2FJCA

Crystal structure of antigen tpf1 from treponema pallidum
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
151
structure length
151
Chain Sequence
PDARAIAAICEQLRQHVADLGVLYIKLHNYHWHIYGIEFKQVHELLEEYYVSVTEAFDTIAERLLQLGAQAPASMAEYLALSGIAEETEKEITIVSALARVKRDFEYLSTRFSQTQVLAAESGDAVTDGIITDILRTLGKAIWMLGATLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen TpF1
publication title Crystal structure of antigen TpF1 from Treponema pallidum.
pubmed doi rcsb
source organism Treponema pallidum
molecule tags Metal transport
total genus 67
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2006-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2fjcA00
1F33A 2X170 5FFDA 5E1UA 3GHQA 2FG4A 4OYNA 2C41A 2V2JA 1YV1A 4TOHA 3QHBA 4CVPA 3PVRA 2BKCA 2XJNA 3GVYA 2FL0A 1S30A 3E1JA 1H96A 5LG8A 3UOIA 3A9QA 5C6FA 2ITBA 3F39A 3PZAA 3PVRB 5HJFA 1Z6OM 3WNWA 1DPSA 4R42A 4LYUA 1JYBA 2FJCA 3NP2X 2XJOA 3ISFA 2VXXA 3SHXA 1YUZA 4LQHA 4DYXA 5JKMG 2VZBA 1BFRA 5J93A 1DATA 1RYTA 2C2FA 3BKNA 2JD80 4CY9A 3KA8A 4TOBA 3KA6A 1O9IA 1IESA 1FHAA 1XZ3A 4TOEA 3AF9X 2BW1A 3SH6A 5IX6A 4ZLWA 4MJYA 2QQYA 3AJQA 3IQ1A 4PGKA 1VLGA 2BJYA 5D8OA 3QHCA 2Z90A 3NP0X 4M32A 3QZ3A 4Z3BA 5D8PA 3PW1A 4RC7B 4Y08A 3AJOA 2V2NA 5D8QA 4PGIA 5CMRA 4AM4A 4ZMCA 2Y3QA 4AM2A 4Z5SA 1LKPA 3PW1B 1OTKA 1NF4A 3FVBA 5J8WA 2FKZA 4EVBA 4LQVA 1LKOA 1B71A 1ZS3A 1L8IA 4CYBA 1NNQA 1MFRA 5JKMA 1S2ZA 3HIUA 2W0OA 4TOAA 1N1QA 4IXKA 4XKUA 5I4JA 3IS7A 4ZKWA 2V15A 4ZKXA 1JIGA 2Z5PA 5LS9A 4KVSA 3VNXA 3R2KA 3T9JA 2CHIA 2HR5A 4EVDA 3E2CA 3OJ5A 4ISMA 1JKVA 3E1MA 1TKOA 5GU3X 4ZL6A 3SE1A 3BVIA 2YJJA 3KX9A 4TW3A 5K52A 4DYZA 5ERKA 2RBDA 4P18A 4TOCA 2V2IA 3PVYB 3WVUA 5D8XA 3E1PA 5AXSA 3U90A 4PG0A 3UOFA 3F32A 2FG8A 1NFVA 4TO9A 2ZURX 3KA4A 3ES3A 4LYXA 5J8SA 3BVFA 3R2HA 1LB3A 2CLBA 2HTNA 1QGHA 5E2DA 1GWGA 3AK9A 1RCIA 2ZG8X 3Q4NA 5LG2A 3TA8A 3IS8A 3RD0A 4IWKA 3RGDA 1HRSA 4ITTA 1TKPA 1DVBA 3QD8A 3EZUA 4RC5B 2IY4A 2G4HA 1VJXA 5D8YA 3BT5A 1JGCA 2FFXJ 2YW6A 5GN8A 3A68A 4KVQA 1RCCA 4DYYA 3RAVA 2GS4A 4M33A 2D5KA 5ERJA 3RE7A 4MKUA 5GN8B 4RC7A 2C2UA 4EVCA 2V2SA 1S3QA 5JACA 5LBHA 2WTLA 2ZA7A 2FHAA 2OH3A 1BCFA 4ZTTA 4ISPA 2VXIA 1TK6A 3NOZX 2V2OA 4MUDA 3KWOA 3E6SA 4DE6A 4CVRA 3FI6A 5FEJA 3R2OA 4LPMA 2CLUA 2OC5A 1L8HA 3HL1A 5FFAA 2ZA8A 1J30A 1XZ1A 3BVEA 3R2RA 4CVTA 4CVSA 3PVTA 3AF7X 1MOJA 4KVRA 4CYAA 4TOGA 2CEIA 2PYBA 3R2MA 4RC6A 3QVDA 4MN9A 3PVTB 1JI4A 2CN7A 4RC6B 4DYUA 2GYDA 2UX1A 5GU2X 3E1OA 3Q4RA 3EZ0A 2Z5QA 1RCDA 1SQ3A 2BK6A 3BVLA 4RC8A 4DI0A 4IWJA 4LPJA 3SIDA 3PVYA 4DZ0A 3R2LA 2QF9A 3KA9A 4MY7A 3E1NA 3EGMA 4XGSA 1EUMA 2Z6MA 3BVKA 4II4B 3QB9A 3O7RA 1Z6OA 2V2RA 2GYQA 2YW7A 5FFEA 4CMYA 3PW8C 4REUA 3PWFA 2JD70 5J9VA 4ETRA 2V2MA 5FFBA 1SOFA 3E6RA 5CZUA 2XGWA 2YJKA 5GU0X 3PWQC 4ITWA 2JD60 4RC5A 1QYBA 5D8RA 4ZL5A 5D8SA 1LKMA 4LPNA 3F35A 1VELA 4QUWA 2XKQA 1O9RA 5GOUA 1KRQA 1TJOA 4ERUA 1RCGA 2IB0A 3E1QA 2ZG9X 4LQJA 3AJPA 2C6RA 3KA3A 3OGHA 1JI5A 3F36A 3O7SA 3F34A 1BG7A 1YUXA 1JTSA 5JKLG 1JREA 2WLUA 1JKUA 3GE4A 4XKTA 5CMQA 3FSEA 4ZJKA 3E1LA 3AK8A 1Z4AA 4M35A 5K53A 4ML5A 3MPSA 1UVHA 4DASA 3F33A 5HJHA 2ZA6A 3ISEA 3KXUA 2XJMA 2CIHA 4EVEA 3AF8X 4YKHA 4AM5A 3F38A 5GU1X 4M34A 1UMNA 1RCEA 1VEQA 3H7GA 5FFCA 2WLAA 2CF7A 3F37A 5HQOA 1NF6A 3ERZA 3WVVA 2CHPA 4PG1A 4CMYV 4U3GA 1F30A 3UNOA 2F7NA 2ZG7X 1AEWA 2C2JA 1VEIA 4TOFA 2CN6A 2V2PA 3WVWA 4LQNA 3PW8A 3Q4QA 2FZFA 1IERA 4TODA 3Q4OA 3RBCA 4A25A 4E6KA 1ZUJA 4XKSA 1R03A 3PWQA 3R2SA 4ZKHA 2V2LA 5JKLA 4II4A 2Z5RA 2IU2A
chains in the Genus database with same CATH superfamily
1F33A 2X170 5FFDA 5E1UA 3GHQA 2FG4A 4OYNA 2C41A 2V2JA 1YV1A 4TOHA 3QHBA 3DBYA 4CVPA 3PVRA 3JZ9A 2BKCA 2XJNA 3GVYA 2FL0A 1S30A 3E1JA 1H96A 5LG8A 3UOIA 3A9QA 5C6FA 2ITBA 3F39A 3PZAA 3PVRB 5HJFA 1Z6OM 3WNWA 1DPSA 4R42A 4LYUA 1JYBA 2FJCA 3NP2X 2AR0A 2XJOA 3ISFA 2VXXA 3SHXA 1YUZA 4LQHA 4DYXA 5JKMG 2VZBA 1BFRA 5J93A 1DATA 1RYTA 2C2FA 3BKNA 2JD80 4CY9A 3KA8A 4TOBA 3KA6A 1O9IA 1IESA 1FHAA 1XZ3A 4TOEA 3AF9X 4YXMA 2BW1A 3SH6A 5IX6A 4ZLWA 2V8UA 4MXPA 4MJYA 2QQYA 3AJQA 3IQ1A 4PGKA 1VLGA 4W4LB 2BJYA 5HU6D 5D8OA 3QHCA 2Z90A 3NP0X 4M32A 3QZ3A 4X0JA 4Z3BA 5D8PA 3PW1A 4RC7B 4Y08A 3AJOA 2V2NA 5D8QA 4PGIA 5CMRA 4AM4A 4ZMCA 2Y3QA 4AM2A 4Z5SA 3KDQA 5JDOB 1LKPA 3PW1B 1OTKA 1NF4A 3FVBA 5J8WA 2FKZA 4EVBA 4LQVA 1LKOA 1B71A 1ZS3A 1L8IA 4CYBA 1NNQA 4E40A 1MFRA 5JKMA 1S2ZA 3HIUA 2W0OA 4TOAA 1N1QA 4IXKA 4XKUA 5I4JA 3IS7A 4ZKWA 3W54A 3V3KB 2V15A 4KXRB 4ZKXA 1JIGA 2Z5PA 5LS9A 3UFBA 3L0MA 4KVSA 3VNXA 3R2KA 3T9JA 2CHIA 2HR5A 4EVDA 3E2CA 3OJ5A 4ISMA 1JKVA 3E1MA 1TKOA 2G38B 5GU3X 4ZL6A 3SE1A 3BVIA 2YJJA 3KX9A 4TW3A 5K52A 4DYZA 5ERKA 2RBDA 4P18A 4TOCA 2V2IA 3PVYB 3WVUA 3LKDA 5D8XA 3E1PA 5AXSA 3U90A 4PG0A 3UOFA 3F32A 2FG8A 1NFVA 4TO9A 2ZURX 3KA4A 3ES3A 4LYXA 5J8SA 3BVFA 4YVZA 3R2HA 1LB3A 2CLBA 2HTNA 1QGHA 5E2DA 1GWGA 3AK9A 1RCIA 2ZG8X 3M6JA 3Q4NA 5LG2A 3TA8A 3IS8A 3RD0A 4IWKA 3RGDA 1HRSA 4ITTA 1TKPA 1DVBA 3QD8A 3EZUA 4RC5B 2IY4A 2G4HA 2WWXB 1VJXA 5D8YA 3BT5A 1JGCA 2FFXJ 2YW6A 5GN8A 3A68A 4KVQA 1RCCA 4DYYA 3RAVA 2GS4A 4M33A 2D5KA 5ERJA 3RE7A 4MKUA 3VVAA 5GN8B 4RC7A 2C2UA 4EVCA 2V2SA 1S3QA 5JACA 5LBHA 2WTLA 2ZA7A 2FHAA 2OH3A 1BCFA 4ZTTA 4ISPA 2VXIA 3GGZA 5JDOA 1TK6A 3NOZX 2V2OA 4MUDA 3KWOA 3E6SA 4DE6A 4CVRA 3FI6A 5FEJA 3R2OA 4LPMA 2CLUA 2OC5A 1L8HA 3HL1A 5FFAA 2ZA8A 1J30A 1XZ1A 3BVEA 3R2RA 4CVTA 4CVSA 3PVTA 3AF7X 1MOJA 4KVRA 4CYAA 4TOGA 2CEIA 2PYBA 3JZAB 3R2MA 4RC6A 3QVDA 4MN9A 2MGYA 3PVTB 1JI4A 2CN7A 4RC6B 4DYUA 2GYDA 2UX1A 5GU2X 3E1OA 3Q4RA 3EZ0A 2Z5QA 1RCDA 1SQ3A 2BK6A 3BVLA 4RC8A 4DI0A 3N6OA 4IWJA 4LPJA 3SIDA 3PVYA 4DZ0A 3R2LA 2QF9A 4W4KB 3FRRA 3KA9A 4MY7A 3E1NA 3EGMA 4XGSA 1EUMA 3GGYA 2Z6MA 3BVKA 4II4B 4WJG4 2Y44A 3QB9A 3O7RA 1Z6OA 2V2RA 2GYQA 2YW7A 5FFEA 4CMYA 3PW8C 3VV9A 4REUA 3PWFA 2JD70 5J9VA 4ETRA 2V2MA 5FFBA 1SOFA 3E6RA 5CZUA 2XGWA 2YJKA 5GU0X 3PWQC 4ITWA 4YXJA 2JD60 4RC5A 1QYBA 5D8RA 4ZL5A 5D8SA 1LKMA 4LPNA 3F35A 1VELA 4QUWA 2XKQA 3KHKA 1O9RA 5GOUA 1KRQA 1TJOA 4ERUA 1RCGA 3C1ZA 2IB0A 3E1QA 2ZG9X 4LQJA 3AJPA 2C6RA 3KA3A 3OGHA 1JI5A 3F36A 3O7SA 2OKCA 1BG7A 3F34A 1YUXA 1JTSA 5JKLG 1JREA 2WLUA 1JKUA 3GE4A 4XKTA 5CMQA 3FSEA 4ZJKA 3E1LA 2V8TA 3D19A 3AK8A 1Z4AA 4M35A 5K53A 4ML5A 3MPSA 1UVHA 4DASA 2N02A 3F33A 5HJHA 2ZA6A 3ISEA 3KXUA 2XJMA 2CIHA 4EVEA 3AF8X 4YKHA 4AM5A 3F38A 5GU1X 4M34A 1UMNA 1RCEA 3C1YA 1VEQA 3H7GA 5FFCA 2WLAA 2CF7A 3F37A 5HQOA 1NF6A 3ERZA 3WVVA 2CHPA 4PG1A 4CMYV 4U3GA 1F30A 3UNOA 2F7NA 2ZG7X 1AEWA 2C2JA 1VEIA 4TOFA 2CN6A 2V2PA 3WVWA 4LQNA 3C21A 3PW8A 3Q4QA 2FZFA 1IERA 4TODA 3Q4OA 3RBCA 4A25A 4E6KA 3FRSA 1ZUJA 4XKSA 1R03A 3PWQA 3R2SA 4ZKHA 3C23A 2V2LA 5JKLA 4II4A 2Z5RA 2CWLA 2IU2A
chains in the Genus database with same CATH topology
1F33A 2X170 5FFDA 5E1UA 3GHQA 2FG4A 4OYNA 2C41A 2V2JA 1YV1A 4TOHA 3QHBA 3DBYA 4CVPA 3PVRA 3JZ9A 2BKCA 2XJNA 3GVYA 2FL0A 1S30A 3E1JA 1H96A 5LG8A 3UOIA 3A9QA 5C6FA 2ITBA 3F39A 3PZAA 3PVRB 5HJFA 1Z6OM 3WNWA 1DPSA 4R42A 4LYUA 1JYBA 2FJCA 3NP2X 2AR0A 2XJOA 3ISFA 2VXXA 3SHXA 1YUZA 4LQHA 4DYXA 5JKMG 2VZBA 1BFRA 5J93A 1DATA 1RYTA 2C2FA 3BKNA 2JD80 4CY9A 3KA8A 4TOBA 3KA6A 1O9IA 1IESA 1FHAA 1XZ3A 4TOEA 3AF9X 4YXMA 2BW1A 3SH6A 5IX6A 4ZLWA 2V8UA 4MXPA 4MJYA 2QQYA 3AJQA 3IQ1A 4PGKA 1VLGA 4W4LB 2BJYA 5HU6D 5D8OA 3QHCA 2Z90A 3NP0X 4M32A 3QZ3A 4X0JA 4Z3BA 5D8PA 3PW1A 4RC7B 4Y08A 3AJOA 2V2NA 5D8QA 4PGIA 5CMRA 4AM4A 4ZMCA 2Y3QA 4AM2A 4Z5SA 3KDQA 5JDOB 1LKPA 3PW1B 1OTKA 1NF4A 3FVBA 5J8WA 2FKZA 4EVBA 4LQVA 1LKOA 1B71A 1ZS3A 1L8IA 4CYBA 1NNQA 4E40A 1MFRA 5JKMA 1S2ZA 3HIUA 2W0OA 4TOAA 1N1QA 4IXKA 4XKUA 5I4JA 3IS7A 4ZKWA 3W54A 3V3KB 2V15A 4KXRB 4ZKXA 1JIGA 2Z5PA 5LS9A 3UFBA 3L0MA 4KVSA 3VNXA 3R2KA 3T9JA 2CHIA 2HR5A 4EVDA 3E2CA 3OJ5A 4ISMA 1JKVA 3E1MA 1TKOA 2G38B 5GU3X 4ZL6A 3SE1A 3BVIA 2YJJA 3KX9A 4TW3A 5K52A 4DYZA 5ERKA 2RBDA 4P18A 4TOCA 2V2IA 3PVYB 3WVUA 3LKDA 5D8XA 3E1PA 5AXSA 3U90A 4PG0A 3UOFA 3F32A 2FG8A 1NFVA 4TO9A 2ZURX 3KA4A 3ES3A 4LYXA 5J8SA 3BVFA 4YVZA 3R2HA 1LB3A 2CLBA 2HTNA 1QGHA 5E2DA 1GWGA 3AK9A 1RCIA 2ZG8X 3M6JA 3Q4NA 5LG2A 3TA8A 3IS8A 3RD0A 4IWKA 3RGDA 1HRSA 4ITTA 1TKPA 1DVBA 3QD8A 3EZUA 4RC5B 2IY4A 2G4HA 2WWXB 1VJXA 5D8YA 3BT5A 1JGCA 2FFXJ 2YW6A 5GN8A 3A68A 4KVQA 1RCCA 4DYYA 3RAVA 2GS4A 4M33A 2D5KA 5ERJA 3RE7A 4MKUA 3VVAA 5GN8B 4RC7A 2C2UA 4EVCA 2V2SA 1S3QA 5JACA 5LBHA 2WTLA 2ZA7A 2FHAA 2OH3A 1BCFA 4ZTTA 4ISPA 2VXIA 3GGZA 5JDOA 1TK6A 3NOZX 2V2OA 4MUDA 3KWOA 3E6SA 4DE6A 4CVRA 3FI6A 5FEJA 3R2OA 4LPMA 2CLUA 2OC5A 1L8HA 3HL1A 5FFAA 2ZA8A 1J30A 1XZ1A 3BVEA 3R2RA 4CVTA 4CVSA 3PVTA 3AF7X 1MOJA 4KVRA 4CYAA 4TOGA 2CEIA 2PYBA 3JZAB 3R2MA 4RC6A 3QVDA 4MN9A 2MGYA 3PVTB 1JI4A 2CN7A 4RC6B 4DYUA 2GYDA 2UX1A 5GU2X 3E1OA 3Q4RA 3EZ0A 2Z5QA 1RCDA 1SQ3A 2BK6A 3BVLA 4RC8A 4DI0A 3N6OA 4IWJA 4LPJA 3SIDA 3PVYA 4DZ0A 3R2LA 2QF9A 4W4KB 3FRRA 3KA9A 4MY7A 3E1NA 3EGMA 4XGSA 1EUMA 3GGYA 2Z6MA 3BVKA 4II4B 4WJG4 2Y44A 3QB9A 3O7RA 1Z6OA 2V2RA 2GYQA 2YW7A 5FFEA 4CMYA 3PW8C 3VV9A 4REUA 3PWFA 2JD70 5J9VA 4ETRA 2V2MA 5FFBA 1SOFA 3E6RA 5CZUA 2XGWA 2YJKA 5GU0X 3PWQC 4ITWA 4YXJA 2JD60 4RC5A 1QYBA 5D8RA 4ZL5A 5D8SA 1LKMA 4LPNA 3F35A 1VELA 4QUWA 2XKQA 3KHKA 1O9RA 5GOUA 1KRQA 1TJOA 4ERUA 1RCGA 3C1ZA 2IB0A 3E1QA 2ZG9X 4LQJA 3AJPA 2C6RA 3KA3A 3OGHA 1JI5A 3F36A 3O7SA 2OKCA 1BG7A 3F34A 1YUXA 1JTSA 5JKLG 1JREA 2WLUA 1JKUA 3GE4A 4XKTA 5CMQA 3FSEA 4ZJKA 3E1LA 2V8TA 3D19A 3AK8A 1Z4AA 4M35A 5K53A 4ML5A 3MPSA 1UVHA 4DASA 2N02A 3F33A 5HJHA 2ZA6A 3ISEA 3KXUA 2XJMA 2CIHA 4EVEA 3AF8X 4YKHA 4AM5A 3F38A 5GU1X 4M34A 1UMNA 1RCEA 3C1YA 1VEQA 3H7GA 5FFCA 2WLAA 2CF7A 3F37A 5HQOA 1NF6A 3ERZA 3WVVA 2CHPA 4PG1A 4CMYV 4U3GA 1F30A 3UNOA 2F7NA 2ZG7X 1AEWA 2C2JA 1VEIA 4TOFA 2CN6A 2V2PA 3WVWA 4LQNA 3C21A 3PW8A 3Q4QA 2FZFA 1IERA 4TODA 3Q4OA 3RBCA 4A25A 4E6KA 3FRSA 1ZUJA 4XKSA 1R03A 3PWQA 3R2SA 4ZKHA 3C23A 2V2LA 5JKLA 4II4A 2Z5RA 2CWLA 2IU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F33 A;  2X17 0;  5FFD A;  5E1U A;  3GHQ A;  2FG4 A;  4OYN A;  2C41 A;  2V2J A;  1YV1 A;  4TOH A;  3QHB A;  4CVP A;  3PVR A;  2BKC A;  2XJN A;  3GVY A;  2FL0 A;  1S30 A;  3E1J A;  1H96 A;  5LG8 A;  3UOI A;  3A9Q A;  5C6F A;  2ITB A;  3F39 A;  3PZA A;  3PVR B;  5HJF A;  1Z6O M;  3WNW A;  1DPS A;  4R42 A;  4LYU A;  1JYB A;  2FJC A;  3NP2 X;  2XJO A;  3ISF A;  2VXX A;  3SHX A;  1YUZ A;  4LQH A;  4DYX A;  5JKM G;  2VZB A;  1BFR A;  5J93 A;  1DAT A;  1RYT A;  2C2F A;  3BKN A;  2JD8 0;  4CY9 A;  3KA8 A;  4TOB A;  3KA6 A;  1O9I A;  1IES A;  1FHA A;  1XZ3 A;  4TOE A;  3AF9 X;  2BW1 A;  3SH6 A;  5IX6 A;  4ZLW A;  4MJY A;  2QQY A;  3AJQ A;  3IQ1 A;  4PGK A;  1VLG A;  2BJY A;  5D8O A;  3QHC A;  2Z90 A;  3NP0 X;  4M32 A;  3QZ3 A;  4Z3B A;  5D8P A;  3PW1 A;  4RC7 B;  4Y08 A;  3AJO A;  2V2N A;  5D8Q A;  4PGI A;  5CMR A;  4AM4 A;  4ZMC A;  2Y3Q A;  4AM2 A;  4Z5S A;  1LKP A;  3PW1 B;  1OTK A;  1NF4 A;  3FVB A;  5J8W A;  2FKZ A;  4EVB A;  4LQV A;  1LKO A;  1B71 A;  1ZS3 A;  1L8I A;  4CYB A;  1NNQ A;  1MFR A;  5JKM A;  1S2Z A;  3HIU A;  2W0O A;  4TOA A;  1N1Q A;  4IXK A;  4XKU A;  5I4J A;  3IS7 A;  4ZKW A;  2V15 A;  4ZKX A;  1JIG A;  2Z5P A;  5LS9 A;  4KVS A;  3VNX A;  3R2K A;  3T9J A;  2CHI A;  2HR5 A;  4EVD A;  3E2C A;  3OJ5 A;  4ISM A;  1JKV A;  3E1M A;  1TKO A;  5GU3 X;  4ZL6 A;  3SE1 A;  3BVI A;  2YJJ A;  3KX9 A;  4TW3 A;  5K52 A;  4DYZ A;  5ERK A;  2RBD A;  4P18 A;  4TOC A;  2V2I A;  3PVY B;  3WVU A;  5D8X A;  3E1P A;  5AXS A;  3U90 A;  4PG0 A;  3UOF A;  3F32 A;  2FG8 A;  1NFV A;  4TO9 A;  2ZUR X;  3KA4 A;  3ES3 A;  4LYX A;  5J8S A;  3BVF A;  3R2H A;  1LB3 A;  2CLB A;  2HTN A;  1QGH A;  5E2D A;  1GWG A;  3AK9 A;  1RCI A;  2ZG8 X;  3Q4N A;  5LG2 A;  3TA8 A;  3IS8 A;  3RD0 A;  4IWK A;  3RGD A;  1HRS A;  4ITT A;  1TKP A;  1DVB A;  3QD8 A;  3EZU A;  4RC5 B;  2IY4 A;  2G4H A;  1VJX A;  5D8Y A;  3BT5 A;  1JGC A;  2FFX J;  2YW6 A;  5GN8 A;  3A68 A;  4KVQ A;  1RCC A;  4DYY A;  3RAV A;  2GS4 A;  4M33 A;  2D5K A;  5ERJ A;  3RE7 A;  4MKU A;  5GN8 B;  4RC7 A;  2C2U A;  4EVC A;  2V2S A;  1S3Q A;  5JAC A;  5LBH A;  2WTL A;  2ZA7 A;  2FHA A;  2OH3 A;  1BCF A;  4ZTT A;  4ISP A;  2VXI A;  1TK6 A;  3NOZ X;  2V2O A;  4MUD A;  3KWO A;  3E6S A;  4DE6 A;  4CVR A;  3FI6 A;  5FEJ A;  3R2O A;  4LPM A;  2CLU A;  2OC5 A;  1L8H A;  3HL1 A;  5FFA A;  2ZA8 A;  1J30 A;  1XZ1 A;  3BVE A;  3R2R A;  4CVT A;  4CVS A;  3PVT A;  3AF7 X;  1MOJ A;  4KVR A;  4CYA A;  4TOG A;  2CEI A;  2PYB A;  3R2M A;  4RC6 A;  3QVD A;  4MN9 A;  3PVT B;  1JI4 A;  2CN7 A;  4RC6 B;  4DYU A;  2GYD A;  2UX1 A;  5GU2 X;  3E1O A;  3Q4R A;  3EZ0 A;  2Z5Q A;  1RCD A;  1SQ3 A;  2BK6 A;  3BVL A;  4RC8 A;  4DI0 A;  4IWJ A;  4LPJ A;  3SID A;  3PVY A;  4DZ0 A;  3R2L A;  2QF9 A;  3KA9 A;  4MY7 A;  3E1N A;  3EGM A;  4XGS A;  1EUM A;  2Z6M A;  3BVK A;  4II4 B;  3QB9 A;  3O7R A;  1Z6O A;  2V2R A;  2GYQ A;  2YW7 A;  5FFE A;  4CMY A;  3PW8 C;  4REU A;  3PWF A;  2JD7 0;  5J9V A;  4ETR A;  2V2M A;  5FFB A;  1SOF A;  3E6R A;  5CZU A;  2XGW A;  2YJK A;  5GU0 X;  3PWQ C;  4ITW A;  2JD6 0;  4RC5 A;  1QYB A;  5D8R A;  4ZL5 A;  5D8S A;  1LKM A;  4LPN A;  3F35 A;  1VEL A;  4QUW A;  2XKQ A;  1O9R A;  5GOU A;  1KRQ A;  1TJO A;  4ERU A;  1RCG A;  2IB0 A;  3E1Q A;  2ZG9 X;  4LQJ A;  3AJP A;  2C6R A;  3KA3 A;  3OGH A;  1JI5 A;  3F36 A;  3O7S A;  3F34 A;  1BG7 A;  1YUX A;  1JTS A;  5JKL G;  1JRE A;  2WLU A;  1JKU A;  3GE4 A;  4XKT A;  5CMQ A;  3FSE A;  4ZJK A;  3E1L A;  3AK8 A;  1Z4A A;  4M35 A;  5K53 A;  4ML5 A;  3MPS A;  1UVH A;  4DAS A;  3F33 A;  5HJH A;  2ZA6 A;  3ISE A;  3KXU A;  2XJM A;  2CIH A;  4EVE A;  3AF8 X;  4YKH A;  4AM5 A;  3F38 A;  5GU1 X;  4M34 A;  1UMN A;  1RCE A;  1VEQ A;  3H7G A;  5FFC A;  2WLA A;  2CF7 A;  3F37 A;  5HQO A;  1NF6 A;  3ERZ A;  3WVV A;  2CHP A;  4PG1 A;  4CMY V;  4U3G A;  1F30 A;  3UNO A;  2F7N A;  2ZG7 X;  1AEW A;  2C2J A;  1VEI A;  4TOF A;  2CN6 A;  2V2P A;  3WVW A;  4LQN A;  3PW8 A;  3Q4Q A;  2FZF A;  1IER A;  4TOD A;  3Q4O A;  3RBC A;  4A25 A;  4E6K A;  1ZUJ A;  4XKS A;  1R03 A;  3PWQ A;  3R2S A;  4ZKH A;  2V2L A;  5JKL A;  4II4 A;  2Z5R A;  2IU2 A; 
#chains in the Genus database with same CATH topology
 1F33 A;  2X17 0;  5FFD A;  5E1U A;  3GHQ A;  2FG4 A;  4OYN A;  2C41 A;  2V2J A;  1YV1 A;  4TOH A;  3QHB A;  3DBY A;  4CVP A;  3PVR A;  3JZ9 A;  2BKC A;  2XJN A;  3GVY A;  2FL0 A;  1S30 A;  3E1J A;  1H96 A;  5LG8 A;  3UOI A;  3A9Q A;  5C6F A;  2ITB A;  3F39 A;  3PZA A;  3PVR B;  5HJF A;  1Z6O M;  3WNW A;  1DPS A;  4R42 A;  4LYU A;  1JYB A;  2FJC A;  3NP2 X;  2AR0 A;  2XJO A;  3ISF A;  2VXX A;  3SHX A;  1YUZ A;  4LQH A;  4DYX A;  5JKM G;  2VZB A;  1BFR A;  5J93 A;  1DAT A;  1RYT A;  2C2F A;  3BKN A;  2JD8 0;  4CY9 A;  3KA8 A;  4TOB A;  3KA6 A;  1O9I A;  1IES A;  1FHA A;  1XZ3 A;  4TOE A;  3AF9 X;  4YXM A;  2BW1 A;  3SH6 A;  5IX6 A;  4ZLW A;  2V8U A;  4MXP A;  4MJY A;  2QQY A;  3AJQ A;  3IQ1 A;  4PGK A;  1VLG A;  4W4L B;  2BJY A;  5HU6 D;  5D8O A;  3QHC A;  2Z90 A;  3NP0 X;  4M32 A;  3QZ3 A;  4X0J A;  4Z3B A;  5D8P A;  3PW1 A;  4RC7 B;  4Y08 A;  3AJO A;  2V2N A;  5D8Q A;  4PGI A;  5CMR A;  4AM4 A;  4ZMC A;  2Y3Q A;  4AM2 A;  4Z5S A;  3KDQ A;  5JDO B;  1LKP A;  3PW1 B;  1OTK A;  1NF4 A;  3FVB A;  5J8W A;  2FKZ A;  4EVB A;  4LQV A;  1LKO A;  1B71 A;  1ZS3 A;  1L8I A;  4CYB A;  1NNQ A;  4E40 A;  1MFR A;  5JKM A;  1S2Z A;  3HIU A;  2W0O A;  4TOA A;  1N1Q A;  4IXK A;  4XKU A;  5I4J A;  3IS7 A;  4ZKW A;  3W54 A;  3V3K B;  2V15 A;  4KXR B;  4ZKX A;  1JIG A;  2Z5P A;  5LS9 A;  3UFB A;  3L0M A;  4KVS A;  3VNX A;  3R2K A;  3T9J A;  2CHI A;  2HR5 A;  4EVD A;  3E2C A;  3OJ5 A;  4ISM A;  1JKV A;  3E1M A;  1TKO A;  2G38 B;  5GU3 X;  4ZL6 A;  3SE1 A;  3BVI A;  2YJJ A;  3KX9 A;  4TW3 A;  5K52 A;  4DYZ A;  5ERK A;  2RBD A;  4P18 A;  4TOC A;  2V2I A;  3PVY B;  3WVU A;  3LKD A;  5D8X A;  3E1P A;  5AXS A;  3U90 A;  4PG0 A;  3UOF A;  3F32 A;  2FG8 A;  1NFV A;  4TO9 A;  2ZUR X;  3KA4 A;  3ES3 A;  4LYX A;  5J8S A;  3BVF A;  4YVZ A;  3R2H A;  1LB3 A;  2CLB A;  2HTN A;  1QGH A;  5E2D A;  1GWG A;  3AK9 A;  1RCI A;  2ZG8 X;  3M6J A;  3Q4N A;  5LG2 A;  3TA8 A;  3IS8 A;  3RD0 A;  4IWK A;  3RGD A;  1HRS A;  4ITT A;  1TKP A;  1DVB A;  3QD8 A;  3EZU A;  4RC5 B;  2IY4 A;  2G4H A;  2WWX B;  1VJX A;  5D8Y A;  3BT5 A;  1JGC A;  2FFX J;  2YW6 A;  5GN8 A;  3A68 A;  4KVQ A;  1RCC A;  4DYY A;  3RAV A;  2GS4 A;  4M33 A;  2D5K A;  5ERJ A;  3RE7 A;  4MKU A;  3VVA A;  5GN8 B;  4RC7 A;  2C2U A;  4EVC A;  2V2S A;  1S3Q A;  5JAC A;  5LBH A;  2WTL A;  2ZA7 A;  2FHA A;  2OH3 A;  1BCF A;  4ZTT A;  4ISP A;  2VXI A;  3GGZ A;  5JDO A;  1TK6 A;  3NOZ X;  2V2O A;  4MUD A;  3KWO A;  3E6S A;  4DE6 A;  4CVR A;  3FI6 A;  5FEJ A;  3R2O A;  4LPM A;  2CLU A;  2OC5 A;  1L8H A;  3HL1 A;  5FFA A;  2ZA8 A;  1J30 A;  1XZ1 A;  3BVE A;  3R2R A;  4CVT A;  4CVS A;  3PVT A;  3AF7 X;  1MOJ A;  4KVR A;  4CYA A;  4TOG A;  2CEI A;  2PYB A;  3JZA B;  3R2M A;  4RC6 A;  3QVD A;  4MN9 A;  2MGY A;  3PVT B;  1JI4 A;  2CN7 A;  4RC6 B;  4DYU A;  2GYD A;  2UX1 A;  5GU2 X;  3E1O A;  3Q4R A;  3EZ0 A;  2Z5Q A;  1RCD A;  1SQ3 A;  2BK6 A;  3BVL A;  4RC8 A;  4DI0 A;  3N6O A;  4IWJ A;  4LPJ A;  3SID A;  3PVY A;  4DZ0 A;  3R2L A;  2QF9 A;  4W4K B;  3FRR A;  3KA9 A;  4MY7 A;  3E1N A;  3EGM A;  4XGS A;  1EUM A;  3GGY A;  2Z6M A;  3BVK A;  4II4 B;  4WJG 4;  2Y44 A;  3QB9 A;  3O7R A;  1Z6O A;  2V2R A;  2GYQ A;  2YW7 A;  5FFE A;  4CMY A;  3PW8 C;  3VV9 A;  4REU A;  3PWF A;  2JD7 0;  5J9V A;  4ETR A;  2V2M A;  5FFB A;  1SOF A;  3E6R A;  5CZU A;  2XGW A;  2YJK A;  5GU0 X;  3PWQ C;  4ITW A;  4YXJ A;  2JD6 0;  4RC5 A;  1QYB A;  5D8R A;  4ZL5 A;  5D8S A;  1LKM A;  4LPN A;  3F35 A;  1VEL A;  4QUW A;  2XKQ A;  3KHK A;  1O9R A;  5GOU A;  1KRQ A;  1TJO A;  4ERU A;  1RCG A;  3C1Z A;  2IB0 A;  3E1Q A;  2ZG9 X;  4LQJ A;  3AJP A;  2C6R A;  3KA3 A;  3OGH A;  1JI5 A;  3F36 A;  3O7S A;  2OKC A;  1BG7 A;  3F34 A;  1YUX A;  1JTS A;  5JKL G;  1JRE A;  2WLU A;  1JKU A;  3GE4 A;  4XKT A;  5CMQ A;  3FSE A;  4ZJK A;  3E1L A;  2V8T A;  3D19 A;  3AK8 A;  1Z4A A;  4M35 A;  5K53 A;  4ML5 A;  3MPS A;  1UVH A;  4DAS A;  2N02 A;  3F33 A;  5HJH A;  2ZA6 A;  3ISE A;  3KXU A;  2XJM A;  2CIH A;  4EVE A;  3AF8 X;  4YKH A;  4AM5 A;  3F38 A;  5GU1 X;  4M34 A;  1UMN A;  1RCE A;  3C1Y A;  1VEQ A;  3H7G A;  5FFC A;  2WLA A;  2CF7 A;  3F37 A;  5HQO A;  1NF6 A;  3ERZ A;  3WVV A;  2CHP A;  4PG1 A;  4CMY V;  4U3G A;  1F30 A;  3UNO A;  2F7N A;  2ZG7 X;  1AEW A;  2C2J A;  1VEI A;  4TOF A;  2CN6 A;  2V2P A;  3WVW A;  4LQN A;  3C21 A;  3PW8 A;  3Q4Q A;  2FZF A;  1IER A;  4TOD A;  3Q4O A;  3RBC A;  4A25 A;  4E6K A;  3FRS A;  1ZUJ A;  4XKS A;  1R03 A;  3PWQ A;  3R2S A;  4ZKH A;  3C23 A;  2V2L A;  5JKL A;  4II4 A;  2Z5R A;  2CWL A;  2IU2 A; 
#chains in the Genus database with same CATH homology
 1F33 A;  2X17 0;  5FFD A;  5E1U A;  3GHQ A;  2FG4 A;  4OYN A;  2C41 A;  2V2J A;  1YV1 A;  4TOH A;  3QHB A;  3DBY A;  4CVP A;  3PVR A;  3JZ9 A;  2BKC A;  2XJN A;  3GVY A;  2FL0 A;  1S30 A;  3E1J A;  1H96 A;  5LG8 A;  3UOI A;  3A9Q A;  5C6F A;  2ITB A;  3F39 A;  3PZA A;  3PVR B;  5HJF A;  1Z6O M;  3WNW A;  1DPS A;  4R42 A;  4LYU A;  1JYB A;  2FJC A;  3NP2 X;  2AR0 A;  2XJO A;  3ISF A;  2VXX A;  3SHX A;  1YUZ A;  4LQH A;  4DYX A;  5JKM G;  2VZB A;  1BFR A;  5J93 A;  1DAT A;  1RYT A;  2C2F A;  3BKN A;  2JD8 0;  4CY9 A;  3KA8 A;  4TOB A;  3KA6 A;  1O9I A;  1IES A;  1FHA A;  1XZ3 A;  4TOE A;  3AF9 X;  4YXM A;  2BW1 A;  3SH6 A;  5IX6 A;  4ZLW A;  2V8U A;  4MXP A;  4MJY A;  2QQY A;  3AJQ A;  3IQ1 A;  4PGK A;  1VLG A;  4W4L B;  2BJY A;  5HU6 D;  5D8O A;  3QHC A;  2Z90 A;  3NP0 X;  4M32 A;  3QZ3 A;  4X0J A;  4Z3B A;  5D8P A;  3PW1 A;  4RC7 B;  4Y08 A;  3AJO A;  2V2N A;  5D8Q A;  4PGI A;  5CMR A;  4AM4 A;  4ZMC A;  2Y3Q A;  4AM2 A;  4Z5S A;  3KDQ A;  5JDO B;  1LKP A;  3PW1 B;  1OTK A;  1NF4 A;  3FVB A;  5J8W A;  2FKZ A;  4EVB A;  4LQV A;  1LKO A;  1B71 A;  1ZS3 A;  1L8I A;  4CYB A;  1NNQ A;  4E40 A;  1MFR A;  5JKM A;  1S2Z A;  3HIU A;  2W0O A;  4TOA A;  1N1Q A;  4IXK A;  4XKU A;  5I4J A;  3IS7 A;  4ZKW A;  3W54 A;  3V3K B;  2V15 A;  4KXR B;  4ZKX A;  1JIG A;  2Z5P A;  5LS9 A;  3UFB A;  3L0M A;  4KVS A;  3VNX A;  3R2K A;  3T9J A;  2CHI A;  2HR5 A;  4EVD A;  3E2C A;  3OJ5 A;  4ISM A;  1JKV A;  3E1M A;  1TKO A;  2G38 B;  5GU3 X;  4ZL6 A;  3SE1 A;  3BVI A;  2YJJ A;  3KX9 A;  4TW3 A;  5K52 A;  4DYZ A;  5ERK A;  2RBD A;  4P18 A;  4TOC A;  2V2I A;  3PVY B;  3WVU A;  3LKD A;  5D8X A;  3E1P A;  5AXS A;  3U90 A;  4PG0 A;  3UOF A;  3F32 A;  2FG8 A;  1NFV A;  4TO9 A;  2ZUR X;  3KA4 A;  3ES3 A;  4LYX A;  5J8S A;  3BVF A;  4YVZ A;  3R2H A;  1LB3 A;  2CLB A;  2HTN A;  1QGH A;  5E2D A;  1GWG A;  3AK9 A;  1RCI A;  2ZG8 X;  3M6J A;  3Q4N A;  5LG2 A;  3TA8 A;  3IS8 A;  3RD0 A;  4IWK A;  3RGD A;  1HRS A;  4ITT A;  1TKP A;  1DVB A;  3QD8 A;  3EZU A;  4RC5 B;  2IY4 A;  2G4H A;  2WWX B;  1VJX A;  5D8Y A;  3BT5 A;  1JGC A;  2FFX J;  2YW6 A;  5GN8 A;  3A68 A;  4KVQ A;  1RCC A;  4DYY A;  3RAV A;  2GS4 A;  4M33 A;  2D5K A;  5ERJ A;  3RE7 A;  4MKU A;  3VVA A;  5GN8 B;  4RC7 A;  2C2U A;  4EVC A;  2V2S A;  1S3Q A;  5JAC A;  5LBH A;  2WTL A;  2ZA7 A;  2FHA A;  2OH3 A;  1BCF A;  4ZTT A;  4ISP A;  2VXI A;  3GGZ A;  5JDO A;  1TK6 A;  3NOZ X;  2V2O A;  4MUD A;  3KWO A;  3E6S A;  4DE6 A;  4CVR A;  3FI6 A;  5FEJ A;  3R2O A;  4LPM A;  2CLU A;  2OC5 A;  1L8H A;  3HL1 A;  5FFA A;  2ZA8 A;  1J30 A;  1XZ1 A;  3BVE A;  3R2R A;  4CVT A;  4CVS A;  3PVT A;  3AF7 X;  1MOJ A;  4KVR A;  4CYA A;  4TOG A;  2CEI A;  2PYB A;  3JZA B;  3R2M A;  4RC6 A;  3QVD A;  4MN9 A;  2MGY A;  3PVT B;  1JI4 A;  2CN7 A;  4RC6 B;  4DYU A;  2GYD A;  2UX1 A;  5GU2 X;  3E1O A;  3Q4R A;  3EZ0 A;  2Z5Q A;  1RCD A;  1SQ3 A;  2BK6 A;  3BVL A;  4RC8 A;  4DI0 A;  3N6O A;  4IWJ A;  4LPJ A;  3SID A;  3PVY A;  4DZ0 A;  3R2L A;  2QF9 A;  4W4K B;  3FRR A;  3KA9 A;  4MY7 A;  3E1N A;  3EGM A;  4XGS A;  1EUM A;  3GGY A;  2Z6M A;  3BVK A;  4II4 B;  4WJG 4;  2Y44 A;  3QB9 A;  3O7R A;  1Z6O A;  2V2R A;  2GYQ A;  2YW7 A;  5FFE A;  4CMY A;  3PW8 C;  3VV9 A;  4REU A;  3PWF A;  2JD7 0;  5J9V A;  4ETR A;  2V2M A;  5FFB A;  1SOF A;  3E6R A;  5CZU A;  2XGW A;  2YJK A;  5GU0 X;  3PWQ C;  4ITW A;  4YXJ A;  2JD6 0;  4RC5 A;  1QYB A;  5D8R A;  4ZL5 A;  5D8S A;  1LKM A;  4LPN A;  3F35 A;  1VEL A;  4QUW A;  2XKQ A;  3KHK A;  1O9R A;  5GOU A;  1KRQ A;  1TJO A;  4ERU A;  1RCG A;  3C1Z A;  2IB0 A;  3E1Q A;  2ZG9 X;  4LQJ A;  3AJP A;  2C6R A;  3KA3 A;  3OGH A;  1JI5 A;  3F36 A;  3O7S A;  2OKC A;  1BG7 A;  3F34 A;  1YUX A;  1JTS A;  5JKL G;  1JRE A;  2WLU A;  1JKU A;  3GE4 A;  4XKT A;  5CMQ A;  3FSE A;  4ZJK A;  3E1L A;  2V8T A;  3D19 A;  3AK8 A;  1Z4A A;  4M35 A;  5K53 A;  4ML5 A;  3MPS A;  1UVH A;  4DAS A;  2N02 A;  3F33 A;  5HJH A;  2ZA6 A;  3ISE A;  3KXU A;  2XJM A;  2CIH A;  4EVE A;  3AF8 X;  4YKH A;  4AM5 A;  3F38 A;  5GU1 X;  4M34 A;  1UMN A;  1RCE A;  3C1Y A;  1VEQ A;  3H7G A;  5FFC A;  2WLA A;  2CF7 A;  3F37 A;  5HQO A;  1NF6 A;  3ERZ A;  3WVV A;  2CHP A;  4PG1 A;  4CMY V;  4U3G A;  1F30 A;  3UNO A;  2F7N A;  2ZG7 X;  1AEW A;  2C2J A;  1VEI A;  4TOF A;  2CN6 A;  2V2P A;  3WVW A;  4LQN A;  3C21 A;  3PW8 A;  3Q4Q A;  2FZF A;  1IER A;  4TOD A;  3Q4O A;  3RBC A;  4A25 A;  4E6K A;  3FRS A;  1ZUJ A;  4XKS A;  1R03 A;  3PWQ A;  3R2S A;  4ZKH A;  3C23 A;  2V2L A;  5JKL A;  4II4 A;  2Z5R A;  2CWL A;  2IU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...