2FJHB

Structure of the b20-4 fab, a phage derived fab fragment, in complex with vegf
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
224
structure length
219
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTINASWIHWVRQAPGKGLEWVGAIYPYSGYTNYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARWGHSTSPWAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vascular endothelial growth factor A
publication title Structure-function studies of two synthetic anti-vascular endothelial growth factor Fabs and comparison with the Avastin Fab.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor/immune system
total genus 42
structure length 219
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fjhB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fjhB01
2JTDA 4F9PA 1CT8B 1MAMH 2EEBA 2H9GA 5HY9B 1RIHH 3RWEB 3FT3B 2WINB 4QXTB 5E95B 2XN9D 4RQQA 4UT6H 5M95B 4Z0BH 2NY2B 1LEIB 2PYED 1JE6A 2O93L 1QO3B 4NJAH 1Z6JT 1XZ0A 2P45B 4TNVF 3G04B 3IFOB 3RX8A 1AP2B 2VTFA 2HVJB 2JB6A 4QF1A 3TYGL 1VB9A 4PRHA 4NUGH 4APQD 4GUPA 5F7MC 2XXCB 4KI1A 1CBVH 3WLWD 3GSQB 5E03A 2CO6B 3HUJA 2R1YA 1PX4A 3DO7A 5DJ6A 3HLAA 3ROOA 5TDNB 4TVPH 1I85A 3MZGB 4JFXA 3S88L 2Q76B 4RGMC 1A6ZB 1S7XB 3HG1B 2HN7B 2RFXB 2EO9A 5D9SB 4X0KA 4WDIA 2E5EA 1OGAA 3RKPA 5F89B 3OJDB 1FHGA 4AIZA 1HXYB 2IAMB 3DX9A 4MA1C 4ZOBA 1S5HA 1OWRM 1S7QA 5DS8A 1T6WA 2NPLX 2I5YL 4KKAD 3T0XA 5HD8C 1E4XL 3QQ4A 1T2QL 1U8NB 1MCOH 4BUHA 1PX3A 4LCWA 1UVQB 1JP5A 4FQCL 4LLUA 4GMSL 3PL6B 4OLZL 1QG3A 4QRPA 3L7FB 1JUFB 4ZO7A 5EU6B 1EXUA 4QEGA 3AREB 5F7DB 5A2KH 1I1FA 2NW2B 3PGDB 1TLKA 4Y1AD 1BFVL 1T7YA 4HC1H 4YBLB 3VI3E 3ZYJA 1PD6A 2DLHA 2NYYD 5ICXA 4K7PL 4KJQD 2V2XA 5K59E 4RNRB 5I16A 1YA5A 4F2MA 1OM3L 5LGJB 2X89A 3GBML 4Y19A 4JFFE 4XC1L 3TJHC 4KMQA 3KJ4C 4KXZI 4WEBL 1IKNA 4PB0H 4PJ7B 3ZDXE 5L2KD 1TVHB 4P4KB 1IC4L 1MHCB 3FTGB 2EEDA 4HG4K 2VQUA 1A7NH 5IOPA 1G7LA 3OR7B 2I27N 1QRNE 2IWGA 5IMMA 4PLOB 2NXZD 5I1HH 5FO9A 5I15L 4JFZL 4YHIA 4JVUA 5DXWA 3FJTA 4YBHA 1XIWB 4QGTA 3BPLC 1NAML 4X99B 3T2NH 4IIQC 4KXZH 1FZJA 2DMBA 2W0FA 1YEKL 1MCRA 4AMKL 5F7FA 4JDVA 5E1HB 4JHAL 4OB5L 1U91A 1ZGLA 5FYJD 5F1IB 3X11B 3BESR 4OFIA 2EYSB 3S35H 4NP4L 1A3QA 4YHNA 5HYJA 1MEXL 3VDCA 1MJUL 5DEFA 3LKRA 3OWEA 5EUKB 3KYAA 1NAMA 2C1PA 3LKPB 3TBYB 2QSCL 3L3JB 1CFTA 2D7MA 4HKXB 1YC7A 3WNKA 3WXVH 3FMGH 1R3IH 4GAFB 3NCYS 3EFDL 4F7TB 5TF1L 4M8VA 1QLRA 2HVKB 2KQMA 1VEMA 3NCJL 1QSEB 4BZ1L 1T5XB 4HEPG 1A1NB 2VUYA 1YN6B 2HT4D 2HFFA 1XR9B 2ADJB 2FZ3B 3MRKB 2Q86B 2DQTL 4NUJA 1WC7B 2X9YA 4WUKL 5KVGL 4XAKD 4RCAA 1KJ2L 5D5ME 4MJIE 1KIRB 5F8QC 4XP5L 3SGDI 4LSRH 4S1QL 3QXVA 1RU9L 4NQDA 2IQAA 5CZKA 2PO6C 4OZFG 1CXLA 4PP2A 2AXFB 1IEBB 3NPSB 1CFSB 5GSRA 1A3RL 4OFDA 5MI0C 1T80A 4KK9D 2ENYA 2R56H 4Q0XH 4W81A 5DURD 1MHPL 4W70A 1KJ2A 1WWWX 4KY1L 4L1DA 5LG1A 3TNNB 1GGTA 1CS6A 2D0GA 1QUNA 2KZ1B 4UUJB 5EBLA 4K23H 3SGDH 3WO4B 3I6KB 3RWIA 3EGSA 1KCUH 3P77B 4G42B 2J3SA 4RGNE 4GKSB 3HI5L 3HA0A 4WWKB 5D1XB 5DK2B 3OKNB 4IRJC 3A6CL 3ALWA 3QRFM 4M7LH 3KPNA 5E8PA 1QEWB 4TVPE 5GGQL 1CQYA 4QYOB 4G8GE 4O2CB 4DQOH 4Y4KA 35C8L 3EOBA 2DWEB 3RKDD 2RCSL 5J13B 1J8HD 2B0SL 4XVSH 5C0DB 1FAIH 1E6OL 1EBAA 1CTNA 4KVCH 5DJ0B 1SJXA 1LDPH 2IAND 4R2GC 5JW5B 4LVNC 3RI5F 1LE9B 1UQSA 5C0ND 3WXWH 5AWNH 4Y5YA 1KN2L 5E7BA 1SEQL 5J6GA 5HGHB 3LD8C 2JE8A 4XWOD 3O6FA 1RIVL 3FQWB 1A6UL 1F3DJ 2X7LB 3VCLA 1A1MB 1EFQA 2P5EB 2P8MA 2EYTA 4OCLC 2ESVA 3QDGA 3CFEB 4Y4HB 3GM8A 6FABH 3GSRB 5B38B 4KJPD 2NX5A 5EBMA 4O9HL 5DJ8B 4K2UL 5EZLB 5DQ9B 5H37H 1NGWA 3DMMB 3RY5A 1Q1JL 4P49A 5DJ2B 2NY1B 2Y72A 3WSQL 1T1YB 4Q7DA 2DRUA 2ZOLB 3C6LD 1ES0B 3SDXF 2CR6A 3WJLA 3PIQA 3HN3A 2MCPH 2MSPA 4JQIL 3X3FH 1YY9D 4MNHA 4PRAA 5TDPA 3T4YA 3U2SA 1Q94A 4JG0H 3UTSB 3QIWC 1WAAF 1S9WA 43CAA 5DI8B 4UNVA 4RAUB 1RURL 3JV0A 3GMRB 2DYPA 1UZ6E 5CJOL 4JFEA 2F53D 2QHLA 2GK2A 5EA0H 4UIMA 4GW4B 1RAMA 3VW3L 4Y2DD 1BIHA 1D5MB 3F7YB 4FQ2H 2MNUA 4XRCB 5FFLA 4PGCA 1H3WM 2UWEE 2ATPB 3LKNA 2P7TB 4L3ED 2D03L 2DM4A 1XCQA 4TNVK 2ED9A 5B38G 2DBJA 1ZWIA 4ELKA 5F1OB 2GAZB 2HTKD 1ONQB 1VGEH 3FB7B 5I73B 2OM5A 4UBDD 3C2AL 5E0QA 2CDEB 4QHNB 5SWSD 1QYGL 4NOBA 4MAYD 4PR5B 2X6MA 3I2CL 1MRCL 1L0XA 3QG7L 4IOFC 1CFBA 4R90L 4ZODA 2ED8A 3IETA 4XBGB 4LP4A 3ARZA 3WIIH 5I19H 3QCTL 1MCEA 4KQ3L 1TJIH 4JFOA 4LEOB 1AD0B 4P5KB 1KCRH 3TBSA 5EUOB 3H9HB 3H9SB 3Q0HA 3T0EC 2YSSB 3MV7A 3RGVD 1Q9LA 3MYJA 5IT2H 1JZ4A 1J05B 1G9ML 4LCCB 4X7DC 1I3GH 3L7EB 3QG6B 1GZQB 2P8PB 1A14L 3HS0A 1JWMA 5F9JA 3DLQR 1K5NA 4KRPC 3P0YL 3FB5A 1JTTA 4ZOCA 4LSPL 5F1NB 5GGSA 3C6SA 3OJVC 1HZHH 1UYWH 3GSWA 5JO5B 4GG6A 4D9LL 5JXEA 2IPKA 2ZG1A 4ODVL 4POZC 4XCYB 3KLHD 1B9ZA 3V8CA 3RQ3A 1H3VA 4HUKB 1GAFL 4HF5H 3D25B 4JM2F 3THMH 3N1PC 5DR5L 2BMKA 1VACB 5JW4R 4R4FL 4K8RH 4F7PB 4M7KL 4K7PY 4D0DA 4HKJA 2YD8A 4MD4A 2E9WA 2WV3A 5EO1A 4F3FB 4OAWA 2HFGH 3TO2B 4Z76B 1G9NC 4LU5H 2JIXD 2YC1B 4HWZA 2YA1A 1I1YA 4G6ML 1OLLA 4HAGA 4L8BB 3E6HA 1CFQA 3M17B 1YEIH 4GSDL 2OL3B 3QZWB 1N5AB 2VZ3A 3HR5B 3I6LE 5I1AA 3L5HA 1HDMA 1KV3A 1N6UA 5CLWA 3T65B 4TOYL 3MLSH 5KSUB 4HWBA 1NMCC 4N5ED 3D39A 2Z8RA 1MWAL 4G8IA 5IBLD 4XVJL 1CGWA 3L3OB 3MLWL 2XWTB 4FXKA 1QHPA 2VL4A 5JNYA 4LBEA 3F12A 4G9DB 1AKJB 3SKNA 5C0FA 2CDFA 5EU7C 3QHZL 4GT7A 1DFBH 1CK0L 4U1SA 3TWCH 4QWWD 2FH8A 4NKMB 4KZDH 1J11A 1PQZB 5BV7C 1ZA6A 2VLRD 1MWAA 3CJJA 5EOTB 4WCYH 5EG6C 2VDOL 3C87A 1E6JH 3UTZA 1KPUB 4QNPE 1JIBA 5DHVH 3RBSA 3WIFA 3WNLA 3GMMB 1IKFH 4UAOC 4U6XB 1AQKH 1RUPL 4NZDA 4KROC 3S7GA 3PHOA 1PG7L 4O51A 3BO8B 4Z7WB 1NSNL 2DQCH 3QFJD 3AS3A 1L9MA 1JPSH 3QCUH 1GCFA 2ED7A 2FH6A 3C2SA 3MREA 3O41B 2F8OA 2ATKA 3HAEH 3MXVH 3QZWG 4LNRA 4PGEB 4XNXH 3C60B 4KKBC 3LEYL 3QUMH 3MJ9A 4ODTH 1IGFH 2RB8A 3IGAA 3REVA 2LE9A 3HFML 2ICCA 1WBYB 4B7IA 2UZYB 3EOTH 3OKOA 5F9OH 4YLQT 4L3CA 3CH1A 3U30B 4AEHL 1FNLA 1IGJB 3I6GA 4GO6B 1VKXA 1P2CB 2NY7H 1HHIA 4FQXB 2D7TL 5GJTH 4Z95H 4CDGC 1ETZB 2EC8A 2QSVA 3T0BA 3VWJA 1PZ5A 4HSQA 4XNYH 4ZXBA 2G2RA 5C0CD 2AK4D 4IHOA 1WZ1L 1TQCC 5IEKB 2RBLA 1ZVHA 3FAWA 4TUJA 2V2WA 4ZSOA 1KLFA 1HHHA 3C8KA 1AO7E 2GHWB 3QIUA 2E8ZA 3DUUA 5DQJA 3K74B 5EWIH 1RSFA 4DKEL 3ARBA 4PUBH 3R8QA 4GXVH 1Z9SA 3OKMA 3SDAD 5SX4I 1KIQB 4Q9RL 1IM9B 5TPWH 4PLNC 5BZDA 3CXHK 4MNQD 1AE6H 3RI5K 4NQXB 4HXAH 4HT1L 4M5ZH 5D7JB 5C09B 5DJAA 1RVFL 1FGVL 1RUKL 5GS0D 1CD0A 4QOKE 1OAXH 1T21B 1JWUA 4E42B 1RUMH 1FYTD 3MV9E 1EHLH 2N1KA 1FRGH 5ITBH 3NOIA 1D6VL 5SX4H 5HVGB 1AXSB 2C7UB 3RWEA 3FT3A 2WINA 3CMGA 1V7MH 4QXTA 4YC2C 5T1LB 4Z77B 2DIJA 2XQBL 4LCIL 5HHMB 4QHLB 3ARPA 4NSKA 2WBJB 4ELMB 4XP6L 3DV4B 3RWFB 3G04A 3IFOA 1AP2A 4UV7L 2HVJA 1RJLB 3VD5A 1KYOJ 3MUY1 4ODBD 4OI8A 5LGKA 2X41A 3NH7H 4D94A 1CE1L 2XIDA 1DE4B 2R0ZL 3ARWA 3GSQA 3W2DL 4FXLA 4YE4H 4KZEH 3KPTA 5IR1B 3QI9C 1SVZA 4JFYB 5DLML 3ZYZA 2ERJB 4FN0A 5TDNA 5D7SH 5AYQA 2Q76A 1FYHB 3G6DH 2YZ1A 2KDGA 1A6ZA 1S7XA 3HG1A 2GK0B 2HN7A 2RFXA 3EUUA 4OSUL 5IQ9B 3PGFH 2WBKA 5D9SA 4B50A 1M71B 1DZBA 1INDH 1NC2D 1TNMA 3U7WL 5F89A 3OJDA 3MJ7B 4RGOH 2IAMA 1T89C 1WEJH 4FNLH 1WFUA 4X4ME 3QUYD 3ULUC 1MCKA 5DMGC 3BKCH 4Y0GA 1NBVL 3MC0A 3BXNB 4J8RB 4ZDHB 4PY7B 1U8NA 2FX8H 4NQEE 2GJ6B 3RRQA 1UVQA 3DX8A 3DUHA 2VLJB 5D7IE 1I9IL 3PL6A 1OARH 4NN6B 3L7FA 4PJ5E 2NXYB 1JUFA 2CKNA 1VPOH 5EU6A 4X80H 3KYNB 3LIZH 3AREA 5F7DA 5I71B 1BJ8A 2NW2A 2H8PB 3PGDA 2F8XC 1L7IL 1CXHA 3HMXL 3LQAC 4RWHA 3U7YL 2FWOB 1A7BA 3FOMB 4F15C 3U36B 5GGSY 2W38A 3SPVB 4F58L 3X14B 2JJWA 4RNRA 3DVFA 3GEWB 5IFHH 5MEOB 1JPTH 5LGJA 3GRWL 3BKMH 3BZ4B 2P48B 2CUIA 3PP3K 1L7TH 4PJ7A 3M1BB 1TVHA 4TPRL 4K71C 1T66D 4P4KA 4OLYH 1MHCA 1KTKE 3FTGA 2XG5A 2ZCLL 3OR7A 1UFUA 4TN9A 4XVUC 4MA7H 2VZ1A 1FP5A 3GRWA 4XPGH 1B4JL 1KUMA 3V8OA 5E8DL 4X99A 1OP3K 1NGXB 3JVGC 4AIOA 4RFOL 1IT9H 4E5XB 3WD5L 5F1IA 3AY4A 1WLHA 3X11A 4NN5B 4JVWA 2EYSA 3MSPA 2V5YA 1TJHL 1G1YA 5CD5D 5EUKA 1T0NB 5C0AB 1I3UA 2ITCB 3NCMA 5D71L 3LKPA 3TBYA 3L3JA 4HKXA 1IC5L 5DUPL 2FIKB 3NZHL 2ZCKL 2XZCH 3O3UN 4F7TA 3VFMB 5I1GH 3HKFA 4PJHF 5HXMA 4NBYB 2SEBB 2HVKA 3TZVB 5DRZB 5KJRL 1QSEA 1T5XA 5JHDE 4JY6B 1YN6A 4YFLF 1CFVH 1XR9A 2ADJA 2FZ3A 3MRKA 5ACZB 2Q86A 3G9AB 4U6VH 1WC7A 4X98B 3SDCC 2WIMA 1QFWI 1KIRA 1M7IA 5FECB 2CSPA 2BSSB 1UB6B 2DQIH 2YPLB 4IJ3B 1A7OL 3LS5L 1ZA3B 1OGTA 2AXFA 1D6EB 1IEBA 3CH8A 1CFSA 4LSQL 3VRIB 3CLEL 2GSIB 2Z91B 4P0DA 1BEYH 1KG0B 2CXGA 5IVXE 1FNSH 4OLEA 4U0QB 4JO4H 5CGYD 1H15B 3TNNA 4LKCB 1QFWH 4UUJA 3H3PH 3IDYB 1AY1L 4OLUH 1DANT 1MJJB 3O2VL 3P77A 1D5ZB 4G42A 4D3CL 1N5YH 3V4UL 2A6KB 2C3VB 4WWKA 2B5IB 3NIFE 4Y16D 5D1XA 3V4PH 3DYMA 5DK2A 4BH7B 3OKNA 1FBIL 4Q6IB 4IOIB 1Y6MR 2VR4A 3QUKB 1HQ4B 3V0VB 3U9PL 3ESUF 5KTEL 2ZKHL 3U4AA 1CXKA 5DJCB 4QYOA 4G8GD 4O2CA 3VXRB 4JQVC 3OF6D 2DWEA 3PP4L 5C0DA 3GO1H 4CN1A 1U36A 4GJTB 3TYGH 5DJ0A 2DICA 5JW5A 1UM5L 5D7KD 2A38A 1HNGA 2WK2A 5FGBC 4N8PA 3F7VB 3RIAK 1EX0A 1LE9A 5BW7C 3ZE2F 1ZHKB 3S88H 3GSOB 1BZQK 4L9LB 1F42A 5E6YA 3MLVL 3LKSB 4D9QD 5FKAA 3FQWA 2X7LA 4WO4C 4IRZH 5E94B 4FG6D 3VGAB 2P5EA 3HNTL 1BQHB 4X6CF 3S36X 4I18C 4KTDL 2IGFL 1DSFL 3AS2A 2V7NB 4U6YB 3CFEA 4Y4HA 2DS4A 2I5YH 3GSRA 5B38A 3W0WB 5CILL 1Q72H 3QO0B 1E4XH 3CDFA 2BVOB 3ZT7A 5HI4C 5DJ8A 4ZFFB 4QLRA 1T2QH 5EZLA 5DQ9A 3DMMA 4X4ZA 5DJ2A 1T1YA 4FQCH 2ZOLA 1ES0A 4GMSH 5TQ0L 1I4FA 4PJEB 2X1PA 4OLZH 3ZDYF 2AJSL 1X5IA 4BH8B 2XNAB 1GC1C 2HT2C 5A3ID 3UTSA 3OSKA 4JM2C 2X1XR 2AGJL 5F8RC 1SEBA 3V6OC 4MSWB 4CBPA 3U0TB 5DI8A 4RAUA 5GZOC 3VXMB 4NGHH 3GMRA 2X1WL 5DT1L 4CN4A 1BFVH 1CICD 4X6FB 5I6XC 3FRPG 5F6IC 2CK0L 1MSPA 4NNYB 3C8DA 2VLMD 4BSJA 1YEJH 4K7PH 3QXTA 2XZZA 4GW4A 4LSUL 1D5MA 3F7YA 4XRCA 1BQHG 3GBMH 2ATPA 4XC1H 2MQ0A 2P7TA 4KI5E 3ARDD 3WS6A 4CN6A 3CCHA 5J6HB 5ITFB 4M8QB 1IC4H 1ONQA 3D9AL 5HHOE 3FB7A 2CDEA 4QHNA 4J6RH 4WW2B 4YFDB 4PR5A 5I15H 4JFZH 4HG4J 3JV4B 2IBBA 4MJ4A 4KUCD 4XBGA 4HXBL 1NAMH 2HLAB 2P5WE 4ODWA 5C0RL 3BD5A 1YEKH 5CJXA 4ZG1A 2IBZY 4JHAH 4OB5H 5LGHL 4LEOA 4AIXA 5DD6B 4P5KA 2OK0H 1P7QD 5EUOA 1FV1B 1EV2E 3H9HA 3H9SA 3PWNB 4NP4H 2YSSA 4LLVB 1I7ZB 1J05A 1MEXH 5EU5B 4LCCA 1MJUH 3I85A 3L7EA 3QG6A 1GZQA 2P8PA 1K6QL 1MOEA 4OQ1A 3B43A 5F6HI 1M6OB 2EDFA 3C9NB 1EVUA 4G7VL 4WI2A 1BAFH 3DVGB 5F1NA 3EFDH 4CVWA 4PJGB 3CC5B 3VE0A 4M00A 3SDDB 5JO5A 4N9GB 5D2LB 2PCPB 3NCJH 4BZ1H 3O45B 3X3GL 3WBDA 1CLYL 1CDIA 2FNBA 5L6YL 4XCYA 1H5BC 4JN2A 2DQTH 1AC0A 4WFFE 3D25A 4HFUH 2A73A 4WUKH 3GKWL 2ORBL 5I0DA 1VACA 4XP5H 1YMHB 5CKGA 3NA9L 4F7PA 4S1QH 3RJQB 1AGDB 3PWVB 5IHBA 3QT2A 4F3FA 2AQ1A 3TO2A 4Z76A 3QUXD 3B5HA 3RVTC 4Z7UB 1KB5B 4H1LH 5GGRB 2YC1A 4YXKL 1MHPH 4KY1H 5I74B 2JCCB 4L8BA 3DXAD 3EDEA 2RQ8A 3M17A 4JFDD 4YZFF 2OL3A 1TVDA 3DSFL 3UAJC 2EDJA 1N5AA 3HR5A 5BW7A 1JNNL 2AEWA 4WTXA 1LK2B 3RWGB 3T65A 4DGYL 5KSUA 4UOW0 3HI5H 1GZPA 1U58B 2J8UE 3AB0B 1OGAE 3TH2T 4KC3B 3L3OA 5HVHC 5DSCB 3A6CH 3NAAL 2VXVL 4G9DA 2PXYC 1AKJA 2QJDA 2E7BA 3SKMB 2OR9H 2G5BB 3ME0A 5GGQH 3OB0H 1I7TB 1MCHA 4P2OD 1D9KD 4NKMA 4PJDF 4L4TB 1PQZA 1NCAL 5EOTA 2RCSH 2B0SH 5CEYB 1YEHH 1E6OH 1N6VA 4LCWE 3GB7B 3KYMB 4NZRL 3MXWL 1KPUA 5HSFA 3DOSA 2ZUSA 1E27B 3GMMA 4HIXL 4GKOA 4U6XA 1H3PL 4J3WA 3S5LB 4QRPE 2NQCA 3BO8A 5E9DB 2DAVA 3WUWB 3O9WD 2UV3A 1KN2H 1URLA 3MV8B 4N0CC 3O41A 4QT5B 4PGEA 2I25N 1A5FH 2D7NA 3C60A 3SO3C 4EXPX 1MQKL 1RIVH 1A6UH 3JUYA 4K9EL 4CVUA 5F3BB 4KMLB 2EDLA 1FAKT 4KTEL 5IHUL 1WBYA 5C0EB 2OI9B 4JFQB 2L0DA 2F5AL 3AFLA 4BQ9A 4GMTL 4Y19E 3A6BL 5D2NE 2O26U 1IGJA 4O9HH 1AHWC 4K2UH 1U42A 3SJVB 4UTAL 1Q1JH 4APQC 3WSQH 2AJVL 5LQBL 5H8DA 3WLWC 2FBJH 1P2CA 4MMXC 4FQXA 1ETZA 4YHOL 3CXDL 3S5LG 2YEZB 4QRSB 1X6LA 5D93C 2VC2L 2YUZA 3RAJL 2R0LL 1RURH 4P46D 3VFGL 5IEKA 4JPWL 1NAKL 1ADQL 1DL7L 4U05A 1EPFA 1W2KT 4P2QB 5GRVK 2O61B 4NT6B 4PJFE 5CJOH 4Y5XC 12E8L 3DSNA 5DEGB 3VW3H 4OI7A 3Q2CA 4KGLA 3RL1B 4GBXC 2EE9A 4TTDD 2D03H 2VLLB 7FABL 3BSZL 4F7EB 1KIQA 4KKNA 1ADQA 1EEYB 2BX5A 3QWOB 5T5FL 1IM9A 2A6JB 4R8WL 3C2AH 2OSLB 4Z7VB 3EHBD 1X5XA 1ULVA 1MRDL 4NQXA 5IB5B 1NCCL 2W1NA 1QYGH 4WGWB 1VFAB 3L3IB 2DQEL 3I2CH 4FFWD 1MRCH 4K07A 5JIIA 3QG7H 4R90H 4JAMB 2V5RA 5I1IH 1T21A 5EH1A 4E42A 1KTRL 5D1ZB 3QJHB 2Z31B 3BYTA 4KQ3H 1AXSA 2C7UA 4NWUL 3RY6C 2NYYC 2JJSC 5T1LA 5C2BL 4Z77A 5JOPD 1G9MH 1XH3A 2MQ3A 1G84A 1BJMA 3ESVF 2ARJQ 2WBJA 5EZOL 4NPYB 4ELMA 1A14H 3SO5A 3DV4A 4C54A 2HKFL 3RWFA 1CDJA 4EIGB 1RJLA 1WV7T 1KFAL 2J2ZA 2RAMA 3UO1L 3P0YH 1NEZG 1DE4A 1H3TA 2EICA 3UXFA 2VUOA 2NXZC 3KYOB 2E7HA 2MPAH 5IR1A 4GLRI 4JFYA 4V1DE 3MRIB 4Q74A 4JDTL 4D9LH 5JW4N 3DGGB 3VFNB 3W81A 3GSNL 3WMSA 3BJLA 1S3KH 4ODVH 2LVEA 2GK0A 3PUCA 3RTQB 5IQ9A 5L8JB 1AD9A 1C8PA 1OP9A 1GAFH 2J4WL 5DR5H 4AL8H 5KZCB 3MJ7A 2R69L 4LCUB 1R3LA 3MJ8B 4R4FH 3D1MC 1LGVA 2ICES 4M7KH 4DTGL 1ZAGA 3PGCB 4HIJB 3MCKB 4GLRH 2IQ9L 4H25A 5FA4B 4ZUSB 2NY6C 4P57B 3BXNA 4HIHB 4J8RA 3ARGB 3QWRA 4PY7A 4ZDHA 3TVMB 4G6MH 2YOCA 5CD3B 2GJ6A 2HMID 2DLFL 2VLJA 4PJBE 3FO1B 4GSDH 1MF2L 2PYFB 4PRDA 4OGZA 4PJ5D 4YUEL 4TOYH 4X9FA 1DANU 2HT4C 1BD2E 4JO2L 1UA6L 1MWAH 1AXTL 3KYNA 4XVJH 3MLWH 4PTUB 2FX7L 2H8PA 3DUSB 3OKKB 3B9KB 3ULVL 4N5UA 2ESVE 5AAMA 3QHZH 3QDGE 2FWOA 1BJ1J 3FOMA 3MUHL 1M7DB 3U36A 1GJIA 1CK0H 3X14A 2NX5E 3ABZA 4HEME 3AGVA 5MEOA 3VG0L 3BZ4A 2VDOH 4X83A 3LN4B 1OW0C 3FFCE 1FFNA 3CMOL 4ENED 3M1BA 5CEZD 1RUPH 4JG1H 4GRWF 5DDHA 3KPLB 1PG7H 4S11A 3PQYB 1FDLL 1KOAA 1U6AL 1MHHB 3UTTA 1GOFA 1NSNH 2K7QA 4OM1L 5HI3D 4ZUUB 3HE6D 3LQMA 5KVDL 3N85L 5BVPL 5IVOA 4D0CB 3C5ZD 3LEYH 2F19L 1NGXA 1GGCL 4AEIL 4JFEE 3H0TA 3MBEC 4E5XA 5JIPA 4O2EB 5IFJB 4K7FA 1SY6L 1FN4B 1KJ3L 4AEHH 1T0NA 4PLJD 5C0AA 4ISVB 2ITCA 4YIQB 5E2WL 4NO2B 1AFVL 4AH2A 2VITB 5KVMC 2FIKA 2D7TH 5K93A 1SY6A 2SEBA 3TZVA 3T3MF 5DRZA 2XTJE 3BW9B 3OL2A 3UMTA 4E41D 5JDJA 2CGRL 4JY6A 4WUUD 4J4PD 1WZ1H 5ACZA 4HJJL 1QSFB 4XMLL 3UX9B 2UY6A 1ZT1B 5D8JL 4X98A 3ZHLA 1MFEL 1TZIB 4HHAB 3LB6D 3MV7E 5FECA 5ESAB 4GRLD 3UTPE 4LQFL 2BSSA 3QA3A 2YPLA 1FLRL 2YPKB 5CMAB 4JFFB 4KJPC 4YHPB 2QHRL 4AJ0A 1ZA3A 3DGCR 1PEWA 5AEAA 4J3OC 4DKEH 2AJZB 5KSBF 4M61B 2NZ9D 4LVOC 3VRIA 3SE3C 2GSIA 2Z91A 1A6WL 2KH2B 1KG0A 4P2RB 4Q58C 1R5VB 4Q9RH 3WV0A 3C6LC 1H15A 3SKOB 1EDQA 1OAZL 4LKCA 3SE4C 4BK4A 1YY9C 4HT1H 4J7RA 1RVFH 2Q87A 1FGVH 1RUKH 3QWQB 4XMPL 2VZSA 1MJJA 1D5ZA 1YQVL 2R1WB 2VL5B 4EDXB 2C4FT 3CXHJ 2GKIA 3HI6L 2EDKA 2A6KA 2C3VA 3L9RB 1G7QB 1WWCA 1A7QH 3MQIA 4BH7A 5ID1B 2Z8VC 4Q6IA 4IOIA 3QUKA 1HQ4A 1D6VH 2R1XB 3V0VA 2I9LB 3K4DA 2Z92B 1MNUL 2XQBH 4LCIH 5CSBA 5DJCA 3VXRA 4S1DD 1Q38A 3DNKA 4XP6H 4BK5A 4UV7H 1C5BL 1J0JA 3BN9C 3RDTD 1F11B 4N1HB 1CE1H 3GI8L 3TN0B 2YXMA 2R0ZH 4HUVB 2YD3A 5GRUH 3W2DH 4OJFH 3F7VA 4J2XA 4MAYC 5ENWB 2WLYA 5DLMH 1V3KA 2QSTA 4GQPH 2YUVA 1CD9B 1ZHKA 2ZUQC 2BDNL 4OSUH 3GSOA 1OVZA 4FFYL 3GMLB 4L9LA 1IGTB 3LKSA 5H2BB 2DI8A 4L8SB 2CUHA 3K8KA 3U7WH 2BHUA 1U3HD 2DWDB 5E94A 2Z93B 1BQHA 2BNRD 3GHEL 3QAZC 4MJ5B 2Y25A 1K3IA 2V7NA 1QD0A 4U6YA 4PTTB 3WFCL 3W0WA 4IEFB 3QO0A 1NBVH 4CMHB 2BVOA 1JYXA 4HZAA 1QLEL 3O3EB 4YGVB 4NN7C 2IG2L 1I1AC 3MLRL 2VXQL 3OV6A 4M6ML 3VFTB 4YXLL 5IW1B 2D9CA 2R9HC 3ZDZF 3GKZA 1I9IH 2QADD 3SQOL 2AQ2A 4PJEA 4RGNB 2XNAA 4BH8A 2ICEB 4NKOB 4PLKC 4Z18A 3I50L 4W4OC 3OKLB 4P9HL 4WI7A 3RP1A 3KLHC 5E6IB 1TTUA 1JGLL 3JV6B 4MSWA 1UC6A 3U0TA 3ZZ1A 4N8VB 4EN3B 1L7IH 3SDXB 3Q6FB 5F21B 5IBUB 4X6FA 1FLTX 1BVLB 3HMXH 3T3PE 3U7YH 4NNYA 3KXFE 3O11B 1XGYH 4RRPG 3TA3B 4F58H 3P9MB 5D96B 2HFTA 5I75C 5SWZB 1J88A 2F58L 2YA2A 1SQ2N 1VFBB 5ACLA 2ITDB 4DCQB 5ITFA 4M8QA 4TPRH 4F80A 5E2JA 2F8VA 2HAZA 2LU4A 5L88L 4MHHG 2ZCLH 5EULV 4OZFH 2CMRL 4D9RD 3PXJA 1INQB 4H20H 4WW2A 4U1KB 3JV4A 1CYGA 3OJMB 5IBLC 3QIBB 5E8DH 2HLAA 4BM7A 2P5WD 1F4XL 1HEZB 1DBBL 4R26L 1MELA 4KUCF 4RFOH 4ZSOE 1KIPB 2BZDA 3PWPB 4ZAKD 3WD5H 5DD6A 4N8VG 4QWWC 1W72B 1FV1A 4PBXA 3PWNA 1Q9WA 5IBUG 4LLVA 1I7ZA 5EU5A 5AZEL 1REIA 1WTLA 3EYUH 4QHKJ 3CVHA 2XXMB 5J0BA 1CTOA 5D71H 1ZS8B 2Q8AL 1IC5H 3C9NA 5DUPH 3SE4A 1PZUB 1JBJA 4P59L 3NZHH 2ZCKH 1UJ3B 2IFFL 4FOMA 4PJGA 3CC5A 4NIKB 3SDDA 5IJKC 1Q9KA 4N9GA 4EQ2A 4G43B 5D2LA 2GITB 5C9KA 2PCPA 2EDHA 5KJRH 4LARL 3D69B 1FG9C 2B8OT 3RWCB 5E8EB 5E5UB 1RJZB 3S97C 5IHLB 1KB5L 1YPZF 1K4CB 2IPTH 1X5LA 4OKDA 2EC9U 2DD8L 1YMHA 2BHZA 1KPRB 2HT3D 4LNVA 3V4VL 1AGDA 1A7OH 3LS5H 3PWVA 4CDHA 3VDAA 1PY9A 5DTFB 1HCVA 4LSQH 1O0VA 2GY7B 4G6KL 5IHZB 1N4XL 4Z7UA 4PRHD 5GGRA 3CLEH 4X5WB 4K3EL 4L1HA 1CR9L 2CJUL 4TYUA 1S9KC 2JCCA 5T1DL 3HC3H 3C09B 2N56A 1AY1H 4NRZB 1B0RB 3I75B 3L95B 3O2VH 4D3CH 3RWGA 3V4UH 3HG1E 1U2CA 5IKCB 1U58A 2IEPA 3ZSSA 2F54B 5ACMA 5FUZH 1T1XB 1OGAD 4BZ2H 1FBIH 5DSCA 1F90L 1S9YB 2I60L 4M4PA 1EFXB 5KTEH 1Q8MA 1NC4D 2ZKHH 3SKMA 1FCGA 5B3JF 2G5BA 1IZKA 1I7TA 2B20A 4MWFB 4HPYL 4L4TA 1G7HB 1F4AA 3MV11 3ECBB 3PP4H 5CEYA 3KLAB 1Y6NR 3CX5K 4LCWD 3GB7A 3KYMA 1WCBB 1MJ8L 4XX1G 3RVXD 1E27A 3BQUD 3VRLF 4DN4L 1UM5H 3S5LA 4QRPD 3FKUS 5E9DA 3MRNB 4QNPF 5I8KL 3MNVA 4XPBL 3WUWA 5GS0C 2I9TB 4W4OA 4K3DL 4QT5A 5HVFB 4HZLB 1J0IA 5B39B 1OAKH 2YK1L 3MLVH 1LO2L 3QDJB 4DN3L 2BRRL 1ZVSB 2OCFD 1L0YA 2BFVL 1NFDA 2Y06L 4J3VA 5F3BA 3QYCA 2AXGB 3HNTH 4QXGL 4A2MA 3BH8B 4KTDH 2IGFH 3PWJB 5C0EA 5ANMB 1DSFH 4JFQA 5D6DA 2X89D 1MCQA 4Y19D 5CILH 2FB4H 2FBOJ 1VEOA 2K3TA 4G6FD 4PJ7E 3OKYA 3SJVA 5L7XH 2BY0A 1D5BB 1DQLL 2CLZA 4OCWL 3UZEA 1E0OB 4MX7B 5FUCE 5TQ0H 5IMOB 3WJJA 1B2WH 2AJSH 1LEKB 1XAUA 1LEGB 1R3KA 4OZ4B 1N2RB 1F3DH 2ZJSL 4JQXA 3OX8B 2YEZA 2AGJH 2GUOB 3PWLB 1T7VA 3MNZA 5DT1H 4HH9B 2YA0A 3K8LA 1SYVA 4RMQA 2X9WA 2CK0H 1GHFL 3LPWA 4PPTA 2O61A 4P2QA 4NT6A 5HYJD 5DVKA 1ACZA 2OX5A 4IS6B 5DEGA 3EW3B 4LSUH 4WFGD 3TNMB 3OAZK 5FM5O 3RL1A 2B4CC 1S7VB 1VFOA 1PEZA 1S5IL 2VLLA 2MKLC 4F7EA 2X4QB 3HC0A 3NGBC 1EEYA 3QUZC 3QWOA 2A6JA 2AABL 3OTTA 2OSLA 1BF2A 4HAFA 5EZIL 4NCDA 5IB5A 5JMOC 5DK0B 2NLJB 3AMLA 3RVVC 1VFAA 3GM0A 4JPVL 2EDEA 4JAMA 1MHEB 4PV8B 2NY5C 5MP6L 4HXBH 5HHNB 4AM0B 5B8CC 3QJHA 5C0RH 1XEDA 1QFUL 2Z31A 4DKDC 5T1MB 4HLJA 1FCCA 1Z9MA 5LGHH 4JRXA 3W5NA 3D6GA 4NQDD 3MA9L 2QQNL 2D4FA 4NPYA 1K6QH 1U8LB 1IJ9A 5CP3H 1MFAL 1MCCA 4G7VH 4OUOA 4XNQB 3RA7H 4PY8J 2BNQD 5DEZA 5H94B 3KYOA 4PP1D 4N8CL 3MRIA 3T8XA 3DGGA 4NM4L 2XN9B 3VFNA 1WUNT 1RZJC 4WFEE 1CGVA 4FZ8L 4HUXB 1CLYH 1T20A 3OGCB 5L6YH 3RTQA 4N0UB 4N90E 1VDGA 5AZ2L 3FHQA 4TSBL 4LCUA 3MJ8A 3H3KA 3NA9H 3L1OH 5HD8D 5FYKU 1ORSA 4Y4KD 1U8HB 4OFYD 3PGCA 3MCKA 4C4KT 5CD5C 3OZ9L 4IM8A 5FA4A 4F9LA 4ZUSA 4LFHD 4P57A 4HIHA 1R24B 3ARGA 3GSUB 3TVMA 4YXKH 3QSKB 5CD3A 3ARVA 3BN3B 1QR1B 1KTLB 3FO1A 4W4NA 2PYFA 3NABL 2V5SA 4MCYB 1BFSA 3DSFH 5C0GB 1F13A 4QOKB 1JNNH 4DGYH 3MV9B 3KPSD 2LVCA 2ZUYA 3O6FD 4PRID 4PTUA 1EA9C 3DUSA 3NAAH 3B9KA 3OKKA 1OOAA 2VXVH 1X9QA 1CD1A 2Z35B 1M7DA 3VXUD 1FVCB 2O5XL 2VKWA 4JKKA 1KC5L 4F57L 1Z9LA 3ZKNC 4NZRH 2ZPKL 2R39A 3MXWH 5SWQB 3LN4A 5IJVB 4LIQL 1H3PH 3ILQC 4WENB 3KPLA 4Y1AB 3PQYA 1GXEA 5ESVB 4NQUA 1MHHA 4NCC2 4B0MM 4M7ZC 4ZUUA 3D18B 4LVHB 1F02I 3HTLX 4XPTH 3O6ML 4JR9L 4HWUA 4D0CA 1XGPB 2DYPD 4Z7OF 4RBPH 1MQKH 5GGRY 2J6EL 2AI0L 5BRZD 3QBTB 4JFED 4NQCB 1EO5A 3NN8A 3FO9B 4BELD 4KTEH 5JXAH 1V5JA 3AROA 4O2EA 5IFJA 4GMTH 1FN4A 3VFPB 5FK9B 1RZKL 3GJFH 4BSWB 1DDHB 5JQ6L 4NQEB 1CDYA 2J6EA 4ISVA 4RAHA 4UTAH 4YIQA 1IAKB 5HDQL 4NO2A 1YYML 2AJVH 5LQBH 5B4MD 1AH1A 1S7RB 5T33L 2VITA 5LAXB 1RIUL 2X4PB 3BZFB 4PJCF 4YHOH 3CXDH 2VDKL 1K8IB 2XTJD 3BW9A 3FB6B 5IB2B 1HWGB 4HMDA 4U1NB 5B8CA 2VC2H 5ADOL 3RAJH 2R0LH 4Z9KB 1QSFA 3VFGH 3JWOL 5IM7B 5IP4A 1ZT1A 4JPWH 3D48R 1TZIA 1NAKH 1ADQH 5EUOE 4HHAA 2PO6D 4F7CB 1X5FA 3P0VL 4PJHB 3ZKXC 1FVDB 5ESAA 4LASL 3H2WA 5CMAA 4JFFA 4YHPA 2E8YA 4YDLB 1OL0A 2OMBA 1OLZA 4JGUA 2AJZA 2QQLH 4CGTA 4M61A 1W8OA 2X70B 4LK4A 4CNIB 5EOCJ 4WJ5B 1D5IL 4L5FL 4P2RA 1R5VA 3H9ZA 3D5OF 5T5FH 4R8WH 3SKOA 3FO2B 4LGSB 1MRDH 4PJIE 5JXED 1NCCH 3IDJB 5A3IC 1N3NB 5ICYB 1T04B 4ONGL 2DQEH 3ZT5A 3IDXL 2R1WA 4EDXA 2VL5A 1NDMB 2X40A 1IILE 3L9RA 1G7QA 1DQTA 5ID1A 1CICC 2R1XA 1GL4B 3FQUB 2KUTA 4NWUH 4P9ML 5L2JB 4WWID 4XNUL 2HJKB 1I3VA 2I9LA 2KQNA 1O5DT 2Z92A 5C2BH 2IH1B 1MI5D 5KVEL 3I02B 1RZFL 5EZOH 3ARDC 4R2GD 2HKFH 1Z9OA 5C0JB 3GMOB 1UWXK 1F11A 2Y23A 4MQXD 3UO1H 4KU1A 3TN0A 1AC6A 4HUVA 4YK4B 3H42H 1TVBB 1T03L 1C12B 5ENWA 2ZUUA 5FGRA 4OM0H 3D39D 3GSNH 3KGRA 2J1KA 1Z2KA 2HJFA 1EAJA 1GVIA 3GMLA 1FGNL 1IGTA 3CZJA 2J4WH 5H2BA 4RRPA 4L8SA 4P5TC 4UV4L 5T3ZH 2DWDA 3R0NA 2R69H 4NJAL 4X9GA 4AEEA 2IANB 2VWEE 1NBYB 5A43C 2J12B 4DTGH 2W0KA 4MJ5A 3IXTB 5HHXL 1VADB 3CSPA 2IQ9H 4WV1B 4PTTA 1OHQA 1RMFL 5EORL 3T0DA 1OAYL 1OT1A 3EDFA 5IVXB 3O3EA 3D3VE 3ZKQD 5EO0B 4YGVA 1FNAA 1A9EB 3VXNB 3VFTA 1JRHI 4KKLD 5IW1A 4Z7WE 2DLFH 4X6CB 1G0DA 1MF2H 4Y88A 5E56A 4ZQKA 2V17L 1P1ZB 3QIWD 3MV01 2Z4QB 4YUEH 2ICEA 4NKOA 1NUDA 3O81A 4JO2H 1UA6H 1AXTH 3OKLA 3GNML 3JV6A 1MCDA 2FX7H 3ZE1F 4EN3A 3CX2A 3SDXA 3Q6FA 3ULVH 4LF3B 1BVLA 4DEPC 3O11A 2H2PD 4NZJA 3TA3A 1QVOB 3P9MA 1IRAY 2NY3D 2PTUA 5SWZA 2H2SD 1F4WL 3DBXB 4I77L 1LK3L 1VFBA 1WQVT 2ITDA 4DCQA 2EIZB 5GS1C 4ZFOL 4JY4B 2MHAB 1PG7W 2NMSA 5HTSA 4OV6F 1FDLH 2R8SL 3VWJD 4IOFD 4X6DF 2A0LC 1FZKB 1XF2B 5FYKD 4OM1H 1W72L 4ZXBD 3UEZA 5KVDH 4U1KA 4GQ9L 1JHLL 4Y2DB 1NPUA 3QIBA 3VXPB 5J12B 2F19H 3DIFB 3EJYD 1HEZA 2Q7NA 5HHVL 3T0ED 3STZB 4AEIH 1KIPA 3K4AA 3PWPA 4IMKC 1MREL 4KJWC 1FG2B 4P2OC 3S34L 2Q3ZA 1OAQL 4WHYG 1CXFA 1KF9B 1SY6H 4HC1A 1KLUB 1KJ3H 5SWSB 4I2XB 4YDVB 4YNYB 5F1KC 1A7NL 1ZS8A 5E2WH 2VDQL 1AFVH 1T83C 4PJ8B 3B9VA 3SE8L 3QQ3B 2QV2A 5C09E 1CDUA 1UJ3A 1MVUB 2OJEB 5C86A 3O8XB 3O9WC 4P4RB 2H3NB 4XBEL 3T2NL 4G43A 2FEDC 2GITA 3D69A 3RGVB 1DBML 1ZLWH 2BOBB 3B3IB 4XMKL 3ZTNL 3RWCA 5E8EA 4HJJH 5HYIA 1RJZA 1YNLL 4Y5VB 1K4CA 5D8JH 1MFEH 4OLXL 4UI2A 1HKLL 4N1EA 5HHME 5I1CL 1FFPB 1KPRA 4LQFH 5K33A 3E3QE 1FLRH 1IEAB 2UWEA 2OTPA 5I18L 2H45A 4ELME 2QHRH 2FHCA 2BRQA 5DTFA 3BVNB 3J8F7 5HHOB 4X5WA 1A6WH 3R1GL 2WUCL 4G9FD 4DKFL 4R96B 1OAZH 1GSMA 4GKZB 4LMQI 5E8OB 3HUJF 4XMPH 4NRZA 1B0RA 3I75A 4QY8B 2FGWL 3L95A 1YQVH 5IKCA 1T7XA 3V6FB 1U8MB 2F54A 4P46C 1T1XA 1HHKB 2ADGA 2X42A 4ZS6C 4P5TA 4AK1A 1S9YA 2JIXB 3ZHKA 2C3HA 2AQ3A 3DTXB 1MNUH 5I9QB 4MWFA 4RWYL 5HVWA 4TTDC 1G7HA 1YECH 3N1MC 3ECBA 5SV4A 1XFPA 3KLAA 5T3ZE 1C5BH 3QXUA 3S35X 1WCBA 2VLJE 3VXSE 4HK3J 4OF5A 3GI8H 4DKAA 4YHYB 1ND0A 5GRWA 5KSVB 3MRNA 4PJDB 2BSTA 5EU6D 2E27L 4L8CB 2I9TA 3ARED 1ITBB 4M7LL 2BDNH 3Q3GB 1KENL 4HZLA 3RJDA 4FFYH 5IMLB 1FFRA 5B39A 5GZNC 3QDJA 1YUHB 4HV8B 2OQJB 1ZVSA 1G9EA 7CGTA 5D1QC 1VFMA 2AXGA 3VXOB 4JY5L 3BH8A 4ODUA 3PWJA 5ANMA 4U0RC 2EIEA 3ARFC 1AJ7L 3WFCH 5DF0A 3QFJB 4JKWA 1EZVX 4ACPA 1FSKC 1QLEH 3ULVE 4O2FB 3GZKA 2IG2H 3MLRH 3BGFB 4XPAL 2VXQH 4K8RC 4M6MH 4Z7QF 4YXLH 2H1PL 1D5BA 4MX7A 4JRYD 3GHBH 3SQOH 2HKHL 3LDBB 2YUWA 1LEKA 1EH9A 1LEGA 2PNDA 2X4UB 2Y6SC 3DRTA 4OZ4A 1N2RA 3MUJA 2J8UB 4XNZB 3OX8A 2WWMC 3BP4B 3BEVB 4P9HH 2GUOA 1Y6KR 3PWLA 1JGLH 4Y2OA 5IB4B 2H6PB 4EI5B 4HH9A 2YR3A 3UPCA 2CQVA 3ARRA 5JPMB 2WUBH 1WSST 2BVYA 3MFFB 3N0PB 3V5DB 5FB8B 4IS6A 3TNMA 3BI9X 4Y4FB 4RZCB 1S7VA 1WIUA 4KH2A 2Y07L 3VGGA 1B0WA 2F58H 3RPIB 1EEUA 3TBWB 4LQ1A 2X4QA 5C0CB 4G8EB 1U8JB 5LJYH 5L88H 1CXIA 2CMRH 5J11C 5DK0A 2NLJA 1QSED 1YEEL 3IFPB 4I4WB 1OY3B 1MCBA 3PHQB 4QKXB 1MHEA 4PV8A 3LKQB 5HHNA 4AM0A 3U9UB 4R97C 4DWHA 1MFNA 1BLNB 1F4XH 3HRPA 4ZPVB 1HHJB 1DBBH 2CRZA 4R26H 1IE5A 4PRNB 5T1MA 3SDAB 4R7NB 4MD5B 4HMCA 1CFNB 2YPLE 4PJ9B 5D2NB 4ORZC 4FQPA 4WU7B 4X8JB 5AZEH 3DARA 1A6AA 5HYQB 5TQ2L 1U8LA 1CIUA 4GXUM 2Q8AH 1VESA 3RNKB 3PE9A 4ENEC 5TE6L 3BPNC 1FIEA 3QI9D 1BGXL 1FYTB 1LQSR 5C92A 3MNWB 4P59H 4XNQA 2IFFH 4GW1B 5H94A 2CLVB 5HI3C 5CP7A 1DQML 1UACL 3DROB 2J5LB 1UGNA 3ULSB 5I19L 4WWKD 2XN9A 4LARH 4WFED 4HUXA 3C5ZC 4H0HB 2CH8A 3OGCA 5ISZD 1OB1B 1KB5H 3O2WH 5CIPH 2M2DA 4N0UA 5KN5A 5IWLA 4PJFB 4PV9B 2DBLL 2IC2A 5IT2L 5DMIH 3ULUD 4MXWH 2DD8H 1I3GL 3VXRE 5DUBB 3S3SA 5LXGL 4R3SA 3V4VH 1U8HA 4OZGE 4QHUB 1YYLL 1H3GA 4G6KH 3KJ6L 4JZJB 2JJTC 1N4XH 1R24A 2NTFB 3GSUA 1W0VB 3SDYL 4K3EH 5D7LD 2CJUH 4MJ2A 1QR1A 1YEFH 4LMQE 1IGCL 1KTLA 5T1DH 4M9OA 3V7AG 1N26A 4LKXB 5ILTH 4I8DA 5C0GA 2FIRT 4QOKA 4RMRA 3MLTB 3VWKC 1P4IH 3QUYB 3MV9A 4HF5L 4HUMB 2YKLL 4J4PC 3RPKA 4LPUA 1F90H 5FA3B 1NCDL 1JNJA 1UH4A 2I60H 2P5ED 1C7TA 2Z35A 5F7NC 2A83A 5DRXB 1FVCA 3W0WE 2E7CA 4HPYH 3T4AB 2VQ1B 5FGSA 3KG5A 15C8L 3TIDB 3OMZA 2AEQL 2NY1D 4OGAC 5CJQH 1MJ8H 5SWQA 5IIEB 5IJVA 5JR1L 1X5JA 5E2UL 4DN4H 4XVUD 4V1DB 4Y1AA 4QRRD 2VO5A 3CX5J 5I8KH 5ESVA 5AYUL 4H1LB 4XPBH 3UTSD 1HI6B 1Q0XL 3D18A 4JGJA 4K3DH 1N64L 4L8DB 3WCYA 3VXME 5HBBA 1XGPA 2YK1H 3BPOB 5DD5L 1LO2H 4XNMB 3TJEL 1WGOA 2BRRH 5ELIA 1IGML 4GRWB 4NFBA 5D6CB 2NY4B 2E7LC 2BFVH 2Y06H 3MRHB 2X4TB 1PLGL 4X4MA 4NQCA 4QXGH 3FO9A 5JUEL 4PJAF 4TNWF 4FQQB 3GJFK 4LRIC 4H8WL 2BCKB 3VFPA 5FYJL 5FK9A 5E4EB 4RDQG 4BSWA 3NIGE 1DDHA 3RDTC 4NQEA 3K46A 2B7DT 1ZLUK 2M1KA 2JJUA 1IAKA 4OCWH 1S7RA 1G9NH 4R7DB 5LAXA 5KS9F 3C5JB 2X4PA 4XHJD 1BD2B 1UB5B 1GGBH 3G5XB 4NQVB 2ZJSH 1K8IA 2AXJA 3FB6A 1DVFB 5IB2A 4ZUVB 2A9NL 5FAAA 4U1NA 3SDCD 1EZVY 1FC1A 1DN2A 1FPTL 2X4RB 3INUL 4HFWB 4D2NA 1G0XA 5IM7A 3EOTL 2KL6A 3UBXB 5LBSL 5GIRB 3GDBA 3HAEA 1GHFH 5IBTL 3UPRB 3H9SD 4O58L 4PJHA 2FO4B 4XCNB 1FVDA 3N9GL 4UQ2B 4NKDB 2VXSL 4P23C 1VGKB 4MXQC 5FHAL 3FFCB 3F58L 2X70A 4OIIL 4CNIA 5MEND 4WJ5A 3WFEL 1EIBA 1P9MC 2EE6A 5DVNA 43C9B 3VFSB 4JFPB 3KVQA 4PJGE 2AABH 3ARUA 3FO2A 3QXAB 5EZIH 4XNYL 5D2LE 3JTSB 1N3NA 5ICYA 1ZE3C 1MFDL 4JPVH 4GG6F 2XA3A 3H6JA 1NDMA 4M3KB 5KSBB 3PDGA 1U8IB 4A2LA 3UJIL 5DHXB 4OGYL 2JF1A 1IC1A 1K8DA 1OF2B 3JTTB 5E5MB 3FQUA 5L2JA 5GRVL 2HJKA 4X7SL 2PR4L 3EYQC 4KAQL 3MA9H 4RIRB 2QQNH 2EECA 4PUBL 2IH1A 4U1GC 5EOCL 5C08B 3UBXG 3I02A 2V9TA 2AEPL 4Z7UE 5TPWL 3D2UD 2V2TB 1CZ8H 5C0JA 2JCCE 2FL5B 3GMOA 1MFAH 2Z8SA 4Y16B 8FABB 1F6LL 1TVBA 1C12A 4N8CH 5GHWL 5CBAB 4NM4H 2Y1VA 3BH9A 4FZ8H 5CUSL 2E7MA 1HE7A 2MCG1 3TBVB 4WO4D 2DTSA 1EUUA 1AGEB 3ISWA 4ZAKC 4TSBH 3VG9B 3CK0H 1NBYA 4L4TE 1YZZA 5HI4D 2EIDA 2OTUB 3Q1SL 5IK3B 1VADA 2DM2A 2EEAA 4WV1A 3UJJL 3OZ9H 1UWEL 5CEXB 4PG9B 4YDJA 5IVXA 5LWYL 4JFHE 5EO0A 1JMXA 3NA4A 4HX1B 3VI4E 4KZEL 3VXNA 1E4JA 1HKFA 2HT2D 1S7TB 4X6CA 2W59A 3NABH 4MCZB 5DD3H 1P1ZA 1TMCB 4OQTL 3G6DL 2Z4QA 3MV8E 5IMKB 5F88A 1DUYB 2W0PA 4JREB 3C60D 1B0GB 4F9PC 2XICA 4RGOL 4XHQA 2DLTA 2C1OB 4LF3A 3T1WA 2DQHL 1LO5B 2HT3C 3CIQA 3B8SA 1QVOA 1KC5H 3T08A 2HJLB 1J0KA 5JW4Q 4F57H 4LHUD 2YWZA 3SJVE 3DBXA 1UM4H 2ZPKH 4NZUL 3ZE0F 5E8NB 1OARL 3VA6A 2EIZA 1WITA 3RZCC 4JY4A 4LIQH 1QKZL 3BGFC 2MHAA 3TPUB 4NO0A 4ZOEA 4X80L 1I85C 2GT9B 3V6BR 3BAEL 1FZKA 1YN7B 1LO3L 2GEEA 1XF2A 5F44A 2V6HA 2VKXA 2W92A 3QNZB 3ZTJG 4FFVD 4X7EC 1MCIA 3IDIB 5ICZB 2Q6WB 4DZ8B 4UT7L 1BJ1H 5CBEA 3VXPA 2J6EH 3DIFA 1U92B 2AI0H 4NNXB 4P2QE 4QCIB 4LEXH 1FG2A 1S9VB 3QPQD 4Y8DC 1KLUA 1AI1L 3V7MA 1RZKH 2X1OA 5SWSA 5JQ6H 1DP0A 4I2XA 4YDVA 4YNYA 2DI7A 4BFIB 3U4BL 1A21A 4GAYB 5HDQH 1YYMH 3IJHB 4OTXL 4MA7L 4PJ8A 3KPQB 4Z7VE 3QQ3A 5T33H 4O02L 1RIUH 3EO9L 2OJEA 3O8XA 4P4RA 2H3NA 5EU7E 3P4MB 2VDKH 1P7QB 3RGVA 1BWMA 3LN5B 4RX4A 3B3IA 5ADOH 3L3KB 4U1HB 2XACC 4Y5VA 3JWOH 2ZWLT 2BC4B 3KXFB 3WFBL 2OP4L 3QXDA 4YWGH 5T1LD 5CHNB 4GFTB 5HHMD 4LASH 1FFPA 3HPLB 1IEAA 3RVTD 3HRZB 1CLOH 2QTEA 2QSQA 2CKBB 3LQAH 4MS8C 1IKNC 4EKXA 1ZHNB 1MIML 3BVNA 4OT1L 1YPZB 5HHOA 2A6DB 2GYSA 1D5IH 4L5FH 3PV7A 4JKPL 2GQHA 4DK6A 1TXKA 4R96A 4GKZA 1KB9K 5E8OA 1DQDL 1IBGL 4ONGH 4QY8A 2IBGA 3IDXH 4U6VL 3V6FA 1U8MA 1HHKA 4M7JL 2J7LA 4HUUA 3QUXB 4I3GA 3LEVL 4JZOB 4XNUH 3DTXA 3DXAB 3GK8L 4JFDB 3WNNA 5KVEH 2CK2A 3BGAA 1RZFH 4NZTH 2J88L 3QWRD 4RMUA 5F72S 5IW6B 2B1HH 2GJ6D 2UY7A 3UYOD 5JHLH 3QFDB 4PBWD 3H3PL 2VLJD 2JKXA 1U95B 4UILL 1LNUB 4ZD3L 1J1OL 1T03H 4M5YL 3OAYK 4GG8B 4N0CD 3V0WL 2OJZL 1RPQA 4L8CA 3RUGF 1D9KB 3Q3GA 5IMLA 1NKOA 1FGNH 4WIQA 1YUHA 2F15A 3WFDL 3RVUC 4HV8A 3WO3B 4UV4H 2BVQB 3P73B 4GRMB 3VXOA 5FEBA 2BJML 4OZIF 5HHXH 1N6QL 2FEEL 3OXSB 1F8TL 2LABA 3GO1L 1OD9A 1QRKA 3MYZA 4NC0B 1RMFH 3SCMB 3QFJA 5EORH 1OAYH 1A3LL 2VAAB 1FL6B 3PNWB 3MGAA 3KHQA 4O2FA 3RZCA 1YJDC 4CADB 5FCUL 3IJSB 3PQYE 3O4LB 3UTTD 4YX2L 2V17H 4PP1C 5GS3A 5DO2D 3AUVA 4CU6A 2X4UA 3ORJA 2J8UA 2Y7QA 4TRPH 4AENB 3BP4A 1XF5B 3LSOB 3BEVA 4H26B 1WICA 4IRZL 4LIQE 5A2FA 4N1CA 1D5XA 3GNMH 2H6PA 4EI5A 3LRSB 2FJHA 1JF6A 1M1SA 4L4VB 1MCNA 5JPMA 4LAQL 1Q72L 1W0WB 3WLBB 4EBQL 4GBXD 4Y4KC 3QNXB 4ZO8A 3MFFA 4WI9A 3V5DA 5FB8A 2XI9A 1HH6B 4Y4FA 5C0AD 3WN5B 4RZCA 4BQCA 1F4WH 2VDLH 4I77H 1LK3H 3RPIA 4DOHB 1DCLA 2V9QA 2XKUA 5GGUB 5GPRA 5C0CA 2MWCA 4G8EA 3LN9A 1U8JA 5LCVL 2XA8L 2R8SH 4Y5YC 1A4KB 3MOBL 1W72H 3FN9A 3SBWA 4NGHL 2X10A 3IFPA 3IYLW 1KGCD 4I4WA 4BYHA 4GQ9H 1JHLH 3O6FC 1QSFE 3PHQA 4YPGB 5I1DB 1NL0L 3AMKA 3LKQA 3T04D 3U9UA 3S6CA 5J4MA 1TIUA 2LU7A 1BLNA 4ZPVA 1HHJA 1FE8L 1YEJL 5HHVH 2PKDA 4K94L 3SDAA 4R7NA 3DV6B 4MD5A 1CFNA 5F9WB 1MREH 4PJ9A 3V5KB 5D2NA 3JSSA 3S34H 1OAQH 2GY5A 4LPVA 2A2QT 2YRLA 4WU7A 2R23B 2VH5L 3O4OB 3PP3H 1CGXA 4RFNC 4P2RE 2VDQH 2LTQB 1EAPB 4J6RL 3WJLC 2NW3B 4K55A 1SVCP 5SV3A 3SE8H 4QHKI 1FYTA 3MNWA 2FJGB 5GGVL 4FTVB 4GW1A 2CLVA 3SGJA 4XBEH 3CU1A 2ZOKB 5FM8A 2FYYA 3DETC 4ZNCD 3ULSA 3HNVL 1DBMH 1H8SA 4OZFB 1YY8B 4XMKH 3ZTNH 1E28B 1GC1H 1YNLH 2OK0L 1OP3H 5JLZB 4KV5F 3BWAB 4U6HB 5HGBB 1LE5B 3G6AB 5JQHC 4PJFA 4PV9A 4LLDA 25C8L 4OLXH 3V5HB 4I0PB 2KZWA 3O6LL 1HKLH 3VH8G 2X4OB 5I1CH 1KEML 2NY6D 1ZTXL 5DUBA 1RUQL 3ULUF 5I18H 1EGJL 4FS0A 3JBG7 2PTTB 1BAFL 4JZJA 4ETYA 3TT1L 2NTFA 4K7PX 1W0VA 2XPGB 3R1GH 3MRLA 4WRLA 2WUCH 5B4MC 2RIKA 1K9TA 4WNQB 3U48A 2B4CL 3BDBA 4DKFH 4M1CD 4WHTB 1EEQA 1X4ZA 4KDTA 3E2HB 1EGJA 5C7XL 3FT4B 3HE7B 4MXVF 1ORQB 2XTJC 2FGWH 3MLTA 3ZKMD 3QUYA 4LRNL 4HFUL 3Q48A 1MCJA 2DN7A 3BP7B 3TT3L 3ZYOA 2NY5L 5DRXA 5GXBB 3W0WD 4RWYH 1NUGA 3T4AA 2VQ1A 5I1LB 1WCQA 4M93C 5DJXB 2XKNB 4QTIL 1KNOB 1G9MC 4V1DA 5JXEC 2AJXH 4H1LA 3IRPX 4KPHL 5HYSG 1XR8B 4DGVL 2E27H 5LKNA 1HI6A 3HZYB 1QPXA 1KENH 2XG4A 2EXYD 3L3GA 2OR8A 4XNMA 3MBED 3QCVL 2OR9L 3SDXE 3CUPB 1L0QA 2I24N 2X4TA 3MRHA 4GS7C 2DIAA 3U6RB 3WS3B 4JY5H 4FQQA 3WNPA 1YEHL 2R4SL 1AJ7H 1WAAE 4NRYB 3QJFB 5SWZE 2BCKA 3DI3B 4ODSL 2FHFA 1XGUB 4OZHF 3J7HA 3VMNA 5DK3A 1KELL 3HE6B 3BGMB 3DX7B 4XPAH 4LDLB 1BOGB 4PJBA 2ADIB 4MQXC 5BS0D 2H1PH 4XTRD 5DFVD 1QFHA 1DJSA 1KJVB 4R7DA 3C5JA 4M7LT 1ACYL 2HKHH 3U4EB 1A5FL 1BD2A 1UB5A 5E1AB 3G5XA 4NQVA 4L9DA 1DVFA 2L4OA 4ZUVA 1I7RB 2VJXA 4GKNB 2A6IB 1X4XA 2X4RA 3KPMB 4HFWA 5DC0A 4IMLA 5FYLD 3PWPE 1MCPL 3UBXA 5GIRA 3C8HA 2C3GA 4U33A 4PJCB 3UPRA 2FO4A 4XCNA 4UQ2A 4NKDA 4Y8AA 3RHWF 1VGKA 1ZK9A 4Y7MA 1BMGA 2X4NB 2Y07H 2FBJL 3FFCA 4J12A 5BCAA 3GIVB 4JRWA 4E41B 5C07B 4KKLC 1VENA 43C9A 3VFSA 4JFPA 4PRPB 4KFZC 3QXAA 3CLFL 5I8OH 1L9NA 1MIEH 3IU3A 4OF3A 4G5ZL 3JTSA 1YEEH 2D7OA 4GRLB 5KSBA 4LSTH 1U8IA 5I17B 4QRTB 1HK6A 1OF2A 5LVEA 2X44D 2VLKD 3JTTA 1CN4A 1A47A 2H2PC 4PD4K 2ZSWA 4RIRA 1J8KA 2C26A 5M7QA 2NY3C 2LQRA 4XX1E 1SJEB 2FRGP 4BKLB 5C08A 3IDMB 4JCLA 3BN9D 2HRPL 2UZXB 3FHAA 2H2SC 5M94B 2LFGA 5TQ2H 2V2TA 3TFKC 2YUXA 5TE4L 1LP9F 3TO4B 1WISA 2FL5A 5TE6H 3FZUC 3HPJB 3V6OE 4Y16A 2ZUVA 5L8LB 4JJ5B 1BGXH 8FABA 3MLZL 3VWJC 2G75B 5FHBL 5I1IL 4I9WD 3QB7C 1DQMH 1UACH 4ZXBC 2BVEA 5CBAA 1OD7A 1FL3B 2F54E 3LVEA 4PY8I 1BZ7B 3ARTA 3TBVA 4C56D 1QA9B 3EJYC 1R0AL 3PWUB 1IMHC 2DBLH 1AGEA 3QIUC 4MA3A 3KPRB 1A7RL 1V3LA 3LOWA 5DQDL 5LXGH 4L4TD 4R0LB 2O5ZH 4RAVB 2OTUA 5I8CB 5IK3A 2KKQA 3ARBC 1I1AD 3LRGA 1YYLH 5CEXA 2BVPB 4PG9A 1ITCA 3KJ6H 4JFHD 2R9HD 5IROC 3SDYH 4JPIB 2P1YA 2MPAL 1TQBC 2YBRB 4PJIB 5E9DD 1IGCH 4MCZA 4PLKD 4XXDB 5K9QI 1S3KL 1U3HB 3UDWA 5IMKA 2BNRB 1DUYA 4NKIL 2YKLH 3LHPL 1B0GA 1G7JB 3QDJE 2JK5B 1HSBB 4AL8L 4FABL 3KNBB 3MLXL 3V6ZB 3RIFF 1NCDH 5C71A 5INDB 3VFRA 4FRWA 4NM8L 2NY2C 1LO5A 5ANME 1JWSB 4U3CA 2QADB 3IJYB 1GPOH 2HJLA 4GW5B 1JHTB 15C8H 3SJVD 2AEQH 5JORB 1N59B 5E8NA 4UOJA 4G80B 4X9BA 3MJGX 3NPZB 5JR1H 5E2UH 5ECJE 1R5IB 4IRSB 4X9IA 3TPUA 4XBPB 5GGVY 4HJ0C 4PYGA 1Z5LB 3S4SB 5AYUH 2GT9A 1YN7A 5CZXC 1G0YR 1Q0XH 3QNZA 1N64H 3WFZA 4I3RL 3IDIA 3OHXB 5ICZA 2Q6WA 4DZ8A 5DD5H 3TJEH 4YHML 3V0AC 3NIDF 4B7LA 1IGMH 2IAMC 1U92A 4NNXA 1PKQB 3NFNB 3AM8A 1PLGH 2GFBB 3BE1H 5JUEH 5MHSE 4QCIA 4XCFH 2A1WL 3AU1B 1S9VA 4M48H 4H8WH 3D3VB 5FYJH 2D4DA 4JN1L 1MH5B 4JG1L 4YFLI 4BA8A 1I3RA 1YMMD 2HFEB 4BFIA 1EBPA 4GAYA 5GRJL 3IJHA 1T6VN 3PL6C 3S37H 3HZVB 1OP5K 4JO1L 3MACL 5FUOL 2HYMA 4NCC1 4JO3L 3P4MA 3AREC 3S4SG 2A9NH 3LN5A 2CKBL 1HYSD 1FPTH 4YBLC 3INUH 3L3KA 4ERSL 1QR4A 3BRGC 4JRXD 2BC4A 3KXFA 3LV3B 3X12B 5LBSH 4EZMA 3IAGC 5IBTH 5CHNA 4V2BA 1T5WA 4O58H 1X5ZA 4M6AA 3N9GH 1NBQA 2WM0A 3HPLA 2VXSH 1U3YA 3MRCA 3HRZA 4HPOL 1BQSA 5FHAH 2CKBA 2VIRB 4WHCA 5HJ3B 1JPST 4LHJB 1ZHNA 3F58H 4P4KC 4OIIH 1YPZA 4JANB 1HHGB 1C1EL 2A6DA 3WFEH 5FUCC 1TJGL 2RR3A 3GJFB 1MRFL 4CRPA 1I8IB 2ICWJ 4FA8A 1MJ7L 4DJMA 2OLDA 3VGFA 1MFCL 2DOCA 2XN9E 4RQQB 1MFDH 1XIWC 1GYAA 1JV5A 3QEQD 1PG7X 5BOPA 1IC7L 3UJIH 3G6JF 4N0UE 4OGYH 3QUXA 4G3YL 3GJEB 3AY4C 5KSAB 4JZOA 4X7SH 2PR4H 4KAQH 5TGBB 5B21A 3DXAA 4JFDA 3QEGL 5EOCH 3Q6GL 1PVHA 2G60L 2AEPH 3ARGD 3FCTB 5IROA 3TVMD 2GI7A 5IW6A 2YD4A 3D0VB 1HILB 1XGTB 4X0KB 3QFDA 3T2OA 4U7SA 1U95A 5CJ5A 2NY0B 2VABB 4I1NB 1NC4B 4GG8A 4RFEB 5GHWH 1A7QL 1G7PB 3BKJL 2ICWB 3JWDL 3MLUL 5CUSH 1CT8A 3QHFL 4P3CL 5HY9A 3B9KD 1T0MB 1RULL 3DJ9A 1LEIA 1F6AB 5KVFL 1QO3A 1SJVA 2BVQA 3P73A 3GBLA 3VGDA 3BQUB 3X17A 3D85D 1FORL 3NPSC 3Q1SH 1JGDB 1UH2A 3OXSA 3UJJH 1DEDA 1UWEH 3JWNC 3SCMA 2R2EB 1EUTA 4IDJL 2VAAA 1FL6A 1GOHA 3PNWA 5LWYH 5GRUL 1R6VA 2YD9A 5F7EL 4CADA 1YQ2A 4OJFL 4Y1AE 5GJSL 4UNUA 3IJSA 3WO4C 3O4LA 2PF6A 2P24B 4WHYH 4OQTH 2X5PA 4WWKC 5I16B 3P2TA 5D1XC 2Q20A 4CAGA 4AENA 1XF5A 3LSOA 4H26A 3RX5A 1HXYA 1DEEB 5C0BB 3LRSA 4NQCE 5L2KE 1CVSC 3GSNB 2D2OA 4L4VA 2DQHH 1W0WA 1WWAX 3WLBA 3LAFA 5IOPB 3QNXA 2DTML 4HK3N 2FLRT 3G08B 5J13C 1HH6A 3HC4L 2WP3T 2HWZL 2VDNL 3QUZD 4NZUH 3VXSB 5EZJB 4WI8A 3TIEB 5GGUA 1QKZH 3UCRA 3RVVD 1GGYA 3CFJB 5FYJE 1A4KA 3BAEH 4E9LA 1LO3H 1FJ1B 1MCLA 4KQ4L 5JA9A 5GGTL 4DAGL 3A67L 2YD7A 2XWJB 4POUB 5I1DA 4YPGA 1QP1A 4UT7H 5JZ7C 5KG9B 5IGXL 4XCCL 1RJCA 1X44A 1XGYL 1PKOA 1TNNA 1JYWA 2D31B 4PJHE 2EE3A 3DV6A 3QULB 4Y4HC 3BRDA 3JZ7A 4WI5A 5L0QB 4JFFD 3V5KA 1E4KA 1AI1H 2R23A 2IBZX 3DMMC 3HMXA 1RI8A 2NY1C 3U4BH 4H0GA 4P2RD 5J57B 1EAPA 1QRND 4OTXH 4H20L 1I9RH 2NW3A 1KSRA 4O02H 2FJGA 4XAKE 4EQ3A 1NANH 3EO9H 4FTVA 4EDWL 3O6KL 1XIWA 1KCLA 2ZOKA 2YXFA 1J10A 2IQAB 1MVFA 2RHEA 3OKDB 2QL1A 2K9UA 4OZFA 1YY8A 1E28A 5JLZA 4U6HA 3BWAA 3RIFK 5HGBA 1LE5A 3G6AA 3WFBH 2OP4H 3U0WL 3V5HA 4UDTB 1KT2B 4I0PA 3EYUL 2X4OA 5J1TC 2BNQB 3EGSB 3WS6C 3DVIA 3RGHA 4XI5C 4RGMB 1W0YT 2PTTA 1MIMH 4OT1H 2VSCA 1HIML 4OCMC 5I73C 2XPGA 4NJ9L 1WFOA 1KCKA 4HH8A 1KXTB 3TN0D 4WNQA 4JKPH 1P4BL 1UWGL 3F6IA 4MA1B 2XOTA 1A1NA 4XHJC 1DQDH 1IBGH 3HE7A 1ORQA 5HGGS 2IPTL 5EOQL 1KB9J 4MJID 5I2IB 5CJXC 1OTTC 4M7JH 4OCSL 1JN6B 2EKJA 5I1JL 3IS0X 5DUML 3VD7A 2IANE 3BP7A 1OTUD 4S2SB 4CW1B 3HB3D 3LEVH 4U31A 4LCCC 3ZE2E 3GK8H 4KKCD 1QFOA 1UQSB 3ZKND 4UU9B 2N4IA 2J88H 4PJXF 5I1LA 4XWGL 3ILQD 3SY0B 3WNMA 3HC3L 5DJXA 2XKNA 5K9KB 1UADC 3KPSB 4X6CE 3I6KA 4UILH 4PRIB 3TCLB 1KNOA 4ZD3H 3QDAA 1FIGL 4RGND 1J1OH 4GKSA 4PB9L 3MR9B 4M5YH 2FEEI 3MRDB 5CEZL 3V0WH 1XR8A 2OJZH 5FUZL 4PJEF 3ARXA 4YH6A 4BZ2L 3KS0J 3VXUB 3HZYA 4U2YA 2V5TA 4U7MA 1HYRC 3KJ4B 1RD6A 4TUKL 1QEWA 3WFDH 4TVPD 2APXA 2E6PA 3DRQB 3ZDYE 4KDWA 1Q0YL 3CUPA 3GUTB 3LZFL 3U6RA 3TA3D 3ROLB 3WS3A 4FQLH 4LFHG 2BJMH 4JZNB 4OZGB 4U1MB 1N6QH 3S3PA 1F8TH 5E99L 3F7PC 1Q94B 4MVBD 1JPGB 1XGUA 5I66B 1A3LH 4JHWL 1PDKA 4IIQB 3DX7A 1JFQH 5FCUH 1BOGA 1C5DB 1S7WB 5TFSH 1E4XI 4PJAB 1KJVA 4YX2H 5BRZB 5HGHA 1KCSL 3OKEB 3U4EA 4L4JA 5JA8B 4Z5RB 1OAKL 3UC0L 3W9EB 1A1MA 4J23A 1I7RA 3QDHA 4GKNA 3S3JA 2A6IA 3KPMA 1HH9B 4HW6A 4JE4B 5KS9B 2FR4B 2VWEC 1ZT7B 4LAQH 3P4OB 4PJCA 1NLDL 4EBQH 2FB4L 2WSKA 4QHMB 5SWSE 1J0YA 1XCTB 5L7XL 4I2XE 5HDBF 5FOBB 2X4NA 2DB8A 1ZLVK 1WT5C 3GIVA 3IETB 3UJTL 5B3NA 4E41A 5C07A 3I84A 1B2WL 4PG2A 3KHOA 3G5YB 5IW3A 4PRPA 5LCVH 1A6TB 2XA8H 1WFTA 4YO0B 4LPCA 4QRUB 4LLMB 2APBA 1OT2A 2PO6B 3MOBH 3MYJB 4GRLA 3C60C 2VXUL 4OFVA 5MI0B 1NL0H 3ZYIA 3WL9B 4QRTA 1FO0B 1JWMB 4N0RA 4WTZG 1U3ZA 1FE8H 2AV7B 1RK0B 5FF6B 4K94H 3P9WB 4PREB 2XZQL 3U30C 4BKLA 4XVTH 1SYSB 3IDMA 3B2UC 4NWTL 1Z3GL 4DUXA 2GAZA 2VH5H 3NCBB 2IPKB 1LHZA 3IAPA 4K9EC 1H8OA 4IRJB 4JPKL 3TO4A 4S0TD 4UT9L 3ZSTA 3MGTB 1JF1B 4FQXC 4JJ5A 4M1GL 4Y89A 5I30L 5GGVH 3AS0A 3P40A 2G75A 1O7VA 3SN6N 3A0OA 5DZLA 4FFVC 3HNVH 4MD4B 1FL3A 1MI5B 2BNUB 4P5TD 1BZ7A 5C6TL 1AD0A 1QA9A 1QPPA 2APTA 5IVNA 4YZFE 1WJ3A 1I1YB 4R2GB 3PWUA 25C8H 4LVNB 1N0XH 4BFEA 3O6LH 2AK1L 1HQRB 3KPRA 2EH8L 3NCYP 3WKNA 1KEMH 3QPQC 1ZTXH 4O5LL 4QO1A 1RUQH 4R0LA 1JL8A 4RAVA 5I8CA 1EGJH 3DVNB 1HDMB 3LD8B 3S8WA 2BVPA 3RA7L 1RFDL 3TT1H 5HPMB 4JPIA 2B4CH 2YBRA 4PJIA 5D7JC 2R4RL 3SGKA 4PJDE 5J3HD 2YRPA 4XXDA 1U3HA 4PGBB 4WVRA 1CL7H 3G5VB 5CP3A 5C7XH 1NGQL 2BNRA 3EBAA 4YHKL 4UB0H 4LRNH 2VLRE 3K2UL 3QDJD 1G7JA 2JK5A 1HSBA 3FQRB 3KNBA 3V6ZA 3L1OL 5F70A 4HWEL 4OD3L 1P53A 5INDA 3TT3H 3RNQB 5A16B 2NY5H 3MLYL 1JWSA 1NFDF 3E3QC 3E6FB 1V8HA 2WBJC 4LSSL 5CIPB 3QFJE 3IJYA 3QIWB 4YDIL 5I8EB 3MREB 4GW5A 3P11L 1JHTA 3F62A 5JORA 2P46B 4XPFL 4PFEA 3QZWA 4G80A 4QTIH 5CZVL 2A0LD 3I6LD 4GRWH 1R5IA 4J3UA 4IRSA 4XBPA 2GW5A 1Z5LA 3S4SA 2ERJC 4NYLB 4KPHH 4DGVH 3QDMB 1MLCB 1VEPA 2XWTA 3BEWB 4XAWL 3OHXA 1FQ9C 1EHAA 3QCVH 4KJWD 3NFPB 1RZJH 3NFNA 1F3RB 3C08L 2GFBA 3UBXI 1DTUA 1T3FB 2VXTL 1U0QA 3AU1A 2R4SH 3LKOB 1AR1D 1A6PA 1CVRA 3Q5OA 1QLFB 3STLB 3D3VA 4ODSH 1M4KA 1WT5A 3UYPA 1KELH 2HFEA 1DBJL 3QEHB 3IVKB 4Z7WA 5C0CE 2KPNA 2DIBA 5HGDB 3HZVA 1DR9A 1M05B 4NN6C 2HLFD 4I3SL 2FEDD 4XPTL 1ACYH 2NXYC 3T0EB 2FX9L 1CI5A 4UOW1 5JIKA 1SHMA 2QQKL 5I71C 2ID5A 1I8LA 4R9HA 3CSYB 4UNTA 2JB5L 2R29L 2FJFB 5D4QA 3ZO0A 5JXAL 1INEL 2NR6C 3DO3A 4KRPB 5IB3B 1RUAH 4U1JB 1MCPH 3LV3A 3X12A 1VFUA 5KAQF 4Z7NF 4MNQE 1JNLL 1UZ8B 2R15A 2W91A 3EOYG 5BQ7B 2VIRA 2DJUA 5HJ3A 3ULVC 3V7AE 1JWUB 4X4YB 4JANA 1FYTE 1HHGA 4YAQB 1UKTA 4N0YL 5FGCB 1UM6L 3GJFA 1I8IA 5DO2C 5DJDB 4X5LA 3ETBF 3CLFH 5DMKB 4G5ZH 1BBDL 4ZS7L 4ZS6D 3AC0A 4NSKB 3U0PB 4G6JL 1EEZB 1AO7D 3KR3L 3GJEA 5IQ7L 4NN5C 5KSAA 1WWBX 4K3JL 1MQ8A 3FFDB 4G9FB 5TGBA 4P48A 2QQLL 2X09A 1NEZB 1BFOB 3BIKB 3EJJX 3OAZH 1NMCB 2HRPH 4WW1B 4PD4J 3FCTA 3N1GC 5AAWA 4X7FC 5TE4H 4OF0A 3D0VA 1HILA 3DHMA 1XGTA 5D7JA 5C09A 1F58L 5DC4B 3GFUA 1KEGL 3MLZH 3K0WA 2VABA 5FHBH 3TZVC 1EJ6A 3QH3B 4JVPA 4QOKD 1AGBB 1IAIL 1NC4A 3M8OL 4RFEA 2VZOA 3MV9D 1G7PA 5BV7B 4OF8A 5GZND 1GIGL 2ICWA 2YRZA 2ADFL 4EIZC 2E3VA 3CFBB 4U6TA 5D1QD 3CSBA 1R0AH 1T0MA 4UAOB 2H32B 4KROB 1NCNA 3TF7C 3ARFD 3DX8B 4QHLA 1F6AA 3EYOB 1A7RH 3GI9L 1JMZA 4I0KA 3BQUA 4IJ3C 5DQDH 3ZTJH 3RUGB 1JGDA 5T1KD 3EYSL 3WHXB 5FKPB 3AVEA 1AXIB 3PABB 4FFZL 2R2EA 4K8RD 5J1AB 3H42L 3KYKH 4KMTL 1GGUA 1L6ZA 4MB5A 4FQIL 4QTHB 2Y6SD 4OM0L 3IDYC 4OZIB 3BIBX 2P24A 2WWMD 5FM5M 3IRZA 2B5IC 1M71A 1ZGLP 1WZMA 1BQLL 3FONB 4JKMA 4NKIH 3LHPH 4Q6IC 2CLRB 5T3ZL 4LPXA 4FABH 2YPVL 4GRWE 1NMAL 3MLXH 1DEEA 4XZUB 5C0BA 4CJ1A 5JTWA 2C9AA 1SBSL 1V7NL 4NQCD 4I48B 1J7VR 3GSNA 4NM8H 3EAKA 3MOAL 5K9JL 4D8PB 4JRYB 4ETQB 4TSAL 3G08A 2XKSA 4NQED 1TQCB 3IAQA 3VXSA 3MRPB 2DL2A 3ARQA 5EZJA 3IDNB 2WIIB 3TIEA 4RDQF 4M1CC 1X5AA 2YD2A 3BUTA 5FDWB 3CFJA 3WUZA 2ZG2A 2ZSVB 1QBBA 3ARYA 5FIEA 3TM6A 1FJ1A 1WBZB 1E4WL 4U1IB 3ZKMC 2AEIT 1CDCA 4L9LC 2XWJA 4I3RH 4M9PA 5KG9A 1DBKL 4YHMH 5KANG 3VGAC 3SPVA 1IFHL 4HIIB 1LMKA 2D31A 3VI3F 5SX5K 1I8KB 3QULA 1X5HA 5EBWB 3T3ME 3EFFB 2A1WH 5K59F 1IGIL 4X6EB 4W6XB 4JN1H 1MY7A 2D7QA 1ZT4B 4NBXB 2G5RA 4XC3L 3ZDXF 5GRJH 4F33B 2F9BT 5GRYA 4JO1H 2AAVA 4PS4L 4YC2B 3MACH 4LLQB 5FUOH 1M7IB 5DHYB 1U3JA 1YJDL 1FH5L 4JO3H 5KSBE 1OGTB 2BP3A 4BZYA 2EXYC 3OKDA 2CKBH 1EMTH 1TDQA 2BHYA 4ERSH 4NHCL 1QOKA 1K85A 4QXUL 4ZNEE 4UDTA 1KT2A 3QI9B 5C08E 4P9HC 4C57C 3FRUB 4NO5B 4M6OL 2BNQA 2LAAA 4HPOH 2EH7L 3WKML 1C1EH 3MGOB 3VFMA 4XTRC 5DFVC 5ISZB 1TJGH 4GAJL 4LCYB 1MRFH 4WW2C 4LSDA 5E2TL 3VWKD 1EO8L 5JHDD 1MJ7H 1O7SA 1MFCH 4LPWA 5FXCH 3WFHB 1IC7H 3MOQA 3UZQA 4OFYA 2VMFA 3TBTB 3F8UB 5I2IA 2V9RA 4G3YH 1JN6A 1UB6A 1RZIB 4P5MB 5D5MF 3N1QC 4OGXL 4S2SA 5D7LB 4CW1A 5D7KE 3MUZ1 1D6EA 5DGQA 1LO4L 3QEGH 1GOGA 2Q8BL 3Q6GH 2G60H 4I5BB 4OGAD 4UU9A 3JUZA 3SKJL 4TSCL 4ONHB 3SY0A 5K9OB 5K9KA 4D9QE 3ELAT 4DZBB 4OCXL 3KPSA 5FKAB 4PRIA 3B2VL 3SDDC 3TCLA 3SGEI 2IF7A 4F15B 4DGIH 3LEXB 3MR9A 3GSXB 4LLYB 2GJJA 3MRDA 3CAFA 1JZ8A 2D7PA 2MJWA 3BKJH 3JWDH 3MLUH 3VXUA 5E08H 3VXTB 2R2CA 3QHFH 4P3CH 4NDMB 3W11D 4MQTB 4F7MB 2AJYL 3OQ3B 3ZDZE 3WEXB 4K71B 1RULH 3FQTB 3LH2H 3DRQA 4HBCL 3GUTA 4DFIA 5KVFH 1JHKL 3SGEH 3ROLA 1YECL 1FORH 1I4FB 3GGWB 4JZNA 4OZGA 4U1MA 4QRRB 1Y18B 1ERNA 3RY4A 1JPGA 3RWDB 5I66A 4IDJH 5IEHB 5I74C 4IIQA 1SEBB 1UWXH 1I9JL 5F7EH 5GISL 2WW8A 4NO0D 2XZAL 5GJSH 1ZANL 1C5DA 1H3XA 4OD2B 4EOWL 5GS2H 1S7WA 4S1SL 4PJAA 4S1RL 2E6QA 3RVWD 5BRZA 3OKEA 2VLME 3FRPA 4HKBB 4Z5RA 2VISB 4OZHB 3AB0C 2DM3A 4NFDA 4OCYL 4WTZA 5FV2A 3W9EA 2OR7A 3CCHB 4AY0A 4XP1L 1HH9A 3EOAB 2APFA 5E70A 5KS9A 2FR4A 1ZT7A 3P4OA 4P23D 4MXQD 1G6RB 4MLIA 4ZFFA 2DTMH 3PHSA 4QHMA 1JZ2A 1XCTA 1X5KA 2NCMA 5FOBA 3HC4H 5D70L 2HWZH 2VDNH 3WDIA 3GHBL 4PJ8D 4ODWB 3SDCB 4C55A 1FO0L 3G5YA 3O8XD 4UTBL 1A6TA 4YO0A 5IUSA 4QRUA 4LLMA 4KQ4H 2PO6A 3S96B 3PDOB 5GGTH 4DAGH 3VXMA 4Q9QL 3A67H 4RX4D 4YBQD 5IGXH 2AVGA 2WUBL 4XCCH 3WL9A 4RMWA 5BZWB 1FO0A 2BY1A 4KGJA 2AJUL 3EYQD 3HI1B 2AV7A 1RK0A 1UZ6F 5FF6A 2OI9C 1KCVL 5D6DC 4LL9A 5MENB 4Z6AT 1QBAA 4KI5D 4PREA 3VE0B 5CSGA 4PGJA 1SYSA 2EYRB 5J6HA 5IV2B 2UWEF 4NHUB 1YPZE 5HHOD 5IESL 4IRJA 4JN2B 3MGTA 1JF1A 4RA3A 2BY2A 3WJJC 2IPUK 2A73B 1JZ7A 2DQJL 4OIAA 4EDWH 5C1MB 3O6KH 4JQXC 4CMMB 2B1AL 4ZFOB 4FMFA 1ED3B 3IFLL 1UCBH 4LGPB 1MI5A 2BNUA 1LP9B 4HWBL 2P43B 3H3BC 1VCAA 3D2UB 4WTWA 1P4LB 4HULB 3U0WH 1UEYA 1BVKB 2Y36L 4X4XB 1HQRA