2FJLA

Solution structure of the split ph domain in phospholipase c-gamma1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
150
structure length
150
Chain Sequence
SIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASGSTELHSSLEVLFQGPNPAILEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSISMPSVAQWSLDVAADSQEELQDWVKKIREVAQTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase ga
publication title Structural Characterization of the Split Pleckstrin Homology Domain in Phospholipase C-{gamma}1 and Its Interaction with TRPC3
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 13
structure length 150
sequence length 150
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2006-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2fjlA00
2LYDA 2YT1A 1RRPB 1FHXA 2L2IA 1N3HA 3ODWA 2HE7A 2DHKA 4TKNA 2RLOA 3SNHA 1W1DA 1V5PA 2PZ1A 1XCGA 2EC1A 4HAWB 3DXEA 3OANA 3MDBC 4A6HA 1LW3A 2COCA 2DYQA 1Z87A 5JHHA 2YT0A 2P0DA 1DYNA 1J0WA 3GYOA 3D8FA 4MY6A 5D3WA 4D0NB 2UVMA 2DKPA 1P6SA 4DX8A 4F7UP 4DXAB 2CODA 2P0HA 4HB2B 2RUKB 3BJIA 2DHIA 2DYNA 2X18A 4WSFA 1GC6A 2D10A 3CIKA 1WGUA 2DFKA 1W1HA 3ODXA 5FI1A 1OQNA 3SO6A 2YS5A 2D11A 1V5UA 3A8QA 2AEHA 2GJYA 3HW2B 4GMVA 1KZ7A 1ZVRA 2MWNB 4HATB 2Z0QA 3KRXA 2QKLA 1ZSQA 3A8PA 1DDMA 1E5WA 1NTYA 1DDWA 4ZRIA 2IYBA 2P8VA 1XD4A 2M14A 1QQGA 2RSGA 2XQNM 4EMOA 2EMSA 5D3XA 4PNKA 1QC6A 1ZC3B 5J3YA 2LOXA 4EKUA 2R0DA 4K2OA 1DBHA 1IRSA 1KZGA 4NY0A 3UZTA 2GS0A 4PQ0A 1XX0A 4GZUA 2MDXA 1UNQA 1K5DB 1AQCA 3GYPA 2I5CA 1Y19B 3G9WA 1U29A 1ISNA 5FI0A 2LKOA 5EFXA 2ADZA 4WVFB 3BINA 1EF1A 1WI1A 3TW1A 4CHMA 2CY4A 3FM8C 1U5GA 4GXBA 2ROVA 3IVFA 3HK0A 2Z0PA 3P7ZA 1NU2A 1WJ1A 2UZSA 1MK9B 3SYXA 3U7DA 2YF0A 2DN6A 2YS3A 4Z2NA 1UEFA 3PSCA 2LG1A 3PVWA 1BWNA 4K81A 3HQCA 3X23A 5KQ1A 2OTXA 5HE2A 1PFJA 1GC7A 4HAYB 3PVLA 2D9XA 1FB8A 2RVBB 1FGZA 1U2BA 1H4RA 3MPXA 1P3RA 3KSYA 1M7RA 3TFMA 3A98B 2J0JA 2D9ZA 1XR0B 2DX5A 3PEGA 1MIXA 2ELBA 2DLWA 2Y7BA 1WJMA 4GMXB 3M1IB 5DI9B 1OY2A 3O96A 4Z2MB 1DDVA 1Q67A 3ZDTA 1U5FA 2COFA 4KVGB 1BTKA 4TYZA 3TO1A 3KY9A 1V5MA 5DHFB 2YS1A 5J3TA 2CY5A 2P0FA 4EJNA 1UNRA 5JHGA 2MKRA 4XWXA 2J59M 4ZRJA 1MPHA 3SUZA 4HB0B 3DXDA 1OMWA 5DIFB 1PMSA 3F5RA 1XODA 3PVUA 5C5BA 3PZDA 2UZRA 3CXBB 2ELAA 1UPQA 2CAYA 4HAZB 4B6HA 2M38A 1FHWA 3F0WA 1EVHA 1UNPA 1EAZA 2ZPYA 1TJ6A 4ZRKA 1AWEA 1MKEA 2I1KA 2K2UA 2AL6A 3ODOA 3TCAA 4KAXB 2OQBA 2IFSA 4KHOA 1X11A 4Y94A 1TQZA 1MK7B 1X1GA 2EJ8A 2BCJA 4C0AA 4A6FB 1U5DA 1WG7A 1EGXA 1WGQA 5HE0A 5C6RA 1W1GA 2L1CA 2DKQA 3FEHA 3LJUX 3WYFB 4HB3B 4HDOA 2VKIA 2YVCA 4HAVB 2Z0OA 2G35A 4P7IA 4A6FA 3D8EA 3ZVRA 2DHJA 4YONA 1Y5OA 2I1JA 2Y8GA 3KZ1A 4IFSA 1FHOA 1U27A 2W2XC 2Q13A 5L81A 1V88A 3AU4A 2D2QA 1MIZB 5C16A 1KI1B 4DX90 4HAUB 2EMTA 4MT7A 4A5KA 2HTHB 3P6AA 3VIAA 2VRWB 3AU5A 3WA0A 1WVHA 2LOZA 5C79A 2DTCA 4KHAA 4F7GA 2Y8FA 3U8ZA 4HAXB 2DX1A 5LOPB 2VSZA 1ZM0A 1DROA 4F7HA 2D9YA 1TXDA 1NI2A 1U5EA 3QIJA 1BAKA 2W2XD 1X86A 1V89A 2RGNB 2J0MA 3ULBA 2MFQA 3ML4A 2COAA 2QKMA 1NTVA 2YSZA 3SV1A 3N7CA 3NSUA 2J0KA 5C5BB 5JLJB 1B55A 2I5FA 5D3YA 4DBBA 3V5WA 1MAIA 3QWMA 2E2XA 4HDQA 1FOEA 1K5GB 5D27A 4IAPA 4YL8A 5CLQB 4A6KA 5HE1A 5DH9B 2N0YA 5J3QA 3DXCA 4NSWA 2V76A 4WJ7A 2KCJA 1RJ2A 4K17A 3VOQA 4L6EA 5LONB 2D4QA 2LULA 2W2WA 2D9WA 1H10A 2N23A 4GN1A 3KRWA 4H8SA 2FJLA 3T06A 1XKEA 2CRFA 5CLLB 2D9VA 1UPRA 4K2PA 5HE3A 3FSSA 5GOWB 5JP4A 5KCVA 1M7EA 1I2HA 2NZ8B 5D3VA 4KHBB 2JP2A 2K00A 2R09A 3D8DA 1P5TA 2YRYA 4HHVA 3PP2A 4CYEA 1X1FA 1FAOA 2H7EA 3QBVB 4CHJA 2ROZB 4GPTB 4HB4B 3ULCA 2K2JA 1LB1A 1BTNA 2KUPA 2DA0A 1SHCA 4MK0A 2RNRB 4IOYX 2H7DA 1FGYA 1X05A 1PLSA 5KQ4A 2NMBA 3PG7A 2GCLA 2GCJA 3TVVA 4BBKA 2KGXB 1J19A 3RCPA 3AJ4A 1ZC4B 1SGHA 5DHAB 1V61A 1GG3A 1I7AA
chains in the Genus database with same CATH superfamily
2LYDA 2YT1A 1RRPB 1FHXA 2L2IA 1N3HA 3ODWA 2HE7A 3A58A 2DHKA 4TKNA 2RLOA 3SNHA 1W1DA 1V5PA 2PZ1A 1XCGA 2EC1A 4HAWB 3DXEA 3OANA 3MDBC 1MI1A 4A6HA 1LW3A 2COCA 2DYQA 1Z87A 5JHHA 2YT0A 2P0DA 1DYNA 1J0WA 4D6WA 3FVCA 3GYOA 3D8FA 4MY6A 5D3WA 4D0NB 2UVMA 2DKPA 1P6SA 2Z14A 4DX8A 4F7UP 4DXAB 2CODA 2P0HA 4HB2B 2RUKB 3BJIA 2DHIA 2DYNA 4QJ4B 2X18A 4WSFA 1GC6A 2D10A 3CIKA 1WGUA 2DFKA 1W1HA 3ODXA 5FI1A 1OQNA 3SO6A 2Z59A 2YS5A 4GOUA 2D11A 1V5UA 3NWAA 3A8QA 2AEHA 2GJYA 3HW2B 4GMVA 1KZ7A 1ZVRA 2MWNB 4HATB 5I2SA 2Z0QA 4DIXA 3KRXA 2QKLA 1ZSQA 3A8PA 1DDMA 1E5WA 1NTYA 2RRFA 1DDWA 4ZRIA 2IYBA 2P8VA 4GNKB 1XD4A 2M14A 1QQGA 2RSGA 2XQNM 4EMOA 2EMSA 4QJ3B 5D3XA 4PNKA 1QC6A 1ZC3B 5J3YA 2LOXA 2NBVA 4EKUA 2R0DA 4K2OA 1ZYIA 1DBHA 1IRSA 1KZGA 4NY0A 3UZTA 2GS0A 4PQ0A 1XX0A 4GZUA 2MDXA 1UNQA 1K5DB 1AQCA 3GYPA 3NW8A 2I5CA 1Y19B 3G9WA 1U29A 1ISNA 5FI0A 2LKOA 5EFXA 2ADZA 4WVFB 3BINA 1EF1A 1WI1A 3TW1A 4CHMA 2CY4A 3FM8C 1U5GA 4GXBA 2ROVA 3IVFA 3HK0A 2Z0PA 1NU2A 1WJ1A 2UZSA 1MK9B 3P7ZA 3SYXA 3U7DA 2YF0A 2DN6A 2YS3A 4Z2NA 1UEFA 3PSCA 2LG1A 3PVWA 1BWNA 4K81A 3HQCA 3X23A 5KQ1A 2OTXA 2ZKMX 5HE2A 1PFJA 1GC7A 4HAYB 3PVLA 2D9XA 1FB8A 2RVBB 1FGZA 1U2BA 1H4RA 3MPXA 1P3RA 3KSYA 3NWFA 1M7RA 3TFMA 3A98B 2J0JA 2D9ZA 1XR0B 2DX5A 3PEGA 1MIXA 2ELBA 2DLWA 2Y7BA 1WJMA 4GMXB 3M1IB 5DI9B 1OY2A 3O96A 4Z2MB 1DDVA 1Q67A 3ZDTA 3DCXA 1U5FA 2COFA 4KVGB 1BTKA 4TYZA 3TO1A 3KY9A 1V5MA 5DHFB 2YS1A 5J3TA 2CY5A 4L1RA 2P0FA 4EJNA 1UNRA 5JHGA 2MKRA 4XWXA 2J59M 4ZRJA 1MPHA 3SUZA 4QJ5B 4HB0B 3DXDA 1OMWA 5DIFB 1PMSA 3F5RA 1XODA 3PVUA 5C5BA 3PZDA 2UZRA 3CXBB 2ELAA 3OHMB 1UPQA 2CAYA 4HAZB 2R2YA 4B6HA 2M38A 1FHWA 3F0WA 1EVHA 1UNPA 1EAZA 2ZPYA 1TJ6A 4ZRKA 4HSIA 1AWEA 1MKEA 2I1KA 2K2UA 2AL6A 3ODOA 3TCAA 4KAXB 2OQBA 2IFSA 4KHOA 1X11A 4Y94A 1TQZA 1MK7B 1X1GA 2EJ8A 2BCJA 4C0AA 4A6FB 1U5DA 1WG7A 1EGXA 1WGQA 5HE0A 5C6RA 1W1GA 2L1CA 2DKQA 3FEHA 3LJUX 3WYFB 4HB3B 4HDOA 2VKIA 2YVCA 4HAVB 2Z0OA 2G35A 4P7IA 4A6FA 3D8EA 3ZVRA 2DHJA 4YONA 2KIEA 1Y5OA 3HIEA 4KHBA 2I1JA 2K49A 2Y8GA 3KZ1A 4IFSA 1FHOA 1U27A 2W2XC 2Q13A 5L81A 1V88A 3AU4A 1T77A 2D2QA 1MIZB 5C16A 1KI1B 4DX90 4HAUB 2EMTA 4MT7A 4A5KA 2HTHB 3P6AA 3VIAA 2VRWB 2Z4DA 3AU5A 3WA0A 1WVHA 2LOZA 5C79A 5IRSA 2DTCA 4KHAA 4F7GA 2Y8FA 3U8ZA 4HAXB 2DX1A 5LOPB 2VSZA 1ZM0A 1DROA 4F7HA 2D9YA 5I2MA 1TXDA 3B77A 1NI2A 1U5EA 3QIJA 1BAKA 2W2XD 1X86A 1V89A 2RGNB 2J0MA 3ULBA 2MFQA 3ML4A 2COAA 2QKMA 1NTVA 4OT1A 2YSZA 3SV1A 3N7CA 3NSUA 2J0KA 2Z13A 2YT2A 5C5BB 5JLJB 3U12A 1B55A 2I5FA 5D3YA 4DBBA 3V5WA 3HSAA 1MAIA 3QWMA 2E2XA 4HDQA 1FOEA 5M4YB 1K5GB 5D27A 4IAPA 4YL8A 5CLQB 4A6KA 5HE1A 5DH9B 2N0YA 5J3QA 3DXCA 4NSWA 2V76A 4WJ7A 2KCJA 1RJ2A 4K17A 3VOQA 4L6EA 5LONB 2D4QA 2LULA 2W2WA 2D9WA 1H10A 2N23A 2KUQA 2K8EA 4GN1A 3KRWA 4H8SA 2FJLA 3T06A 5LG4B 1XKEA 2CRFA 5CLLB 2D9VA 1UPRA 4CSQA 4K2PA 5HE3A 3FSSA 4OSNA 5GOWB 5JP4A 5KCVA 1M7EA 1I2HA 2NZ8B 5D3VA 4KHBB 2JP2A 2K00A 2R09A 3D8DA 1P5TA 2YRYA 4HHVA 3PP2A 4CYEA 1X1FA 1FAOA 2H7EA 3QBVB 4CHJA 2ROZB 4GPTB 4HB4B 3ULCA 2K2JA 1LB1A 1BTNA 2KUPA 3NWDA 2DA0A 1SHCA 4MK0A 2RNRB 4IOYX 2H7DA 1FGYA 1X05A 1PLSA 2FJUB 2KIGA 5KQ4A 2NMBA 3PG7A 4QXAB 2GCLA 2GCJA 3TVVA 4BBKA 2KGXB 1J19A 3RCPA 3AJ4A 2KR0A 1ZC4B 2GUMA 1SGHA 5DHAB 1V61A 1GG3A 1I7AA
chains in the Genus database with same CATH topology
2LYDA 2YT1A 1RRPB 1FHXA 2L2IA 1N3HA 3ODWA 2HE7A 2DHKA 4TKNA 2RLOA 3SNHA 1W1DA 1V5PA 2PZ1A 1XCGA 2EC1A 4HAWB 3DXEA 3OANA 3MDBC 4A6HA 1LW3A 2COCA 2DYQA 1Z87A 5JHHA 2YT0A 2P0DA 1DYNA 1J0WA 3GYOA 3D8FA 4MY6A 5D3WA 4D0NB 2UVMA 2DKPA 1P6SA 4DX8A 4F7UP 4DXAB 2CODA 2P0HA 4HB2B 2RUKB 3BJIA 2DHIA 2DYNA 2X18A 4WSFA 1GC6A 2D10A 3CIKA 1WGUA 2DFKA 1W1HA 3ODXA 5FI1A 1OQNA 3SO6A 2YS5A 2D11A 1V5UA 3A8QA 2AEHA 2GJYA 3HW2B 4GMVA 1KZ7A 1ZVRA 2MWNB 4HATB 2Z0QA 3KRXA 2QKLA 1ZSQA 3A8PA 1DDMA 1E5WA 1NTYA 1DDWA 4ZRIA 2IYBA 2P8VA 1XD4A 2M14A 1QQGA 2RSGA 2XQNM 4EMOA 2EMSA 5D3XA 4PNKA 1QC6A 1ZC3B 5J3YA 2LOXA 4EKUA 2R0DA 4K2OA 1DBHA 1IRSA 1KZGA 4NY0A 3UZTA 2GS0A 4PQ0A 1XX0A 4GZUA 2MDXA 1UNQA 1K5DB 1AQCA 3GYPA 2I5CA 1Y19B 3G9WA 1U29A 1ISNA 5FI0A 2LKOA 5EFXA 2ADZA 4WVFB 3BINA 1EF1A 1WI1A 3TW1A 4CHMA 2CY4A 3FM8C 1U5GA 4GXBA 2ROVA 3IVFA 3HK0A 2Z0PA 3P7ZA 1NU2A 1WJ1A 2UZSA 1MK9B 3SYXA 3U7DA 2YF0A 2DN6A 2YS3A 4Z2NA 1UEFA 3PSCA 2LG1A 3PVWA 1BWNA 4K81A 3HQCA 3X23A 5KQ1A 2OTXA 5HE2A 1PFJA 1GC7A 4HAYB 3PVLA 2D9XA 1FB8A 2RVBB 1FGZA 1U2BA 1H4RA 3MPXA 1P3RA 3KSYA 1M7RA 3TFMA 3A98B 2J0JA 2D9ZA 1XR0B 2DX5A 3PEGA 1MIXA 2ELBA 2DLWA 2Y7BA 1WJMA 4GMXB 3M1IB 5DI9B 1OY2A 3O96A 4Z2MB 1DDVA 1Q67A 3ZDTA 1U5FA 2COFA 4KVGB 1BTKA 4TYZA 3TO1A 3KY9A 1V5MA 5DHFB 2YS1A 5J3TA 2CY5A 2P0FA 4EJNA 1UNRA 5JHGA 2MKRA 4XWXA 2J59M 4ZRJA 1MPHA 3SUZA 4HB0B 3DXDA 1OMWA 5DIFB 1PMSA 3F5RA 1XODA 3PVUA 5C5BA 3PZDA 2UZRA 3CXBB 2ELAA 1UPQA 2CAYA 4HAZB 4B6HA 2M38A 1FHWA 3F0WA 1EVHA 1UNPA 1EAZA 2ZPYA 1TJ6A 4ZRKA 1AWEA 1MKEA 2I1KA 2K2UA 2AL6A 3ODOA 3TCAA 4KAXB 2OQBA 2IFSA 4KHOA 1X11A 4Y94A 1TQZA 1MK7B 1X1GA 2EJ8A 2BCJA 4C0AA 4A6FB 1U5DA 1WG7A 1EGXA 1WGQA 5HE0A 5C6RA 1W1GA 2L1CA 2DKQA 3FEHA 3LJUX 3WYFB 4HB3B 4HDOA 2VKIA 2YVCA 4HAVB 2Z0OA 2G35A 4P7IA 4A6FA 3D8EA 3ZVRA 2DHJA 4YONA 1Y5OA 2I1JA 2Y8GA 3KZ1A 4IFSA 1FHOA 1U27A 2W2XC 2Q13A 5L81A 1V88A 3AU4A 2D2QA 1MIZB 5C16A 1KI1B 4DX90 4HAUB 2EMTA 4MT7A 4A5KA 2HTHB 3P6AA 3VIAA 2VRWB 3AU5A 3WA0A 1WVHA 2LOZA 5C79A 2DTCA 4KHAA 4F7GA 2Y8FA 3U8ZA 4HAXB 2DX1A 5LOPB 2VSZA 1ZM0A 1DROA 4F7HA 2D9YA 1TXDA 1NI2A 1U5EA 3QIJA 1BAKA 2W2XD 1X86A 1V89A 2RGNB 2J0MA 3ULBA 2MFQA 3ML4A 2COAA 2QKMA 1NTVA 2YSZA 3SV1A 3N7CA 3NSUA 2J0KA 5C5BB 5JLJB 1B55A 2I5FA 5D3YA 4DBBA 3V5WA 1MAIA 3QWMA 2E2XA 4HDQA 1FOEA 1K5GB 5D27A 4IAPA 4YL8A 5CLQB 4A6KA 5HE1A 5DH9B 2N0YA 5J3QA 3DXCA 4NSWA 2V76A 4WJ7A 2KCJA 1RJ2A 4K17A 3VOQA 4L6EA 5LONB 2D4QA 2LULA 2W2WA 2D9WA 1H10A 2N23A 4GN1A 3KRWA 4H8SA 2FJLA 3T06A 1XKEA 2CRFA 5CLLB 2D9VA 1UPRA 4K2PA 5HE3A 3FSSA 5GOWB 5JP4A 5KCVA 1M7EA 1I2HA 2NZ8B 5D3VA 4KHBB 2JP2A 2K00A 2R09A 3D8DA 1P5TA 2YRYA 4HHVA 3PP2A 4CYEA 1X1FA 1FAOA 2H7EA 3QBVB 4CHJA 2ROZB 4GPTB 4HB4B 3ULCA 2K2JA 1LB1A 1BTNA 2KUPA 2DA0A 1SHCA 4MK0A 2RNRB 4IOYX 2H7DA 1FGYA 1X05A 1PLSA 5KQ4A 2NMBA 3PG7A 2GCLA 2GCJA 3TVVA 4BBKA 2KGXB 1J19A 3RCPA 3AJ4A 1ZC4B 1SGHA 5DHAB 1V61A 1GG3A 1I7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYD A;  2YT1 A;  1RRP B;  1FHX A;  2L2I A;  1N3H A;  3ODW A;  2HE7 A;  2DHK A;  4TKN A;  2RLO A;  3SNH A;  1W1D A;  1V5P A;  2PZ1 A;  1XCG A;  2EC1 A;  4HAW B;  3DXE A;  3OAN A;  3MDB C;  4A6H A;  1LW3 A;  2COC A;  2DYQ A;  1Z87 A;  5JHH A;  2YT0 A;  2P0D A;  1DYN A;  1J0W A;  3GYO A;  3D8F A;  4MY6 A;  5D3W A;  4D0N B;  2UVM A;  2DKP A;  1P6S A;  4DX8 A;  4F7U P;  4DXA B;  2COD A;  2P0H A;  4HB2 B;  2RUK B;  3BJI A;  2DHI A;  2DYN A;  2X18 A;  4WSF A;  1GC6 A;  2D10 A;  3CIK A;  1WGU A;  2DFK A;  1W1H A;  3ODX A;  5FI1 A;  1OQN A;  3SO6 A;  2YS5 A;  2D11 A;  1V5U A;  3A8Q A;  2AEH A;  2GJY A;  3HW2 B;  4GMV A;  1KZ7 A;  1ZVR A;  2MWN B;  4HAT B;  2Z0Q A;  3KRX A;  2QKL A;  1ZSQ A;  3A8P A;  1DDM A;  1E5W A;  1NTY A;  1DDW A;  4ZRI A;  2IYB A;  2P8V A;  1XD4 A;  2M14 A;  1QQG A;  2RSG A;  2XQN M;  4EMO A;  2EMS A;  5D3X A;  4PNK A;  1QC6 A;  1ZC3 B;  5J3Y A;  2LOX A;  4EKU A;  2R0D A;  4K2O A;  1DBH A;  1IRS A;  1KZG A;  4NY0 A;  3UZT A;  2GS0 A;  4PQ0 A;  1XX0 A;  4GZU A;  2MDX A;  1UNQ A;  1K5D B;  1AQC A;  3GYP A;  2I5C A;  1Y19 B;  3G9W A;  1U29 A;  1ISN A;  5FI0 A;  2LKO A;  5EFX A;  2ADZ A;  4WVF B;  3BIN A;  1EF1 A;  1WI1 A;  3TW1 A;  4CHM A;  2CY4 A;  3FM8 C;  1U5G A;  4GXB A;  2ROV A;  3IVF A;  3HK0 A;  2Z0P A;  3P7Z A;  1NU2 A;  1WJ1 A;  2UZS A;  1MK9 B;  3SYX A;  3U7D A;  2YF0 A;  2DN6 A;  2YS3 A;  4Z2N A;  1UEF A;  3PSC A;  2LG1 A;  3PVW A;  1BWN A;  4K81 A;  3HQC A;  3X23 A;  5KQ1 A;  2OTX A;  5HE2 A;  1PFJ A;  1GC7 A;  4HAY B;  3PVL A;  2D9X A;  1FB8 A;  2RVB B;  1FGZ A;  1U2B A;  1H4R A;  3MPX A;  1P3R A;  3KSY A;  1M7R A;  3TFM A;  3A98 B;  2J0J A;  2D9Z A;  1XR0 B;  2DX5 A;  3PEG A;  1MIX A;  2ELB A;  2DLW A;  2Y7B A;  1WJM A;  4GMX B;  3M1I B;  5DI9 B;  1OY2 A;  3O96 A;  4Z2M B;  1DDV A;  1Q67 A;  3ZDT A;  1U5F A;  2COF A;  4KVG B;  1BTK A;  4TYZ A;  3TO1 A;  3KY9 A;  1V5M A;  5DHF B;  2YS1 A;  5J3T A;  2CY5 A;  2P0F A;  4EJN A;  1UNR A;  5JHG A;  2MKR A;  4XWX A;  2J59 M;  4ZRJ A;  1MPH A;  3SUZ A;  4HB0 B;  3DXD A;  1OMW A;  5DIF B;  1PMS A;  3F5R A;  1XOD A;  3PVU A;  5C5B A;  3PZD A;  2UZR A;  3CXB B;  2ELA A;  1UPQ A;  2CAY A;  4HAZ B;  4B6H A;  2M38 A;  1FHW A;  3F0W A;  1EVH A;  1UNP A;  1EAZ A;  2ZPY A;  1TJ6 A;  4ZRK A;  1AWE A;  1MKE A;  2I1K A;  2K2U A;  2AL6 A;  3ODO A;  3TCA A;  4KAX B;  2OQB A;  2IFS A;  4KHO A;  1X11 A;  4Y94 A;  1TQZ A;  1MK7 B;  1X1G A;  2EJ8 A;  2BCJ A;  4C0A A;  4A6F B;  1U5D A;  1WG7 A;  1EGX A;  1WGQ A;  5HE0 A;  5C6R A;  1W1G A;  2L1C A;  2DKQ A;  3FEH A;  3LJU X;  3WYF B;  4HB3 B;  4HDO A;  2VKI A;  2YVC A;  4HAV B;  2Z0O A;  2G35 A;  4P7I A;  4A6F A;  3D8E A;  3ZVR A;  2DHJ A;  4YON A;  1Y5O A;  2I1J A;  2Y8G A;  3KZ1 A;  4IFS A;  1FHO A;  1U27 A;  2W2X C;  2Q13 A;  5L81 A;  1V88 A;  3AU4 A;  2D2Q A;  1MIZ B;  5C16 A;  1KI1 B;  4DX9 0;  4HAU B;  2EMT A;  4MT7 A;  4A5K A;  2HTH B;  3P6A A;  3VIA A;  2VRW B;  3AU5 A;  3WA0 A;  1WVH A;  2LOZ A;  5C79 A;  2DTC A;  4KHA A;  4F7G A;  2Y8F A;  3U8Z A;  4HAX B;  2DX1 A;  5LOP B;  2VSZ A;  1ZM0 A;  1DRO A;  4F7H A;  2D9Y A;  1TXD A;  1NI2 A;  1U5E A;  3QIJ A;  1BAK A;  2W2X D;  1X86 A;  1V89 A;  2RGN B;  2J0M A;  3ULB A;  2MFQ A;  3ML4 A;  2COA A;  2QKM A;  1NTV A;  2YSZ A;  3SV1 A;  3N7C A;  3NSU A;  2J0K A;  5C5B B;  5JLJ B;  1B55 A;  2I5F A;  5D3Y A;  4DBB A;  3V5W A;  1MAI A;  3QWM A;  2E2X A;  4HDQ A;  1FOE A;  1K5G B;  5D27 A;  4IAP A;  4YL8 A;  5CLQ B;  4A6K A;  5HE1 A;  5DH9 B;  2N0Y A;  5J3Q A;  3DXC A;  4NSW A;  2V76 A;  4WJ7 A;  2KCJ A;  1RJ2 A;  4K17 A;  3VOQ A;  4L6E A;  5LON B;  2D4Q A;  2LUL A;  2W2W A;  2D9W A;  1H10 A;  2N23 A;  4GN1 A;  3KRW A;  4H8S A;  2FJL A;  3T06 A;  1XKE A;  2CRF A;  5CLL B;  2D9V A;  1UPR A;  4K2P A;  5HE3 A;  3FSS A;  5GOW B;  5JP4 A;  5KCV A;  1M7E A;  1I2H A;  2NZ8 B;  5D3V A;  4KHB B;  2JP2 A;  2K00 A;  2R09 A;  3D8D A;  1P5T A;  2YRY A;  4HHV A;  3PP2 A;  4CYE A;  1X1F A;  1FAO A;  2H7E A;  3QBV B;  4CHJ A;  2ROZ B;  4GPT B;  4HB4 B;  3ULC A;  2K2J A;  1LB1 A;  1BTN A;  2KUP A;  2DA0 A;  1SHC A;  4MK0 A;  2RNR B;  4IOY X;  2H7D A;  1FGY A;  1X05 A;  1PLS A;  5KQ4 A;  2NMB A;  3PG7 A;  2GCL A;  2GCJ A;  3TVV A;  4BBK A;  2KGX B;  1J19 A;  3RCP A;  3AJ4 A;  1ZC4 B;  1SGH A;  5DHA B;  1V61 A;  1GG3 A;  1I7A A; 
#chains in the Genus database with same CATH topology
 2LYD A;  2YT1 A;  1RRP B;  1FHX A;  2L2I A;  1N3H A;  3ODW A;  2HE7 A;  3A58 A;  2DHK A;  4TKN A;  2RLO A;  3SNH A;  1W1D A;  1V5P A;  2PZ1 A;  1XCG A;  2EC1 A;  4HAW B;  3DXE A;  3OAN A;  3MDB C;  1MI1 A;  4A6H A;  1LW3 A;  2COC A;  2DYQ A;  1Z87 A;  5JHH A;  2YT0 A;  2P0D A;  1DYN A;  1J0W A;  4D6W A;  3FVC A;  3GYO A;  3D8F A;  4MY6 A;  5D3W A;  4D0N B;  2UVM A;  2DKP A;  1P6S A;  2Z14 A;  4DX8 A;  4F7U P;  4DXA B;  2COD A;  2P0H A;  4HB2 B;  2RUK B;  3BJI A;  2DHI A;  2DYN A;  4QJ4 B;  2X18 A;  4WSF A;  1GC6 A;  2D10 A;  3CIK A;  1WGU A;  2DFK A;  1W1H A;  3ODX A;  5FI1 A;  1OQN A;  3SO6 A;  2Z59 A;  2YS5 A;  4GOU A;  2D11 A;  1V5U A;  3NWA A;  3A8Q A;  2AEH A;  2GJY A;  3HW2 B;  4GMV A;  1KZ7 A;  1ZVR A;  2MWN B;  4HAT B;  5I2S A;  2Z0Q A;  4DIX A;  3KRX A;  2QKL A;  1ZSQ A;  3A8P A;  1DDM A;  1E5W A;  1NTY A;  2RRF A;  1DDW A;  4ZRI A;  2IYB A;  2P8V A;  4GNK B;  1XD4 A;  2M14 A;  1QQG A;  2RSG A;  2XQN M;  4EMO A;  2EMS A;  4QJ3 B;  5D3X A;  4PNK A;  1QC6 A;  1ZC3 B;  5J3Y A;  2LOX A;  2NBV A;  4EKU A;  2R0D A;  4K2O A;  1ZYI A;  1DBH A;  1IRS A;  1KZG A;  4NY0 A;  3UZT A;  2GS0 A;  4PQ0 A;  1XX0 A;  4GZU A;  2MDX A;  1UNQ A;  1K5D B;  1AQC A;  3GYP A;  3NW8 A;  2I5C A;  1Y19 B;  3G9W A;  1U29 A;  1ISN A;  5FI0 A;  2LKO A;  5EFX A;  2ADZ A;  4WVF B;  3BIN A;  1EF1 A;  1WI1 A;  3TW1 A;  4CHM A;  2CY4 A;  3FM8 C;  1U5G A;  4GXB A;  2ROV A;  3IVF A;  3HK0 A;  2Z0P A;  1NU2 A;  1WJ1 A;  2UZS A;  1MK9 B;  3P7Z A;  3SYX A;  3U7D A;  2YF0 A;  2DN6 A;  2YS3 A;  4Z2N A;  1UEF A;  3PSC A;  2LG1 A;  3PVW A;  1BWN A;  4K81 A;  3HQC A;  3X23 A;  5KQ1 A;  2OTX A;  2ZKM X;  5HE2 A;  1PFJ A;  1GC7 A;  4HAY B;  3PVL A;  2D9X A;  1FB8 A;  2RVB B;  1FGZ A;  1U2B A;  1H4R A;  3MPX A;  1P3R A;  3KSY A;  3NWF A;  1M7R A;  3TFM A;  3A98 B;  2J0J A;  2D9Z A;  1XR0 B;  2DX5 A;  3PEG A;  1MIX A;  2ELB A;  2DLW A;  2Y7B A;  1WJM A;  4GMX B;  3M1I B;  5DI9 B;  1OY2 A;  3O96 A;  4Z2M B;  1DDV A;  1Q67 A;  3ZDT A;  3DCX A;  1U5F A;  2COF A;  4KVG B;  1BTK A;  4TYZ A;  3TO1 A;  3KY9 A;  1V5M A;  5DHF B;  2YS1 A;  5J3T A;  2CY5 A;  4L1R A;  2P0F A;  4EJN A;  1UNR A;  5JHG A;  2MKR A;  4XWX A;  2J59 M;  4ZRJ A;  1MPH A;  3SUZ A;  4QJ5 B;  4HB0 B;  3DXD A;  1OMW A;  5DIF B;  1PMS A;  3F5R A;  1XOD A;  3PVU A;  5C5B A;  3PZD A;  2UZR A;  3CXB B;  2ELA A;  3OHM B;  1UPQ A;  2CAY A;  4HAZ B;  2R2Y A;  4B6H A;  2M38 A;  1FHW A;  3F0W A;  1EVH A;  1UNP A;  1EAZ A;  2ZPY A;  1TJ6 A;  4ZRK A;  4HSI A;  1AWE A;  1MKE A;  2I1K A;  2K2U A;  2AL6 A;  3ODO A;  3TCA A;  4KAX B;  2OQB A;  2IFS A;  4KHO A;  1X11 A;  4Y94 A;  1TQZ A;  1MK7 B;  1X1G A;  2EJ8 A;  2BCJ A;  4C0A A;  4A6F B;  1U5D A;  1WG7 A;  1EGX A;  1WGQ A;  5HE0 A;  5C6R A;  1W1G A;  2L1C A;  2DKQ A;  3FEH A;  3LJU X;  3WYF B;  4HB3 B;  4HDO A;  2VKI A;  2YVC A;  4HAV B;  2Z0O A;  2G35 A;  4P7I A;  4A6F A;  3D8E A;  3ZVR A;  2DHJ A;  4YON A;  2KIE A;  1Y5O A;  3HIE A;  4KHB A;  2I1J A;  2K49 A;  2Y8G A;  3KZ1 A;  4IFS A;  1FHO A;  1U27 A;  2W2X C;  2Q13 A;  5L81 A;  1V88 A;  3AU4 A;  1T77 A;  2D2Q A;  1MIZ B;  5C16 A;  1KI1 B;  4DX9 0;  4HAU B;  2EMT A;  4MT7 A;  4A5K A;  2HTH B;  3P6A A;  3VIA A;  2VRW B;  2Z4D A;  3AU5 A;  3WA0 A;  1WVH A;  2LOZ A;  5C79 A;  5IRS A;  2DTC A;  4KHA A;  4F7G A;  2Y8F A;  3U8Z A;  4HAX B;  2DX1 A;  5LOP B;  2VSZ A;  1ZM0 A;  1DRO A;  4F7H A;  2D9Y A;  5I2M A;  1TXD A;  3B77 A;  1NI2 A;  1U5E A;  3QIJ A;  1BAK A;  2W2X D;  1X86 A;  1V89 A;  2RGN B;  2J0M A;  3ULB A;  2MFQ A;  3ML4 A;  2COA A;  2QKM A;  1NTV A;  4OT1 A;  2YSZ A;  3SV1 A;  3N7C A;  3NSU A;  2J0K A;  2Z13 A;  2YT2 A;  5C5B B;  5JLJ B;  3U12 A;  1B55 A;  2I5F A;  5D3Y A;  4DBB A;  3V5W A;  3HSA A;  1MAI A;  3QWM A;  2E2X A;  4HDQ A;  1FOE A;  5M4Y B;  1K5G B;  5D27 A;  4IAP A;  4YL8 A;  5CLQ B;  4A6K A;  5HE1 A;  5DH9 B;  2N0Y A;  5J3Q A;  3DXC A;  4NSW A;  2V76 A;  4WJ7 A;  2KCJ A;  1RJ2 A;  4K17 A;  3VOQ A;  4L6E A;  5LON B;  2D4Q A;  2LUL A;  2W2W A;  2D9W A;  1H10 A;  2N23 A;  2KUQ A;  2K8E A;  4GN1 A;  3KRW A;  4H8S A;  2FJL A;  3T06 A;  5LG4 B;  1XKE A;  2CRF A;  5CLL B;  2D9V A;  1UPR A;  4CSQ A;  4K2P A;  5HE3 A;  3FSS A;  4OSN A;  5GOW B;  5JP4 A;  5KCV A;  1M7E A;  1I2H A;  2NZ8 B;  5D3V A;  4KHB B;  2JP2 A;  2K00 A;  2R09 A;  3D8D A;  1P5T A;  2YRY A;  4HHV A;  3PP2 A;  4CYE A;  1X1F A;  1FAO A;  2H7E A;  3QBV B;  4CHJ A;  2ROZ B;  4GPT B;  4HB4 B;  3ULC A;  2K2J A;  1LB1 A;  1BTN A;  2KUP A;  3NWD A;  2DA0 A;  1SHC A;  4MK0 A;  2RNR B;  4IOY X;  2H7D A;  1FGY A;  1X05 A;  1PLS A;  2FJU B;  2KIG A;  5KQ4 A;  2NMB A;  3PG7 A;  4QXA B;  2GCL A;  2GCJ A;  3TVV A;  4BBK A;  2KGX B;  1J19 A;  3RCP A;  3AJ4 A;  2KR0 A;  1ZC4 B;  2GUM A;  1SGH A;  5DHA B;  1V61 A;  1GG3 A;  1I7A A; 
#chains in the Genus database with same CATH homology
 2LYD A;  2YT1 A;  1RRP B;  1FHX A;  2L2I A;  1N3H A;  3ODW A;  2HE7 A;  2DHK A;  4TKN A;  2RLO A;  3SNH A;  1W1D A;  1V5P A;  2PZ1 A;  1XCG A;  2EC1 A;  4HAW B;  3DXE A;  3OAN A;  3MDB C;  4A6H A;  1LW3 A;  2COC A;  2DYQ A;  1Z87 A;  5JHH A;  2YT0 A;  2P0D A;  1DYN A;  1J0W A;  3GYO A;  3D8F A;  4MY6 A;  5D3W A;  4D0N B;  2UVM A;  2DKP A;  1P6S A;  4DX8 A;  4F7U P;  4DXA B;  2COD A;  2P0H A;  4HB2 B;  2RUK B;  3BJI A;  2DHI A;  2DYN A;  2X18 A;  4WSF A;  1GC6 A;  2D10 A;  3CIK A;  1WGU A;  2DFK A;  1W1H A;  3ODX A;  5FI1 A;  1OQN A;  3SO6 A;  2YS5 A;  2D11 A;  1V5U A;  3A8Q A;  2AEH A;  2GJY A;  3HW2 B;  4GMV A;  1KZ7 A;  1ZVR A;  2MWN B;  4HAT B;  2Z0Q A;  3KRX A;  2QKL A;  1ZSQ A;  3A8P A;  1DDM A;  1E5W A;  1NTY A;  1DDW A;  4ZRI A;  2IYB A;  2P8V A;  1XD4 A;  2M14 A;  1QQG A;  2RSG A;  2XQN M;  4EMO A;  2EMS A;  5D3X A;  4PNK A;  1QC6 A;  1ZC3 B;  5J3Y A;  2LOX A;  4EKU A;  2R0D A;  4K2O A;  1DBH A;  1IRS A;  1KZG A;  4NY0 A;  3UZT A;  2GS0 A;  4PQ0 A;  1XX0 A;  4GZU A;  2MDX A;  1UNQ A;  1K5D B;  1AQC A;  3GYP A;  2I5C A;  1Y19 B;  3G9W A;  1U29 A;  1ISN A;  5FI0 A;  2LKO A;  5EFX A;  2ADZ A;  4WVF B;  3BIN A;  1EF1 A;  1WI1 A;  3TW1 A;  4CHM A;  2CY4 A;  3FM8 C;  1U5G A;  4GXB A;  2ROV A;  3IVF A;  3HK0 A;  2Z0P A;  3P7Z A;  1NU2 A;  1WJ1 A;  2UZS A;  1MK9 B;  3SYX A;  3U7D A;  2YF0 A;  2DN6 A;  2YS3 A;  4Z2N A;  1UEF A;  3PSC A;  2LG1 A;  3PVW A;  1BWN A;  4K81 A;  3HQC A;  3X23 A;  5KQ1 A;  2OTX A;  5HE2 A;  1PFJ A;  1GC7 A;  4HAY B;  3PVL A;  2D9X A;  1FB8 A;  2RVB B;  1FGZ A;  1U2B A;  1H4R A;  3MPX A;  1P3R A;  3KSY A;  1M7R A;  3TFM A;  3A98 B;  2J0J A;  2D9Z A;  1XR0 B;  2DX5 A;  3PEG A;  1MIX A;  2ELB A;  2DLW A;  2Y7B A;  1WJM A;  4GMX B;  3M1I B;  5DI9 B;  1OY2 A;  3O96 A;  4Z2M B;  1DDV A;  1Q67 A;  3ZDT A;  1U5F A;  2COF A;  4KVG B;  1BTK A;  4TYZ A;  3TO1 A;  3KY9 A;  1V5M A;  5DHF B;  2YS1 A;  5J3T A;  2CY5 A;  2P0F A;  4EJN A;  1UNR A;  5JHG A;  2MKR A;  4XWX A;  2J59 M;  4ZRJ A;  1MPH A;  3SUZ A;  4HB0 B;  3DXD A;  1OMW A;  5DIF B;  1PMS A;  3F5R A;  1XOD A;  3PVU A;  5C5B A;  3PZD A;  2UZR A;  3CXB B;  2ELA A;  1UPQ A;  2CAY A;  4HAZ B;  4B6H A;  2M38 A;  1FHW A;  3F0W A;  1EVH A;  1UNP A;  1EAZ A;  2ZPY A;  1TJ6 A;  4ZRK A;  1AWE A;  1MKE A;  2I1K A;  2K2U A;  2AL6 A;  3ODO A;  3TCA A;  4KAX B;  2OQB A;  2IFS A;  4KHO A;  1X11 A;  4Y94 A;  1TQZ A;  1MK7 B;  1X1G A;  2EJ8 A;  2BCJ A;  4C0A A;  4A6F B;  1U5D A;  1WG7 A;  1EGX A;  1WGQ A;  5HE0 A;  5C6R A;  1W1G A;  2L1C A;  2DKQ A;  3FEH A;  3LJU X;  3WYF B;  4HB3 B;  4HDO A;  2VKI A;  2YVC A;  4HAV B;  2Z0O A;  2G35 A;  4P7I A;  4A6F A;  3D8E A;  3ZVR A;  2DHJ A;  4YON A;  1Y5O A;  2I1J A;  2Y8G A;  3KZ1 A;  4IFS A;  1FHO A;  1U27 A;  2W2X C;  2Q13 A;  5L81 A;  1V88 A;  3AU4 A;  2D2Q A;  1MIZ B;  5C16 A;  1KI1 B;  4DX9 0;  4HAU B;  2EMT A;  4MT7 A;  4A5K A;  2HTH B;  3P6A A;  3VIA A;  2VRW B;  3AU5 A;  3WA0 A;  1WVH A;  2LOZ A;  5C79 A;  2DTC A;  4KHA A;  4F7G A;  2Y8F A;  3U8Z A;  4HAX B;  2DX1 A;  5LOP B;  2VSZ A;  1ZM0 A;  1DRO A;  4F7H A;  2D9Y A;  1TXD A;  1NI2 A;  1U5E A;  3QIJ A;  1BAK A;  2W2X D;  1X86 A;  1V89 A;  2RGN B;  2J0M A;  3ULB A;  2MFQ A;  3ML4 A;  2COA A;  2QKM A;  1NTV A;  2YSZ A;  3SV1 A;  3N7C A;  3NSU A;  2J0K A;  5C5B B;  5JLJ B;  1B55 A;  2I5F A;  5D3Y A;  4DBB A;  3V5W A;  1MAI A;  3QWM A;  2E2X A;  4HDQ A;  1FOE A;  1K5G B;  5D27 A;  4IAP A;  4YL8 A;  5CLQ B;  4A6K A;  5HE1 A;  5DH9 B;  2N0Y A;  5J3Q A;  3DXC A;  4NSW A;  2V76 A;  4WJ7 A;  2KCJ A;  1RJ2 A;  4K17 A;  3VOQ A;  4L6E A;  5LON B;  2D4Q A;  2LUL A;  2W2W A;  2D9W A;  1H10 A;  2N23 A;  4GN1 A;  3KRW A;  4H8S A;  2FJL A;  3T06 A;  1XKE A;  2CRF A;  5CLL B;  2D9V A;  1UPR A;  4K2P A;  5HE3 A;  3FSS A;  5GOW B;  5JP4 A;  5KCV A;  1M7E A;  1I2H A;  2NZ8 B;  5D3V A;  4KHB B;  2JP2 A;  2K00 A;  2R09 A;  3D8D A;  1P5T A;  2YRY A;  4HHV A;  3PP2 A;  4CYE A;  1X1F A;  1FAO A;  2H7E A;  3QBV B;  4CHJ A;  2ROZ B;  4GPT B;  4HB4 B;  3ULC A;  2K2J A;  1LB1 A;  1BTN A;  2KUP A;  2DA0 A;  1SHC A;  4MK0 A;  2RNR B;  4IOY X;  2H7D A;  1FGY A;  1X05 A;  1PLS A;  5KQ4 A;  2NMB A;  3PG7 A;  2GCL A;  2GCJ A;  3TVV A;  4BBK A;  2KGX B;  1J19 A;  3RCP A;  3AJ4 A;  1ZC4 B;  1SGH A;  5DHA B;  1V61 A;  1GG3 A;  1I7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...