2CFXA 5IWAJ 3HHNB 4C8YA 4MIBA 1IKXA 1ZBTA 2DR9A 2A18A 1JKHA 4FKXA 1JLQB 2VG7A 2N4DA 4PG4A 4IFYB 3G6VA 2OH2A 3MMBB 5CYQA 5KFHA 4PWDB 5E3AA 1RT5B 2DNRA 2RF2B 4I7FA 2ZM6J 2YKMB 2KT5A 2AZ1A 1WSVA 2QFIA 5E2QA 2KHCA 5A6WA 3VVTA 1C0TB 3UR0A 4WZQA 1UW4A 1RHRB 3M32A 3W5XA 2B9YA 5E3QA 5HJYA 4EYIB 4K4VA 4HI2A 5K8PA 1MN7A 1FKPB 1NHKL 4G6VB 4DX5A 3CJ5A 4FN5A 5L1JA 3C14A 3TAQA 2DR7A 4N7TA 3PE3A 2NPFA 1HW8A 1WACA 3AD9C 4HVZA 1NKBA 4IOCQ 3QT7A 3MTKA 1IR2A 2ZJPQ 1KN6A 3N9UC 1RHUB 5LMNJ 2CPZA 2K06A 2LEAA 1WKLA 4O3PA 1RU2A 5KG7A 3PRDA 4QIFA 4LFAJ 1ZPVA 1FDNA 1H0HB 1VBZA 3VHQA 3PYDA 3AY0A 2B3TB 5KG1A 2ASJA 1EETA 1T9VA 4C3KA 3W9JA 1FEEA 3B6BA 3EYZA 2ZJQQ 1R0AA 1FRJA 2KRBA 3AQPA 3I4HX 4USJC 4IRDA 4DF4A 1R6VA 3W66A 3GV7B 2UUCF 3GMGA 5F9NA 2XLKA 5C42A 2EI5A 2FQQB 5FLXU 2L48A 4YP3A 2HRYA 3ILJA 3HXMA 3ZTRA 2FHKA 1GQEA 2DGUA 1SV5A 1QTMA 1X0PA 2RRAA 4WYLA 2D69A 4ZOSA 2MZTA 3BBBA 1PYSB 4QIVA 4IO1A 3V6HA 3NS7B 3DOMA 2FJEB 2RQ4A 3PW0A 4DZDA 3SK1A 4P72A 2VFTA 4I4BA 2W4DA 4X84A 2MGZA 3GFHA 3GIIA 3DU6A 2QGFB 2V6AA 2OEKA 4QWBA 1RHMB 1XMOJ 4F3OA 2W7AA 4OYOA 1F60B 1HQUA 2C2RA 2H4WB 3BR8A 3MCMA 4DR1J 4ED5A 3DXSX 3R9LA 1PC4A 2BE2B 2HGNA 4PXEA 3MR3A 2QN6B 4DV5F 3RR8A 2E9ZA 4J9QA 2C28A 1HBNA 3G96A 3DLKA 4ZCIA 1DRZA 1TL1B 2PDAA 1RT2A 4HT5A 4K2JA 2P8IA 2K3KA 3M8YA 3SV3A 4A46A 1UVKA 2I8EA 3TZZA 4ES3A 4DQPA 2VBZA 1ZZNA 1REVB 5ETQA 4WE1B 5D0GA 3MMAB 3DRPA 3OR1A 3ZZRA 3KJVA 3GR0A 2GQCA 4YR0A 2CG8A 4B3TJ 2O66A 3ZZTA 2O1PA 4W98A 6FD1A 1D1UA 1S59A 2P5VA 3GIMA 4RW9A 2B56A 3FBBA 2HGMA 3NRBA 4NLPA 5KOWA 1NZ8A 4XIUA 3HFKA 1S5ZA 1N5SA 3OTOF 1Y0HA 4LREA 4F0MA 5EWGA 3ZTQA 3J80Y 3HK2A 1TVRB 3TI0A 1KONA 4R8UB 2B6AB 3Q2TC 1NK6A 1VLYA 1QAJA 5F8NA 2M7SA 1DAXA 5HQ8A 3A12A 4ZCKA 4H4MB 5IOLA 3ZO7A 2Q79A 1GEHA 2FLLA 2QIFA 2I6WA 4DPUA 4KGXB 3J7ZT 1JLGA 3CCQS 2HGLA 1ROFA 1GK8A 1RWWB 3CCWA 5KFPA 4EYHB 2FFGA 4MFBA 1UFLA 4YR3A 2MDAA 1QTNB 4B3MJ 5LMUF 4GYYA 3W9IA 1MW7A 3ISZA 4CIOA 4OYAA 2W7OA 4FS2A 4DV5J 2ZBRA 3G6XA 1TFWA 5HLFB 2BMBA 4HKQA 4N47A 3FSXA 1I6JA 1YLXA 2V0NA 2E7XA 3LA0A 3RRGA 2AV5A 5D0HA 3THVA 2UXDF 3MXHP 2VASA 4JI0J 2XMJA 4CM2A 1LWXA 1NHVA 3TR5A 4LFBF 4DX6A 4DFPA 1I94F 5KFGA 2K1RB 3W62A 4U9RA 3NNHA 4LRCA 1TKXA 4Q8FA 2C3PA 3KHRA 3J80U 3EX7B 4P71A 2CNNB 4E98A 2RH3A 2LP4A 3MMCA 3IMQJ 3PDNA 3K58A 5AT1B 2E9RX 2X1BA 1NLKL 2CG4A 4ATNA 2BKOA 2BJ3A 3A8EA 2MKCA 3R7BB 4X4SA 4GKKJ 3MI7X 2J9DE 1YJUA 4J9MA 4OX8A 3US5A 1SJFA 2YKOA 2A1BA 2ZUGA 3W8PA 2HQ3A 3CJ4A 5F8GA 1S1WB 2R2RA 4DV3J 5HLFA 2QYCA 4QIWD 1BQMB 5KFCA 3KJFB 3K7RA 4JV5F 3EVMA 4RUAA 4A8XA 2G13A 3C6TA 4OYIA 3TJAA 4UY8T 2JC1A 1RCOB 1N4LA 2NYHA 3TZWA 3CPWR 2DR5A 3MM6B 4FXVA 5T41A 1DTQB 2XLJA 5K8NA 2X51A 4HH0A 3T5JA 4C9DA 1K0TA 4PXDA 1EARA 2YX7A 1FDAA 6FDRA 3IAM9 3MECA 2V8VA 2D3ZA 1OYDA 2CQCA 2KM8C 1S9GB 1U1NA 4ZDNA 2M88A 2F8EX 2DNNA 1V3SA 2LXFA 1FI4A 5C24A 5T7LB 4JI8F 4URGA 5LMUJ 2NXJA 4Y0FA 5M2UA 4KHPF 4DV1J 2G1HA 2XNQA 3CB4A 3TARA 4IDKB 2QC3A 2XSJA 4LBPA 5KT4A 3F73A 4KHPJ 2L08A 1IKWB 2AD9A 2BXJA 2KL8A 4C98A 2XZTB 3HLUA 1NJXA 1U2CA 2A0FB 4LF5J 4DSJA 1F5AA 3VQTA 5BXIA 1ITPA 2KFYA 3ZZUA 4F4KA 2VF3A 2CXEA 3D0HE 2QRRA 2HVIA 2AW0A 2QT7A 2OPRB 1S77D 2VKZG 1RBOB 2V4RA 2DEJA 1RT4A 2HQCA 1XMQJ 4LSNA 1MG7A 4UYKA 1S6OA 4UF4A 4ZPTR 5E5NA 5IFMA 1CULA 1MROB 1WELA 4NXNJ 4XAKA 2R7UA 3P8BB 3PHTA 2VV5A 1SJ1A 4RUCA 3MFHA 1NDPA 4PABA 5KFJA 4ECVA 1G1XA 2DHSA 1WHVA 3BB5A 1OYEA 5A6PA 1XK8A 1C4AA 2HFVA 2V68A 1RI7A 4USUA 3PV8A 3FRZA 3R2CJ 4YQWA 2GIFA 3HHLB 4DL5A 2OJ3A 5GAEI 1NUEA 5ETLA 3QO9A 3T5LA 1RHJB 2AZ3A 1FRKA 2XTJP 3GLJA 4AQYF 4QCLA 2XWYA 3FSIA 2V9WA 1NH7A 1UEVA 2V8GA 2YQ0A 2G2ZA 1FJ7A 2B8PA 3M2RA 1LWCA 5L39A 1S10A 2R8KA 2VUGA 4QYZJ 2BOPA 3K5LA 2YNIB 3QBCA 5J2NB 3M8RA 2BV3A 2C2MB 3GWCA 2Y1LB 2LFVA 4DUZF 4K5RA 1S7IA 3TX0A 2FHJD 4ELVA 3GJRB 3RW6A 1GH8A 2XEXA 3DRRB 4BS2A 3EPGA 1OQ3A 3KK2B 3QGGA 3ENQA 3TUZC 2RRNA 4WFAQ 4DQQA 2ZE2B 4U7UD 1FXRA 5KG2A 3PKMA 3C66A 1R7IA 4NEYA 3RBZA 1RBLA 4KTQA 1TKTB 4CWBA 4DR6J 2J9EA 1N32J 4TYAA 1FEHA 2OELA 5IT4A 2JDJA 1JXLA 1NM2A 3I0RB 4Y2KA 3JSMA 3ZNUA 1NSAA 1RTIB 4FKYA 3TP2A 4G3IA 3UNYA 2QX0A 4LFCJ 1G2EA 4CNZA 1RDRA 5F0WA 2G0CA 3PXGa 1TUGB 1RWOB 5HROA 1N33J 4RPFA 2DGVA 1TVRA 2X7IA 1OPZA 3D6TB 3DLGA 4ZVUB 3RJMB 3MD1A 2VODA 2G2YA 3TA2A 1FRMA 3HP6A 1R8HA 4AL6A 1RP5A 2MZQA 3R5DA 4NLVA 3GJTB 4ECQA 1RT7A 2QSWA 4XDDA 1T0TV 2JLEA 4ECYA 1UFKA 4KRWA 1D09B 3OXGA 4CYUA 4JV0A 1LWEA 2I5JB 3SEOA 1KC8T 4DQSA 1P27B 4RU2A 2R7QA 2E5LJ 2Z2LA 1RT3B 2HYIB 3HVWA 2NZ4A 3JTPA 3W65A 1HYSA 3SCJE 4JI3J 1WHXA 3QO9B 2J7UA 3KK2A 2HW3A 3DLBA 1XTZA 4M5HA 4FNHA 3A1YG 3RBXA 2GQQA 5DQGA 4KKOA 3JXOA 5ETSA 3FMWA 2ZH6A 1J5OB 1RTJB 3MAAB 2RJZA 1ZTWA 1EAYC 2YH0A 4WFYA 1T3OA 2UU9F 2LA6A 3MWBA 2HFSA 4OI4A 2YNIA 1CJKA 2NSCA 2UU9J 1R8AA 1O6XA 5F8JA 1N8RT 4YHHJ 6AT1B 1U0HB 3FZBA 2CVIA 1TMJA 5HN0A 2R8IA 3HSDA 1XR6A 4CH0S 4WXWA 4XPCA 2AGQA 2RUGA 4LR9A 3PFEA 3GYXB 3KLGB 1VQLS 1GTEA 4RX6A 2B51A 5KG5A 4CLFA 1LK7A 1RQ0A 3U1LA 4C3MA 2DXEA 4ZJQA 4UW2A 5E3RA 2DNGA 4F0KA 4K4TA 5IV3A 4MKAA 3NGKA 2ROGA 2YWGA 2MB0B 4F3QA 3CC7S 1QLNA 2JFDA 1VQSA 4EZ9A 2C3YA 2HQDA 2JSXA 2MJNA 2ZH2A 2HURA 3AOAA 2CDQA 4OX9J 4BLGA 2DXDA 4NWBA 3NL0A 2XSJB 5DS7A 3TQEA 3BT3A 3BYPA 2YPYA 1IVZA 3I0SA 3QRRA 2GGPB 1F3VA 3G8QA 2ZD1B 2XI2A 4JB8B 1AT1B 4OJ3A 1RT3A 1NK8A 2GIRA 4KGZB 4WU2A 3AH6A 2QLJB 2LXIA 1U0HA 3BSCA 1FO1A 2CJ9A 1P9YA 5HATA 5LSRA 3BSAA 2JX2A 3LGHA 5E7OB 4CT8A 1FD8A 4DPTA 2Y1IA 1IR0A 1H2TZ 2RQCA 3GG0A 2ATCB 3IBCB 4PPZA 2GQ2A 2WOMB 3OT9A 1HMVA 2EFNA 1RTJA 3MEGA 4IG3A 4CTAB 4DPWA 2LVWA 1W25A 2YNHA 1VQMS 2WHOA 4FYDA 3QQCD 4C0BA 1HFEL 2W01A 3R5CA 3EZUA 4LF4F 3KHHA 4RL1A 5HL7Q 2FZCB 4PCQA 3CIZA 3M8ZA 5H1SV 3VAIA 2MQNA 1YITS 1IM6A 1MN9A 3AB4B 2KH9A 2QYGA 2QTWA 4QOTA 5L9XA 2L3MA 1SJ3P 4DPOA 5IQQA 3PIOQ 2K7KA 3JTOA 4PQUA 5I42B 1XR7A 2IAJA 3A8KA 2XMAA 4IFVA 3S7RA 1HA1A 2PGCA 3HX9A 4BDPA 3V81B 4JYAJ 2X3DA 5ETPA 4HH1A 4K2XA 2DJWA 2H51B 5AJ3F 3PY8A 3AJ1A 2RMLA 1DFDA 3CUNA 3VAKA 3EICA 2A6OA 5G0RB 1LNQA 2MZRA 4TXSA 2HS0A 1U8WA 1VRUA 2CQDA 3HHEA 2LECA 2GAHC 4I64A 4TVAB 3W5YA 2YXLA 5A8WB 1FKAF 2IM1A 3BR9A 3VZHA 4F02A 3UNGC 1IKVB 2ZKTA 4N8NA 4OV6A 4KO0B 2XS5A 5H9FK 2HQGA 2V9KA 3W5ZA 2NLWA 5K5MA 5DG9A 5K20B 1CLFA 5HSPA 3P5BP 4KAIA 4OLOA 2R7WA 1S48A 1F9HA 1RZMA 3EE3A 3OR2B 1FKOA 3UVJB 1RWNB 4PWWA 1SKSA 2FLNA 4UYJB 4IOBA 2W9BB 2J5AA 2ZH4A 2IAJB 1GTHA 2Z56B 4H4OA 2CPJA 1UA1A 2BZ2A 1PC5A 5KFQA 2XCAA 4DQRA 2A3JA 2ADCA 4TN2A 3SFGA 4EU0A 4K4ZA 2EG2A 5LXYA 1V5VA 1RWKB 4OX7A 3GU0A 4E0DA 3OVBA 4W90B 3A3NB 2POKA 2B7BB 2JC0A 3OTEA 4NLWA 4DV0F 1WSRA 1WDDA 2WSFC 3I56S 2J8AA 4OZ3A 1MLAA 4KHMA 2WVDA 2ZDOA 1S4FA 2KI2A 2M70A 4KQZA 4CI0B 4P2FA 3H25A 2KG0A 4TQSA 3V2UC 3RAMA 4K4WA 1FWPA 3EWGA 2H5EA 1EQ0A 1O8BA 1UWBA 2LMIA 3AD8C 1ZS6A 4J5OA 4KY3A 1MMNA 4PYAA 1HD0A 1HNZF 3S01A 3PACA 2G0IA 3AXKA 3QPIA 4KH1B 2Z2MA 5D15A 4C11A 2DRBA 1R8BA 3R5GA 4Q2LA 2MXYA 4DUTA 1F0XA 2Y8YA 1SUQB 1MWQA 3HSZA 1I3OB 2BE2A 4DMZA 1FWKA 3EZ5A 2OPPA 3D1HA 2HEKA 3J7YU 3NKYA 2AGOA 4ILLA 1X9WA 1S1XA 1HBMA 1T95A 1NDCA 3ONQA 4M5MA 1FJGJ 1Q82T 3WX8A 4R0EA 2E44A 4QR2A 4DFKA 2ZD1A 3ETOA 1WOPA 3J7AN 2ZH9A 2R7RA 4C2MA 3CO9A 1TFYA 3S8SA 1F1BB 1WKJA 2IVFB 1S0VA 2XYPB 4NCGA 2RDIA 1HWJA 3CNQP 5L38A 3LP1A 3QZ8A 5JVGQ 2B5JA 3TUJC 2UXDJ 3CJ8A 1JXVA 2HVDA 3F44A 4LBIA 4NA1A 4MIWA 1N5YB 4DUYJ 1SUQA 3C6TB 2Y3YA 5AE3A 1K9MT 3A3PB 4PR6A 1VI7A 2MLXA 3RTVA 4M8LA 2HVZA 1YZ6A 2DO0A 2PN6A 4IKAA 3VTIA 1X9MA 1IBLF 3Q8UA 2JEJA 2UUBF 2EFVA 2A2CA 3BQ1A 1VLOA 2WBRA 2CUYA 3PO4A 5F8IA 4X64F 5KG4A 2D9PA 3AT1B 3MUVP 2DIUA 4RR5A 5EX0A 3B78A 2WB1D 3HHLC 3NS5A 5K14B 2CZ4A 2LXUA 2IRUA 4MTPA 3VAJA 1BMQB 2HAFA 3W7BA 3DRSA 2DO4A 2HRUA 1C1BB 1FKOB 4ED1A 2M3DA 2DXFA 2AQ4A 3ADAC 4L73A 1KQFB 1RTDA 1B70B 4HEA9 1QAXA 4HI1A 2QA1A 1IUJA 1NJYA 3MPWA 4CH7A 4DV2F 2N4CA 1D0EA 4EBEA 2BJ7A 3SMZA 4DG1B 2RDJA 4X4UA 3C46A 3C16A 1ZZFA 1RWPB 4NZ0A 4DV4F 2FJBB 2EFGA 2U1AA 2VFRA 4Q2MA 1KOOA 2FVCA 2IA6A 2FTRA 2IHR1 4Q43A 3OTOJ 1YQHA 3IGVA 1RB0A 1H98A 1S6QB 4OZJA 1X31C 2MKSA 3AOBA 4S0MA 1E8OB 3SQGA 2DCLA 1IXKA 2DH9A 3HHKA 5HJXA 2OD4A 4QWAA 4ED7A 4GMKA 3GV8B 4WFZA 3V6DB 1YJNS 3D28A 1M5PC 1YJ7A 1A7GE 1JJ2R 4JI1J 3FEZA 1JLAB 2BVZA 3I9ZA 3ISND 2XY6A 2BW7A 3RAXA 3WC2A 2AEJA 4JI7F 2R7SA 2L9WA 5MAOA 2Z8QA 2IMWP 2Y9HA 2ZVSA 4RW6B 2FD2A 1FNOA 3VZIA 5GAGU 4RW4B 3KLFB 1CJUB 2GJFA 1NSKL 2IJFA 4I6WA 1JNZB 5G0RA 3MR5A 3T19A 3KXDA 1RTDB 2KM8B 3UW1A 3RBDA 4EEYA 3WHIA 4WFNQ 1UEUA 4C8KA 5KFYA 4Z2XA 3SI8A 4DR3F 4KPYA 2QLXA 4H4MA 3D0GE 4DR3J 1N0UA 2MHEA 2VD3A 3PYGA 2OHDA 3MZIA 1X5PA 2H5IB 2HWIA 2VFVA 2W25A 4J9SA 5HMWA 3KUHA 1KLNA 4FBUA 5ADZA 5CA5A 1NSQA 2HHSA 4KGVB 1Q8KA 2GVZA 4U8VA 2AMCB 1UMJA 5FIIA 4QPXA 3BN7A 5KFNA 1DQ8A 1NZAA 3E8OA 4OMFG 1NRKA 5DZ7A 4OJGA 4TKTA 3PW5A 1T8EA 4USIA 3VR1A 3CD0A 3I4PA 3LAMA 4QR0A 2I38A 2IPOB 1L3KA 2DGOA 1YDLA 2IRYA 2VU5A 3AOCA 1SJ4P 1CULB 2VQFF 1DURA 3R5BA 4HTJA 5EWEA 2LDYA 3N6NA 3ET6A 1OJ4A 4NLYA 4DCPB 2XMUA 3DKDA 3D66A 3KLEB 2BUNA 2GC8A 1Q4RA 1Z2LA 3G86A 3T1YF 1V9OA 3EJMA 1M5OC 1RTHA 4F4ZA 3CJ2A 4MYTA 2W2PP 4PXCA 1U1OA 4C8OA 1FD2A 1FE4A 1ZM3A 2Z2YB 1U48A 1N6QB 2X5HA 3SSQA 4LSZB 3H90A 1S0MA 3O3LA 2UP1A 4B9MA 2FZKB 4NPOA 4LQ3A 2HK2A 1DTTB 1HPZA 1UTAA 2OPSA 3G6ES 4DF8A 2FVSA 5KFIA 2MKIA 1NCLA 3GIRA 2MTLA 3Q2SC 4X4PA 1RAOA 2OTLS 8ATCB 3H98A 4P10A 4Y00A 4LFBJ 2N3OA 1RE1B 2OSQA 1I51B 4ES1A 4CDRA 4RKUC 3KG4A 3MECB 3KDNA 1T03B 1CJTA 2C2ZB 2D9OA 1FX2A 1HBMB 1HLWA 2XLIA 1ULRA 1K47A 1X4DA 3M05A 2FC8A 1AYEA 2HPUA 4CO1A 5J1EA 4EK2A 4DWIA 2OPPB 2P6SA 2UUBJ 2ZZNA 4GKJF 1H73A 1PJ5A 3D6FB 3PZPA 2ZH8A 2VPZB 2DHGA 3ILLA 4CP5A 4N41A 3VCXA 1OPIA 2CRLA 2F65A 3MEEA 3M9NB 3G8TA 4DL0C 2LLZA 1CJVB 2GAGC 3ZZYA 1VS3A 1ZOTA 4DSFA 3ULHA 1HNVB 4DL3A 1Q5YA 4KHRA 3MCSA 4V19X 1T7PA 4DI6A 5CAAA 2RIJA 4H4OB 2B9WA 4QR1A 1C0TA 2YY3A 3SIPB 4C8ZA 3K5PA 3T9NA 5DG8A 3KG0A 3HO1A 2HZAA 2E5GA 3CD7A 1E8OA 2KO1A 3ZFVA 3PX0A 1S4EA 2GHWA 2W24A 3I96A 3UCUP 1TL7B 5KTQA 2Q1LA 2ROEA 3IC1A 2ZBIA 4HHHA 4J9UE 2MZ1A 3OW2R 1XNRF 4GZ3A 3OJSA 2BKNA 3RB3A 2ROPA 4QBUA 2GV1A 1DBDA 1SB6A 2DVIA 2NXEA 2ABYA 1JIHA 3Q8VA 3Q86A 2H4YB 4JI4F 2HWTA 5LJ3Y 3E01A 1U26A 4AE5A 2ILYA 2YKAA 1RU1A 1SIWB 4K4UA 2EVZA 1DLOA 4ECZA 2H9ZA 3LO3A 3QGPA 2R2UA 3G82B 4ZVFA 1CPZA 1I94J 4DPXA 1JLGB 2HFNA 4WP9A 4RNOA 1YJ9S 3VALA 1RXOB 4LBHA 2F3JA 4OHWA 3EXCX 4ZPWR 1O51A 4LVNP 2FB0A 1FJGF 1RKJA 2GX8A 4I68A 2X3GA 4R8UA 1Q8LA 4IG0B 1FE0A 3OFFA 1CJVA 1GT8A 1WI8A 2H54B 2YWWA 3J7YI 4LF8J 3E51A 3OLBA 5DDRC 1KLMA 2EXUA 3CIMA 1AFIA 3W2WA 4YDXA 2DNKA 3CJKB 4N3BA 4OI6A 3NNAA 3I5CA 1AXQA 3SFUA 1MWYA 5F3ZA 3C19A 1M1GA 5IT9Y 4U96A 5KFTA 1WG5A 1TV6B 1X4BA 4ZVEA 3NS6A 4WXOA 2YKNA 4DR2F 3HCXA 1FK9B 4A8YA 3OVAA 2B4PA 2C1EB 4MAKA 1VDHA 3G9CA 4ZVSB 3TZXA 1SH0A 3HI9A 4U7UK 2ZJRQ 4FF1A 4B9VA 3RB0A 3K5MA 4HR2A 1KSPA 3M8WA 4G65A 7AT1B 1F2HA 1HBNB 2DNQA 3BBFA 4OV1A 4JI2J 5JJBA 5LOQA 4ZHRA 2GMJA 3HZEA 2QJ3A 1KFSA 2V67A 1LOUA 2ACYA 2FPHX 2WOMA 3O5TB 1RCXB 4YEAA 3UDVA 1FFWB 1RBAA 2NUHA 4EUVA 5KT2A 1LKZA 1ZPWX 2DH8A 4QJVA 2B5JB 1T9TA 2HSEB 4NL5A 5EGYA 4DR7F 1Q7LB 4JI4J 3M2VA 2V94A 3ZC4A 1JLBB 3FVYA 3MEDA 2QE5A 2HHVA 2SXLA 3H20A 4ZMMA 2W8KA 2W9CA 1QSLA 4IH5A 1WF2A 3OSPA 2AGPA 2XM3A 3JSRA 1S97A 1ZETA 1KQGB 2HLUA 1KVKA 1VRQC 1RJJA 2JJ4D 2YKNB 3O6QA 4KC5A 2YKPA 5KFMA 1RAHB 1TV6A 1NPPA 1BC6A 3ZZ0A 4GZ5A 5C7PA 1T94A 2ZBQA 2BEFA 2ZVIA 2HRTA 2WCXA 4EI2A 2W2NP 3CJKA 3MAHA 2LU1A 1J5OA 2EFQA 1CG2A 2PSZA 3MCNA 3A8JA 3WIUA 3JQJA 1NXIA 3GIKA 5CCLA 3UPFA 2FHOB 2JEGA 2HS3A 4MJKA 1S12A 2JFKA 4UOCA 2DRDA 2ASYA 1PJ7A 1IBCB 1CS4B 3HVAA 3JB9k 1UJ4A 3I82A 4XPEA 1WWHA 4DJBA 1CJKB 2BJDA 2EWHA 3OUYB 1KRPA 1NEEA 3QT8A 3TRGA 1F3FA 4P75A 1H6KX 2FY1A 1SBRA 1DLOB 2M5YA 1FCAA 4L75A 5J2MA 3AAWB 2B43A 1P6TA 2GMHA 5MLCV 4HHJA 2BQ3A 2RT3A 4KSEB 2P9GA 4ZLNA 5GAGI 4JI3F 2GVDB 2PFFB 3Q8PB 2G0JA 1VJWA 1VRTB 1N52B 1IKVA 3UN3A 4MKVA 2PD1A 2XZDB 4L74A 3OL8A 1OQ6A 3M32B 2P9CA 1UJ5A 4J9RA 4LJMA 3T5HA 1HNZJ 4LF6J 3EGVA 3KUGA 1PG5B 4FVCA 4P2SA 4I7FB 2NSBA 2OIHA 3CC4S 4IO9Q 2EC0A 2RSFA 1RT7B 3WQPA 4PWDA 3Q83A 4ZPAA 3P49B 1MWZA 1Y3JA 1ZAWA 1CJUA 2XYGB 3RG6A 4Y6IA 2CJAA 3ZTOA 2R7VA 5J2PB 2AEFA 4YS2A 4AL5A 2L9DA 1JJCB 4ECXA 1D3WA 3QWPA 3V4IB 1VHFA 4ZPCA 1FKPA 1GNKA 4DFJA 2BJ1A 1M1KT 5C1DA 4GVBA 1DZ5A 1NK0A 4ICLB 2YNHB 2RU9A 3BYRA 3HKWA 2PEBA 3LANA 3NCQA 1HW9A 2AJ1A 3MEGB 4IG3B 4WK3A 2B4UA 3JQMA 1AA1B 3K17A 4RW7A 4CTAA 4Q44A 2ZM6F 2YH1A 1TK5A 2UVRA 1KNZA 4R5PB 1FFSB 1WC0A 1SKUB 5AXKA 3KKFA 2M8DB 4Z37A 5K14A 3AD7C 2MKKA 4IFVB 4AXJA 2E1RA 3MMAA 2LCWA 4QYZK 1EIYB 1JB0C 2VA3A 2UXCF 1J2VA 4OZ5A 1M5HA 3HFZB 4GYWA 4Q0BA 3RZAA 1YBAA 2AIRB 2KJWA 5DZ6A 2D3O1 3QLHB 5GMKa 2WW8A 1VRTA 1LQ9A 1YWXA 2AEMA 2YWFA 2H65B 2RKIB 3AB2B 2OFHX 3I87A 5BYQA 5HP1B 2CPIA 2OPSB 1FNMA 1U7IA 4JI5J 5F9LA 1OSDA 4NYPA 3M2UA 5EN1A 3CJRA 2VFSA 4KB7A 4B02A 4MMOA 4C8LA 3DXBA 1RTHB 3P3DA 1N5QA 3W2VB 1EQMA 2ASLA 4Y3CA 1LWFA 1URRA 4NLUA 1DJ0A 3D68A 3MMJA 4BCAA 4J91A 3L7UA 5KT5A 5LMNF 1EKRA 3IR6B 3E2EA 3R5AA 2MSTA 3FGVA 1HI0P 5B0CA 2MYFA 3M6VA 4ZPVR 2JVRA 3ZZOA 2EK6A 1NSPA 1KS2A 4CDIA 2CPDA 2RQMA 5HAOA 4CNYA 1V6HA 1X4EA 2OPRA 2F8MA 3LTOA 1S49A 2L9NA 3ILIA 5KT3A 1RTZA 2O3DA 1U7LA 3NXZA 1MSWD 1PO6A 2A2DA 2D1CA 3DNCA 3FFIB 5KFFA 4K4XA 2HVHA 3H5SA 2GVZB 3OL6A 4UQTA 1RT1A 3C15B 1BD6A 1GMWA 1CSJA 4JV2A 3GR1A 2VQFJ 3TJ8A 3MFIA 2LQ8A 2ZFHA 4DR4J 3R6LB 2XS2A 3G2XA 2F9JA 2HS4A 2KB2A 3F41A 2R2SA 4HT7A 2GIQA 3I32A 4ZN3A 2MZSA 2AJ0A 5FDLB 1X4CA 2BE9B 3GILA 2QLFB 3FRYA 2XNRA 3CDBA 2JZ5A 2UXBF 1SI9A 2BACA 2V8HA 2ACMA 3EMTA 1Q8IA 3NAHA 4DR1F 1S9FA 1LK5A 1S1XB 2K3IA 2W2MP 1GXLA 3C8YA 3KFWX 2LQBA 5H9EK 3IWXA 4N3CA 2OEJA 1IR1A 1XIQA 1YJVA 2BYCA 2MPUA 1KHWA 2CWKA 2X5GA 4C11B 5KOXA 4AXIA 4LR8A 1R0AB 1KR4A 2BBEA 3H0PA 2WVBA 4TQRA 1FT8A 2QL7B 1NKEA 1Y7PA 1N34J 2ZITA 5I4MA 4F7VA 1S1UA 4EBDA 5A8KB 4LT6A 1S9GA 1ZM4A 2HFUA 3GJSB 4NA2A 2AYEA 4AT1B 1N34F 3H5XA 3PW2A 3N0VA 1MU2B 1HHSA 4ZLPA 2FHJA 2BW2A 3S6EA 2PFDA 5K8MA 3MCOA 4M5NA 4KFBA 4ELTA 4J9NA 1FJCA 2WVFA 3KK3B 1HNWF 2VG7B 1J5EJ 2LQJA 1X4AA 2MKJA 1UJRA 3R2DJ 3U1NA 3L7OA 3DGVA 4OYXA 2RNEA 2ZC3A 2UXBJ 1Q5VA 2CQ4A 1WDTA 2QMXA 4ETZA 3V4IA 1ZA1B 5KFOA 3TWZA 4CLZA 1P8GA 3TQ1A 1S6PB 2DR6A 4OI2A 3I9V9 4IRKA 1S76D 2KT2A 3G4SS 1BLUA 3PW4A 4P6QA 3R1LA 2C3MA 1T9YA 2KJVA 2U2FA 2WK4A 5LJ5Y 3PJWA 4C0HA 5J2QA 1Y4ZB 4WK1A 3SSSA 3T1AA 3WX4A 4D3HA 4DV7J 3CJ0A 1SVDA 2WONA 4CO5A 1M90T 1TP7A 1KFDA 2XMKA 4CO2A 1L3VA 2XB2D 3T6BA 1AUDA 2P6TA 4B9LA 5J1PA 3KMQA 4OI0A 2VC0A 3C16B 3MDFA 3CJSA 1VK3A 1IWAA 4O44A 4G1QB 2Z2ZA 4TY8B 3HMJG 2R7OA 2ZHAA 2DGWA 4UY85 2KZZA 3TA0A 1EHWA 2IM2A 2V2QA 5D0EA 1YRUA 5HK4A 1KVIA 3OFHA 4KT0C 5FJ4A 4B3RF 4KV8A 2LQ9A 3QT5A 3NNCA 4I6YA 1YIJS 4OL8A 1D9AA 2XO6A 5GVQA 4N5SA 1EX8A 4IR9A 1S9EB 3BM7A 2DT9A 4URSA 4WJBA 3IP0A 4O3QA 4RNHA 1BY9A 3DU5A 4YY3J 2KFNA 2ZC4A 2YQ3A 1R27B 4M94A 3O44A 1BGXT 1BQNA 1P1TA 2PMZD 2XY5A 3TVZA 3CMAS 3MEDB 4OI3A 3H7HB 2J0QD 1RKIA 2ZBPA 5HVGA 1UP1A 2Q66A 5B0GA 1OIAA 4I56A 3WBZA 1K0VA 4ZP8A 4U67Q 3DLLQ 4H54A 3FFIA 2BJ9A 4ILRA 4YB5A 5CCMA 1VCTA 1T9XA 1E6YB 1UCNA 4P7TA 4H4KC 4DL7A 2UUTA 1QMOE 3MPVA 1UETA 3ET6B 1F5CA 2DGSA 4EFAC 4HACA 3CDWA 5FDLA 4AY5A 5D78A 1L3TA 3UWTA 1KD1T 2M4MA 1B99A 1PYOB 1NMEB 4K59A 4LSNB 4MIAA 2FUG9 4NI2A 4NOHA 2WZ1A 3HD2A 4YDDB 2G9OA 3GV5B 3GE9A 1Q79A 3MR2A 2XSFA 1PBUA 1VGYA 1M0SA 3BS9A 1U45A 3DI6A 3PM9A 3QIPA 2V34A 3M2UB 4L76A 3DOLA 3P5TL 3PJXA 3TOQA 3N5FA 4KV8B 2AX0A 4KPCA 2DY9A 4ZHRB 1QE1A 4P9SA 3GCXP 3K8VA 2MQMA 5D4LA 2JWNA 1JLCA 3DCAA 3ELHA 1S1WA 2HHHJ 2KVIA 2PO4A 2EFPA 5IT9U 2LQ5A 3GFXA 1FRIA 3OTDA 2DEIA 2QZ8A 2VG6A 3DOKB 1LW2B 4URQU 5DDPC 3TAPA 2V2VA 1JLFB 4EO8A 4WIIA 4F3MA 1XNQF 3D0IE 4M1KA 4TLQA 4WKYA 2VIHA 4B3RJ 2HNZA 1Q86T 2AJFE 2COLA 2E5JA 4BHQA 2PE8A 4F0HA 4CLSA 5A76A 1IJFB 3MAAA 1RWUA 2MY7A 3IN5A 5DLFA 2KDOA 2LYVA 3BDPA 4ZP6A 3QZ7A 2FHMA 4O0IA 4ZVRB 3CWJA 1IJEB 2Y1RI 3D54A 1IBMF 3H2LA 2MKHA 3BH6B 3UDCA 5AOXA 2O01C 4RUBA 4WFBQ 2LEPA 3Q8SB 1T05B 2NXNA 3LW5C 1T11A 3GCWP 5I3QA 2FJDB 3SDEB 3LGMA 3B54A 2CQ1A 1D8ZA 4OZLA 4DXLA 5DGBA 3GPAA 2IDEA 4BWJA 4ANCA 2DH7A 5A0YB 2W9BA 3TNVA 2YKMA 4OYZA 4DUZJ 1J5EF 2JEIA 2HNDA 2OPQB 1IQTA 4NE9C 3F56A 4USWA 4IH6A 4ZJLA 3CDUA 2VONA 4O4GA 2KJZA 4DN0A 3G6YA 3BREA 2CNLB 3FUYA 1YZ7A 4RW4A 1Y11A 1P1LA 1NKCA 1FHTA 2CPXA 2FVQA 1G7CB 2HLTA 2V69A 1X9SA 1KHVA 3C2PA 3HT3A 2W2QP 3NAIA 4FNIA 1RGVA 4BBYA 3R7SB 1H7XA 4Y34A 3MHYA 4YB7A 4F4AA 4DU7A 4YR2A 3OV7A 1VMBA 1U1KA 4B3MF 4Y28C 4KFBB 2Z0GA 5AE1A 1YTYA 1GMUA 2MZJA 4YHHF 5BNWA 2CNOB 2ZH3A 2V2ZA 5B7WA 1FVQA 3OR1B 1R6YA 1VJQA 4FF4A 1S99A 1CC8A 2EW9A 1RAJA 2QL9B 1R43A 2VICA 4LF2A 2CPHA 1RT6A 2WTFA 2AU0A 2DNZA 3EVWA 3MPDA 3HPOA 3QATA 1U1RA 1BHNA 2OO4A 5J1NA 3KLHB 2A90A 2MHNA 5F8MA 2B9EA 5JVHQ 2AP6A 2RUSA 5KFWA 1REGX 2XMVA 4UUXA 3IG1A 4OLPA 3T1HJ 2FJWA 5D8HB 4P52A 3K0JA 5DETA 4FVMA 4DL4A 5KFSA 1XC9A 2Q6CA 4M5DA 1RAFB 2AYBA 3PE4A 3DI6B 3DHXA 1M1HA 1AFJA 1WTBA 2UUWA 2HBQB 3RU0A 2IVMA 3FZ2A 4L3KA 1ZYQA 1C1CB 5L1KA 1N0VC 2UXCJ 4M5LA 2CQ3A 2B7CB 5M2PA 4ZJOA 3MD3A 1HNXF 1Q53A 2PMHA 1OS5A 3O1LA 4ZPBA 2J0WA 3TW0A 2CQHA 1JXEA 2OD6A 1NPRA 2VOPA 2VFUA 2RVJA 4A8WA 2Y8WA 2Z30B 2OTJS 1D9DA 2QLWA 1PCAA 4ECWA 2BE7D 1TAQA 4G1PA 3UI3A 1PGZA 5L46A 2R3VA 1GMVA 2R4FA 2M8HA 4DR2J 3QIPB 3LQVA 3NEKA 1TZ0A 5LM7E 3R1HA 4KR0B 4LF7J 1RISA 4UUWA 2DYAA 3AHPA 1YRXA 4USTA 2DR8A 1V5IB 2H1YA 3IG1B 5ETTA 4U95A 1SKWA 1EKSA 2I9SA 3LH2S 3RUBL 3IS9A 4X62F 1U6FA 2B8QA 4OYWA 4X4OA 2QA4G 1BQNB 1W2IA 3JYTB 2DCUB 1FK9A 2KTQA 3MM7B 4RNMA 1M5KC 2XWXA 4NZ6A 2BOAA 2MLYA 4TNOA 4ZP9A 5C2CA 5C2GA 5KFEA 2I5JA 3G87A 4M5JA 3PR5B 3QIDA 3BGRB 3CW2C 2M9KA 3PCOB 3QNWB 4OZ0A 1SCJB 3UCZP 2Y1JA 4IR1A 5E3PA 2D3OR 1N36F 1QY7A 4UZCA 3W8GA 4FZVA 3PX6A 1QAIA 4PRFA 3KJNB 1B0TA 1WUUA 3NGDA 1RAEB 2YNGA 2RU3A 4USKA 4CCHA 4X4VA 2FYXA 5CYMB 2H3EB 1U0SA 1U02A 4GO5X 5T7LA 3UN2A 5C24B 4RU9A 2K2PA 1UWBB 1GX6A 3OBIA 3HSJA 3A13A 3PFOA 1FDBA 5KAKA 7FD1A 2VJUA 2NQPA 5BYRA 5BYSA 5HQLA 1U4BA 1QM9A 5B0FA 4HDGA 3AQOA 3CSKA 3SQGB 3W60A 5DLGA 4LF9F 1S6QA 2VPWB 4M5KA 5HI7A 3THPA 2FLPA 4NYZA 2E1AA 2ZNYA 5F3TA 2J76E 3CJTA 1FF2A 3D6MB 1XNRJ 1N54B 4CLPA 3CJ3A 3DHWC 5HANA 4DR5F 3CDEA 1X4RA 5CYJA 4LF7F 3LP0A 2R2TA 1DQAA 1KVJA 1U47A 3PKYA 1H74A 4GZ6A 3QGHA 1H3DA 2AT1B 3TAXA 2ADBA 3Q8YA 5F8LA 3TU3B 3VAHA 5FD1A 4LVOP 1VOMA 3LF0A 4C4WA 5B09A 3IRWP 1BQXA 3EVOA 1H72C 5L8RC 1VC0A 5F0UA 3UVJA 1HNWJ 1TKXB 4DZ6A 1H38A 4JYAF 1NO8A 4J9VA 1RHKB 4CLTA 5DQHA 4PPDA 2R8HA 3MMBA 5CYQB 3M2RB 2ZKUA 4J9PA 3N5BA 3BGOP 2HBYB 1SC4B 2JRSA 1LW2A 2AYMA 5DJBA 4TU7A 1VQ5S 3PEHA 2F4FA 1NDLA 4U8YA 3V5RA 4ECTA 1FX4A 4KGMA 1VQ6S 5ETOA 4QWCA 4A8OA 2E7WA 4B9SA 3KLVA 4GC7A 2FVPA 2YNGB 3LP0B 2ZZMA 3CT9A 1N56A 2GVDA 3CCMS 3TUPA 1R3NA 1U1LA 3I6PA 3OFGA 4I67A 3L7PA 2EPIA 1UJ6A 4LF8F 2RQKA 2HBRB 1CVJA 9ATCB 2DY1A 3O2IA 4P74A 3LPEA 1TL7A 2W9JA 1HWKA 4HL9A 1XMBA 2BX6A 1MU2A 4NZ7A 5J2NA 1Q8BA 5HMYA 4L6V3 3B4DA 2AJ2A 2ZH5A 4B3SJ 4UOHA 1B7YB 3CMQA 1LWCB 5JUMA 5EDWA 5CH7B 2WSEC 3FEXB 2CAJA 4NI2B 4C8NA 4CLYA 1SC1B 2VDHA 1TKZB 4CO4A 7FDRA 3K59A 3ENVA 4MK9A 1I5OB 4JI6J 1W7WA 4OX6A 3TO8A 4RUHA 4FXDA 4DR5J 4UYKB 2X1AA 3WDOA 3H2VE 5CZVA 3UN5A 1JLBA 2WAQD 2DKOB 3HF5A 5KFDA 2HIQA 3BO2A 5KT7A 2CZ9A 2E5HA 2HQIA 4EWTA 3BJYA 2DHAA 2E5LF 3DRXA 3MUMP 1JK9B 1WKKA 2VDIA 3BGRA 3A8IA 3OSNA 2GJ2A 1VHIA 3BDEA 3NGUA 2APOA 4ECSA 3KNAA 5BJRA 4EBCA 3KLEA 4P7VA 5JMNA 2CVEA 2DK6A 2XMTA 3Q89A 3SCIE 3JYTA 4NMXA 3FQLA 4QIEA 5I3UA 1OO0B 4F04B 3PTWA 3R5JB 1TKZA 2YQ1A 3BPDA 5HQMA 4I2QA 5FLXY 1N6QA 3C3LA 3FDSA 1TMMA 2HQFA 3D3BJ 4ZIWA 1C1CA 3CCZA 4DEZA 4DSKA 1VIXA 2MLZA 4TY9A 2CPFA 4WU3A 3UDLA 4X66F 2BDPA 3BPSP 3V3LA 4X2BA 1WNEA 1WF1A 3LWMA 3B82A 1CBKA 1RACB 3KHLA 1QJHA 3BEGB 4OIXA 5E3CA 4OHVA 4B08A 1JLEB 2AYGA 3FBCA 3MF5A 3HVTB 4KKOB 5CXTA 3GIJA 2KXHA 1SC6A 4DV7F 1YVFA 1EZZB 1JMTA 1UA0A 3H59A 4B3OA 3K89A 5AXLA 5K9FA 1VBYA 2NS1B 3BGUA 3B4MA 5AJ3J 5F8HA 5DDQC 5IWAF 3R27A 2CJQA 1VC5A 4WCEQ 1LWFB 1EB0A 1VQNS 2V2KA 1D8YA 2OMOA 3JQKA 3W2VA 3EDRB 1KOHA 4K7QA 2BQUA 3F0NA 5GMEA 3GB0A 2OAUA 3OL9A 2F4VJ 2MY8A 3MTJA 3I31A 2M0GB 2Z4PA 5C42B 4ELUA 4EMDA 4WFXA 4CH1A 5D3GA 1BQMA 1CC7A 3FMBA 1LW0B 3UO0A 2JVOA 3CCJS 5DGAA 1VQ9S 2HFOA 2O67A 2WSCC 4NXMF 3FNNA 3BSNA 5KFVA 4TY8A 1T3NA 1FTRA 2GFFA 3K5OA 4ED6A 5AXMA 1HYSB 3FJ2A
chains in the Genus database with same CATH topology
4I2PA 5J2PA 4CT9A 3IWLA 1B0PA 1QSYA 4TU9A 2BRKA 3QJPA 4DSLA 1RA7A 1SH2A 3M8SA 5KFAA 2WONB 1SIZA 4YOEA 4B9UA 1GXUA 3N01A 2J9CA 3HZGA 3MM9A 2DRAA 1WD6A 1Q78A 4ICLA 1JKHB 2DHXA 3IA0A 2RS8A 1IKXB 3MUTP 4X4NA 4LFAF 3DM2A 3IXQA 2AJQA 2V5HG 2J9DA 2BR0A 5CYMA 5BR8F 3MURP 2BANB 3FEYB 1U6BA 1FESA 3LPYA 3MEEB 3DLEA 2OKQA 2QV6A 5IS2A 3KMSA 4N77A 1MMLA 1PILA 3BO3A 3V6KA 4AY6A 1OSCA 3DN9A 3N4WA 4IYQA 4K4YA 5A0YA 5AXNA 1T03A 1VC6A 4PQUB 2HNYB 1QAYA 4ZA1A 4EO6A 5EUHA 2ZE2A 4LSLB 3I0SB 4KGKA 1RT2B 2AJ4A 3PRBA 4OZ1A 2UVVA 1APSA 4AL7A 1HNIB 4DL2A 1KTVA 1RT1B 2LKZA 2UZAA 2QMWA 3AA9A 5C5JA 1AW0A 3LP2B 2FGOA 3DOLB 3O8WA 3RRKA 3ZZZA 1JJ4A 4DSIA 4JOUA 1X5SA 2YVSA 2JLGA 1HBOB 2KYZA 2VG5B 4C8MA 2XCPA 3KK1A 3DRYA 2BM0A 1UFWA 2HMIB 4NCAA 2DGQA 4NLOA 3GYNA 4RW8B 1R8CA 3CEDA 2VG6B 4F50A 2W9CB 3T3FA 5I3UB 1FA0A 1SL0A 2GGPA 4B3OB 3AJ2A 2ZBCA 2BJEA 3IRXA 5EWFA 3OJUA 1S1TB 1UAWA 1F9FA 2NUUG 1CQMA 1KQKA 1YGYA 1QE1B 2FIUA 2J6TA 4HYKA 4IQXA 5GADI 3NWGA 4I1TA 1WF0A 1SQEA 1F2GA 4DHVA 1H2VZ 2AWZA 3OXLA 2BM1A 4DSEA 3JSBA 2CPYA 3KLGA 2GW8A 1TQLA 3NBPA 1TL3B 3L09A 3UE2A 5U47A 1RT6B 1U6ZA 4A8SA 4PG8A 2HMIA 3DDNA 1DHMA 2CQGA 3QJJA 1Y5NB 5D4PA 1NJWA 5SZTA 2IBKA 1RYSA 2XHWA 5KT6A 5A8RA 3WZ0A 2MQQA 1U2FA 3LALA 4M5DB 3M9MB 1VBXA 4F4WA 2F9DA 3CXCR 1DQ9A 3C6UA 2UV8A 1XERA 3CCUS 4R0JA 3ENWA 3MAQA 2W4PA 1LFPA 5IT0A 2YWHA 1N33F 1O5JA 4X65F 1YRTA 4IQMA 4ZCLA 1U1QA 1HBUB 1SL1A 3HK2A 2FJVA 1DTQA 3OQ2A 3BGLA 3QJLA 3OR2A 2KFNA 4WF9Q 1K8AT 5E33A 4IFYA 1HQEA 5KFZA 1X4HA 2NXUA 4DLGA 3CD6S 3UFCX 2IVYA 4QIGA 2XI3A 4ZCMA 1CQNA 2K4NA 2BANA 2P9EA 2X1FA 3M6WA 4Q5VA 4ED2A 2UUAF 1LXNA 1LFWA 1U2RA 4QU6A 1SJQA 1S1VA 3BGFA 3PR4A 2PEHA 3OHAA 4J9OA 1K1SA 2XBPA 1S7HA 3RB6A 2RF2A 2K8GA 1SL2A 2IC3A 1HI8A 3CC2S 4QU7A 4YB6A 3TA1A 1M5VC 4DS5A 3K57A 3M6UA 4AKXB 3DOKA 2YTCA 2W9AA 3UCGA 3JAMY 1UVMA 5KG6A 1HNVA 3I5AA 3MM5A 1Y5IB 1V3ZA 4NCBA 5SUHA 3IGNA 4Q45A 4K5SA 1HQEB 5M2RA 4PKDB 1HWIA 4H4KA 3TVKA 4OFZA 5D4OA 2E5IA 2O5DA 4DQIA 1FHTA 3DRSB 1TAUA 3OVSA 4DL6A 5H9EJ 4IOAQ 3DRPB 4N76A 4Q7AA 3MGJA 4IH7A 4WE1A 1XMOF 5GAEU 1ZTTA 4ZVGA 1S72S 3NBPB 4ED0A 3TYTA 4C7QA 3IR5B 4O3RA 4FXWA 3M2VB 4NA3A 1QUPA 2VZ9A 2WRMA 1DTTA 1HPZB 4RW9B 4DN9A 4F4YA 2C3OA 2PIIA 4PG7A 5LXRA 3PY8A 2MMYA 2N82B 4GC6A 3U1MA 4Y2IA 5A8RB 4YB1P 1LV5A 4LIWA 5LSOA 5GAHI 3Q23A 1914A 2EFOA 3BZQA 1VQ4S 3T6JA 3DMJB 3IO1A 3EUNA 3SCLE 1MNEA 1UVIA 4LQ9A 1ZM2A 5EHHA 3FCHA 2YX1A 5EX3A 3DLKB 5C25B 2YX4A 1FRHA 2I2YA 1HBOA 1N88A 2VG5A 1YJTA 3FSYA 1WG1A 3H8YA 4E8UA 1RYRA 4DDFA 3LWLA 3GFYA 2ZHBA 4YFUA 4I0WA 3POTB 3WC0A 2RD5C 2DNLA 4F25A 1S1TA 1SJRA 2RRBA 4QWEA 3M1VB 4FBTA 1VK8A 4O44B 1EETB 4N56A 2CJBA 1I1GA 2PA3A 3BQ0A 1N32F 1HL6A 3EXYA 1FNXH 3KWMA 1C2PA 3EGWB 3MMCB 4JUZA 3KK1B 3BN4A 3QMQA 3M8QA 4MYUA 2CPEA 5L1LA 4J9KA 3PNIA 4G1IA 1VQPS 3LGNA 3I5BA 4ZPDA 3M4XA 3CF5Q 2DTJA 4XIFA 3DLJA 2R7TA 4RZRA 3I55S 2W4CA 2D41A 4NLSA 2EKYA 5I3PA 1U24A 1B64A 1NHUA 4RLEA 4O3OA 2IRXA 2W8LA 3RR7A 2QA2A 2EBGA 1E6VB 3CE8A 1FXDA 2L41A 3TAMA 5LT5A 3JSMB 4HDHA 4X4TA 1ZH5A 1NAQA 5B0AA 4ITSA 2V4QA 1NK5A 4F4XA 1QVGR 3KTQA 2MSSA 4A48A 1OWXA 3DLGB 1KEKA 3UQSA 2GHPA 2IFXA 1JLAA 3VAGA 5AOXB 3BO4A 3HVRA 1Q81T 4O3NA 4IRCA 2B4VA 1UKUA 5AE2A 4U7CA 3Q22A 4Y2AA 2BQRA 1HWLA 2VQEF 4OJHA 2IYGA 2ZNZA 2ERRA 1N5TA 3TANA 3H5UA 4F26A 4DR6F 1HD1A 1A6LA 3H2UB 2HNZB 3IAS9 3M8QB 2CYYA 3N6LA 1HARA 4ZKAA 2KZMA 1FTCA 2IYIA 5CHCB 2DD8S 4LFCF 2IJNA 3ZZPA 4DG1A 2XY7A 2DNHA 3THTA 4DLEA 4LF5F 4A8QA 1W2BR 4QZVB 2IBOA 2KU7A 3HHLA 1Z4UA 4A47A 2R8JA 1H7WA 1TUVA 2GNKA 2OFGX 1TL5A 3IFEA 1H2UX 4JI4F 2CKWA 5D4NA 2D3UA 3K8WA 3HDSA 5J2MB 1XMQF 2PT0A 1RA6A 1XR5A 3HM9A 1WEXA 1T02A 1R31A 1U8SA 1WG4A 3JTNA 4Y2MA 2VONA 5LSLA 3CDAA 2VKRA 3ITWA 4F67A 4V19J 4I2QB 2B9XA 1FERA 1GAOA 3PX4A 2AX1A 2XO7A 2LA4A 3OLAA 4ED8A 2JH3A 3M1VA 4AFFA 3FQKA 4LUBA 3P96A 2Q3PA 1N48A 1JLEA 5LL6d 3Q0AA 3CCLS 2D74B 2GO9A 3V81A 2YKQA 3X3UA 5IZHA 2QO3A 4XO0A 2PA8D 1C4CA 2AF6A 4RBVA 4NCGB 2WBMA 3MPYA 4DBQA 3NP5A 4ED3A 3QLHA 2MGZB 1U09A 4NLTA 2XGQA 2W7PA 3PVXA 2KG1A 4DV6F 4I69A 4NLDA 3MM8A 4ETXA 3CCSS 4A8MP 4RNNA 1RT4B 3KYLA 2CQBA 3EGNA 2KKHA 1ZAXA 1UL3A 4BC7A 2HFZA 1S6UA 1VIOA 2J6UA 4MKYA 2VBXA 2E1CA 5L9NA 3H4BA 4USHA 5L1IA 3W2WB 3V4MA 1SKRA 2HHTA 1KLMB 3PEJA 2HHQA 4NLRA 4ZP7A 4OX9F 4DUYF 2DPIA 1JJHA 3SSRA 4HLBA 1YI2S 4BC9A 3U02A 4ERDA 4WTYA 1R89A 1R8PA 3QWUA 1NK9A 1HR0F 4CO3A 4JV1A 3EGZA 4O23A 2M2BA 3IWNC 3MM9B 5DRKA 3ISNC 3BSOA 4A8FA 1X4GA 2ALZA 3W3SA 4XDCA 1FRLA 2HNDB 2OPQA 3TAMB 4OQJA 3MM6A 5B0BA 3M9OB 4QQBA 3VCDA 3BQ2A 4TLRA 2C2DA 4JI6F 2GA7A 1X5OA 3OPKA 3TUIC 3SDEA 4M63A 4FF2A 2BABA 1X7VA 3VF0B 4ZS6A 5DM6Q 4EZ6A 4NRUA 1Q7YT 2R9LA 4RBTA 3CCRS 3M6XA 2EBEA 1G3OA 3DRRA 2N7CA 3D2WA 3MR6A 2HHXA 5JXSA 2DNMA 2I0XA 1Y5LB 2V4JA 3T9ZA 2MQPA 3CCES 1VQYA 4C97A 3I0RA 5J2QB 4OI1A 4RWXA 2IMOA 2IA0A 2J6SA 4C3LA 4I2PB 2BRLA 2CQIA 4ID5B 5HBMA 4NLXA 1NB7A 4NRTA 5D6GA 4CO0A 2NREA 1VQKS 4JI5F 4DR4F 4WYWA 5GAHU 1JLCB 4TU8A 3CULA 1EP4A 2DK2A 2KN4A 2GO8A 1AROP 3DDKA 3HJFA 2GHVC 2HWHA 2F7VA 5E0OA 2WB4A 4FF3A 3P6YC 1TR0A 1HBUA 2DNPA 2ZOMA 4EGLA 5HMZA 5A8KA 2YWEA 1IKYB 4A4JA 1VQ8S 2RILA 3QGIA 4R25A 2YNFA 1URNA 1TL1A 1B7FA 1ZM9A 2EG1A 3D1QA 4AUKA 2Q6BA 3IR7B 4X4QA 5KFRA 4RWWA 3M30B 4MH8A 1C0UB 1NU4A 4C0OC 4JI1F 1HQUB 3GG1A 3KJVB 5IXUA 2G1DA 3S1TA 4RNFA 2LEBA 4IDKA 4L3NA 2QA4S 3IRXB 3EPIA 1MROA 3MM8B 1F5BA 4TYBA 4NXNF 4D3GA 2XMWA 2JHEA 3MOZA 1JNRB 4OHXA 3NMAA 1M5SA 1IKYA 3J7Z5 5A2QY 4FP9A 1QVFR 1NK4A 1X5TA 1GX5A 3PHEA 4F2SA 4ZVHA 2KT3A 2FDNA 1FJEB 4DV3F 1WHWA 1TK0A 5KFBA 5HMXA 1SV5B 1A9NB 1V3RA 2OLWA 4O4RA 3ICLA 1O0PA 1WHYA 1KTQA 2J0XA 3RBEA 1IKWA 3AA8A 2X1GA 3N6MA 4FS1A 2FGCA 3LUYA 2HHPA 2XZWA 4IG0A 3QYYA 4OHZA 3TX8A 1QSSA 2C3UA 5K8OA 2KYXA 1HHTP 1WTFA 3SCKE 1K73T 3CVKA 4O3SA 1S9EA 3GFZA 2UV8G 2C22A 1TK8A 2ZH7A 2F8HA 3DLEB 1IBKF 1S6PA 2LU2A 3PIPQ 4LIRA 3JSYA 5G4DA 4PUOA 5DO2A 3GQCA 3MM5B 1UVNA 2HG4A 4Q0BB 3SYZA 5IM0A 1XN9A 2DGTA 3KLIB 5THWA 1NJZA 4GKKF 4NX9A 4QPTA 4DX8H 1NNDA 3N28A 2HNYA 4WZMA 3OMSA 3KK3A 2GMLA 2ASDA 2IC3B 4J37A 3H40A 3PW7A 4PXBA 3NMRA 2I1RA 2OSRA 3UD4P 5HO4A 5I42A 4X4RA 3RB4A 3CCVS 3E3XA 4JI0F 1LXJA 3OFEA 2B6AA 2DNOA 2NPIA 4F2RA 2EK1A 3DM2B 3OTBA 2JLFA 4OZNA 5A8WA 4MK8A 1IQZA 5KFKA 2R7XA 4PQAA 1JWWA 3C6UB 3V6DA 2XGPA 2GJIA 2ZOFA 3N79A 1RTIA 4MFBB 2C42A 3QAUA 1Y3KA 3R3TA 1MMDA 5DDOC 1X8DA 1FRXA 5DM7Q 3KOAA 3U7JA 4OHYA 1TKTA 1JLQA 2VPYB 2G4BA 1TKDA 3OTCA 1WEYA 1FDDA 2DGXA 2F40A 1T05A 3GZ7A 2HHHF 4PUOB 4ZK7M 3M8PA 2FC9A 2ILZA 3CMES 3VWSA 2E66A 1NK7A 2UVUA 2VBYA 4B9NA 1Z1ZA 1HMVB 4NYOA 2DIVA 3DFEA 2VBWA 2NYIA 2VA2A 1JX4A 5J1EB 4KJIA 4ECUA 2VC1A 1VQ7S 3VAMA 4OJ1A 3NLCA 4QW8A 5ITHA 1REVA 2E9TA 3DYAB 4NMLA 5H9FJ 2VL1A 4KBIA 3HKZD 3SV4A 2VB6A 2OP5A 3IS9B 4W92B 3Q24A 3MOJB 2CQ0A 3U27A 5CZXA 4K50A 3HVTA 3MEKA 1E6YA 2YWKA 4ALZA 3X1LB 1RK8A 2HAIA 4YY3F 4B17A 2B4OA 3LP1B 3L95X 4ID8A 2F1FA 2MJUA 2KFZA 4WKRA 4B3SF 3HHLD 2PI4A 2YNFB 4XI9A 2XMMA 4JBCA 4LSLA 4PWUA 1HI1A 3KLHA 3K5NA 1BWEA 4RW8A 3DYAA 3L3CA 1G6BA 4YUDA 2Q43A 3GSDA 3H4DA 2VOOA 3D5MA 2A10A 4A8KA 1SXLA 3CTRA 1U49A 1Q16B 1C0UA 4R5PA 3UD3P 4Q8EA 4ILMA 1L5UA 3M30A 3LP2A 4PG6A 3TVYA 1IN0A 4QW9A 2PI5A 4LF6F 2RKIA 3KHGA 4RW6A 3KLFA 4DFMA 5HP1A 4DV1F 2JEFA 2GCFA 4N39A 1Q1KA 3Q8RB 1U1MA 2FLOA 5E41A 3B8HA 4ES2A 2BA9A 3NCPA 2QEXS 4PG5A 2J7WA 5B0EA 2DITA 3OHBA 1PSDA 1UVJA 4UYJA 2IM0A 2VPXB 3T1HF 5KFUA 5T14A 3NCRA 5KG0A 1VFJ<