2FJLA

Solution structure of the split ph domain in phospholipase c-gamma1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
150
structure length
150
Chain Sequence
b'SIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASGSTELHSSLEVLFQGPNPAILEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSISMPSVAQWSLDVAADSQEELQDWVKKIREVAQTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase ga
publication title Structural Characterization of the Split Pleckstrin Homology Domain in Phospholipase C-{gamma}1 and Its Interaction with TRPC3
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 13
structure length 150
sequence length 150
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2006-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2fjlA00
2COAA 4EJNA 4GZUA 4IFSA 5DIFB 1PLSA 2DX5A 2J0KA 4EKUA 2Y8GA 2KGXB 2OTXA 2W2XD 4KAXB 3U8ZA 1V5UA 2D11A 3FEHA 4A6FA 1MAIA 2R09A 4HAVB 3TVVA 1FHOA 4HB0B 2CAYA 4HDQA 2J59M 3RCPA 3SUZA 2DTCA 1MK9B 1FB8A 2H7EA 4DX8A 2N23A 3MPXA 3KRXA 3P6AA 2X18A 2NZ8B 1EF1A 2AEHA 2CY4A 4K81A 3D8EA 4ZRIA 1OY2A 1DDMA 2CY5A 4PNKA 2COFA 1X1FA 3AU4A 4HB3B 3UZTA 2YT1A 2H7DA 3KRWA 2VKIA 4YONA 2ADZA 3F5RA 3P7ZA 4IAPA 3BINA 1BTKA 2GCLA 2I1JA 5FI1A 1DROA 3SNHA 1U5GA 2Y8FA 5D3YA 3PEGA 4A6KA 2Z0OA 2R0DA 2M38A 4DX90 2VSZA 4GMVA 5KQ4A 2YS5A 2BCJA 2HTHB 4WVFB 5DH9B 3PVLA 3D8DA 2JP2A 2LKOA 2KUPA 4K2PA 4A5KA 2D9VA 1OQNA 2GS0A 5C5BB 4H8SA 2I1KA 2COCA 4CHJA 1UPQA 5CLLB 4WSFA 1DYNA 1GC7A 2DLWA 1P3RA 3VIAA 3FM8C 2YS1A 1WJMA 2GJYA 5DI9B 4HATB 1ZM0A 2D10A 2DN6A 4Y94A 1M7EA 4MK0A 4TYZA 5KQ1A 2L1CA 4PQ0A 3T06A 1KZGA 4DXAB 1Q67A 1WG7A 5DHAB 3ULBA 1U29A 4NSWA 4F7GA 1SGHA 2AL6A 5JP4A 1RRPB 5J3TA 3GYPA 2OQBA 2RNRB 3G9WA 2MKRA 4F7UP 2DKQA 5LONB 3KSYA 1DBHA 1RJ2A 2VRWB 3ML4A 1FOEA 3ULCA 1PMSA 2MWNB 5GOWB 5HE1A 1H4RA 3GYOA 4MT7A 5HE0A 2LOZA 4HAYB 2LULA 3A8PA 1FHWA 4KHAA 2YRYA 1LW3A 4HAXB 1ZC4B 2KCJA 2P0FA 1W1HA 1EGXA 2EMSA 1PFJA 1FHXA 1BAKA 1NTVA 3PVUA 1ZC3B 3QBVB 3PP2A 1DDWA 5FI0A 2D9YA 5C6RA 2IFSA 2QKLA 1MIXA 2RSGA 1UNRA 3SYXA 4A6FB 1U5EA 2NMBA 4ZRKA 3DXCA 3ZVRA 3WYFB 2RUKB 4KHOA 1BWNA 2CODA 3KZ1A 1TXDA 1X11A 4HAUB 2ELAA 1E5WA 1OMWA 3V5WA 2L2IA 2DKPA 2DYQA 3HW2B 5JLJB 2Q13A 1XD4A 4HDOA 1MIZB 4Z2NA 1MKEA 1EVHA 1V89A 2RGNB 2N0YA 2D9WA 1UNQA 2YSZA 2W2XC 1U27A 4GMXB 3AU5A 2YVCA 1MPHA 3O96A 1UPRA 2D2QA 5JHHA 2MDXA 3TW1A 2ELBA 1H10A 3ODXA 2D9XA 5J3YA 3A8QA 3KY9A 4GN1A 3QWMA 1J0WA 2DA0A 1B55A 3VOQA 4YL8A 2DX1A 2DHKA 4WJ7A 4K17A 4GPTB 5D27A 5EFXA 3ZDTA 1K5GB 4P7IA 1X05A 1TJ6A 3DXDA 2DFKA 4CHMA 2HE7A 4HAWB 1Y19B 3U7DA 1Z87A 3SO6A 4KVGB 2E2XA 2K2UA 4A6HA 4D0NB 3N7CA 2G35A 1TQZA 2I5CA 4XWXA 1XKEA 1I2HA 1AQCA 1U5DA 2J0MA 1ZVRA 2QKMA 4F7HA 3PZDA 3ODOA 3TO1A 3PG7A 3WA0A 4CYEA 4MY6A 1NTYA 1WGQA 2UVMA 4C0AA 3IVFA 3PVWA 3FSSA 4HHVA 1V5MA 1FAOA 1WGUA 1W1DA 1XODA 3TCAA 4TKNA 1P5TA 4GXBA 2IYBA 5HE2A 2EC1A 1SHCA 2YS3A 1BTNA 2GCJA 3DXEA 5HE3A 1X86A 1W1GA 1IRSA 3BJIA 2ROZB 5D3VA 2UZRA 2XQNM 1P6SA 2D9ZA 2P0HA 2UZSA 2V76A 1V88A 1U2BA 3PSCA 2M14A 5J3QA 1DDVA 5DHFB 1J19A 3M1IB 2DHIA 1V61A 1UEFA 3X23A 5D3WA 1Y5OA 3SV1A 2YT0A 1XR0B 1XCGA 3QIJA 4IOYX 1NU2A 4NY0A 1LB1A 1QQGA 3OANA 1FGYA 1MK7B 2P0DA 4HB4B 1ZSQA 1EAZA 1I7AA 4BBKA 1N3HA 1WJ1A 1NI2A 1GG3A 4ZRJA 3CIKA 1X1GA 3TFMA 1AWEA 5C5BA 1WVHA 1ISNA 1M7RA 3MDBC 2MFQA 2P8VA 2Y7BA 3HK0A 3LJUX 2I5FA 3D8FA 3HQCA 2EJ8A 2RVBB 1GC6A 3AJ4A 1UNPA 1KZ7A 2LYDA 2ROVA 4L6EA 3A98B 2W2WA 2LOXA 1XX0A 2DYNA 1FGZA 2EMTA 4HB2B 2RLOA 2Z0QA 1KI1B 1V5PA 4KHBB 3NSUA 5C79A 2Z0PA 3F0WA 4B6HA 5KCVA 2LG1A 4DBBA 5JHGA 2ZPYA 2PZ1A 5LOPB 2K2JA 3ODWA 2D4QA 3CXBB 5CLQB 1WI1A 2FJLA 4EMOA 1U5FA 2J0JA 5L81A 4HAZB 5D3XA 4Z2MB 5C16A 2YF0A 1QC6A 1K5DB 4K2OA 2K00A 2CRFA 2DHJA
chains in the Genus database with same CATH superfamily
2COAA 4EJNA 4GZUA 4IFSA 5DIFB 1PLSA 2DX5A 2J0KA 4EKUA 2Y8GA 2KGXB 2OTXA 2ZKMX 2W2XD 4KAXB 3U8ZA 1V5UA 2D11A 3FEHA 4A6FA 1MAIA 2R09A 4HAVB 3TVVA 1FHOA 4HB0B 2CAYA 4HDQA 2J59M 3RCPA 3SUZA 2DTCA 1MK9B 1FB8A 2H7EA 4DX8A 2N23A 3MPXA 3KRXA 3P6AA 2X18A 2NZ8B 1EF1A 2AEHA 2CY4A 4K81A 3D8EA 4ZRIA 4QJ4B 1OY2A 1DDMA 2CY5A 4PNKA 2COFA 2KIGA 1X1FA 3AU4A 4HB3B 3UZTA 2YT1A 3OHMB 2H7DA 3KRWA 2VKIA 4YONA 2ADZA 2KIEA 3F5RA 3P7ZA 4IAPA 3BINA 1BTKA 2GCLA 2I1JA 5FI1A 1DROA 3SNHA 1U5GA 2Y8FA 5D3YA 3B77A 3PEGA 4A6KA 2Z0OA 2R0DA 2M38A 4DX90 2VSZA 4GMVA 5KQ4A 2YS5A 2BCJA 2HTHB 4WVFB 5DH9B 3PVLA 3D8DA 5M4YB 2JP2A 2LKOA 2KUPA 4K2PA 4A5KA 2D9VA 1OQNA 2GS0A 5C5BB 4H8SA 2I1KA 2COCA 4CHJA 1UPQA 2K49A 5CLLB 4WSFA 1DYNA 1GC7A 2DLWA 1P3RA 3VIAA 3FM8C 2YS1A 1WJMA 2GJYA 5DI9B 4HATB 1ZM0A 2D10A 2DN6A 4Y94A 1M7EA 4MK0A 4TYZA 5KQ1A 2L1CA 4PQ0A 3T06A 1KZGA 4DXAB 1Q67A 1WG7A 3DCXA 5DHAB 3ULBA 1U29A 4NSWA 4F7GA 1SGHA 2AL6A 5JP4A 1RRPB 4HSIA 5J3TA 3GYPA 2OQBA 2RNRB 3G9WA 2MKRA 4F7UP 2DKQA 5LONB 3KSYA 1DBHA 1RJ2A 2VRWB 3ML4A 1FOEA 3ULCA 1PMSA 2MWNB 5GOWB 5HE1A 2KUQA 4OSNA 1H4RA 3GYOA 4MT7A 5HE0A 2LOZA 4HAYB 5I2MA 2Z14A 2LULA 3A8PA 1FHWA 4KHAA 2YRYA 1LW3A 4HAXB 1ZC4B 2KCJA 2P0FA 1W1HA 1EGXA 3FVCA 2EMSA 1PFJA 1T77A 2NBVA 1FHXA 3HSAA 1BAKA 1NTVA 3PVUA 1ZC3B 3QBVB 3PP2A 1DDWA 5FI0A 2D9YA 5C6RA 2IFSA 2QKLA 1MIXA 3NW8A 2RSGA 1UNRA 3SYXA 3NWAA 4A6FB 1U5EA 2NMBA 4ZRKA 3DXCA 3ZVRA 3WYFB 2K8EA 4CSQA 2RUKB 4KHOA 1BWNA 2CODA 3NWFA 3KZ1A 1TXDA 1X11A 4HAUB 2ELAA 1E5WA 1OMWA 3V5WA 2L2IA 2DKPA 2DYQA 3HW2B 5JLJB 2Q13A 1XD4A 4HDOA 1MIZB 4Z2NA 1MKEA 1EVHA 1V89A 2RGNB 2N0YA 2D9WA 1UNQA 2YSZA 2W2XC 1U27A 4GMXB 3AU5A 3HIEA 2YVCA 1MPHA 3O96A 1UPRA 3U12A 2D2QA 5JHHA 2MDXA 3TW1A 2ELBA 1H10A 3ODXA 2D9XA 5J3YA 3A8QA 3KY9A 4GN1A 4KHBA 4OT1A 3QWMA 1J0WA 2DA0A 1B55A 3VOQA 4YL8A 2DX1A 2DHKA 4WJ7A 4K17A 4D6WA 4GPTB 5D27A 5EFXA 2Z59A 3ZDTA 1K5GB 4P7IA 1X05A 1TJ6A 3DXDA 2DFKA 4CHMA 2HE7A 4HAWB 1Y19B 1MI1A 3U7DA 1Z87A 3SO6A 4KVGB 2RRFA 2E2XA 2K2UA 4A6HA 4D0NB 3N7CA 2G35A 1TQZA 2I5CA 4XWXA 1XKEA 1I2HA 1AQCA 1U5DA 2J0MA 1ZVRA 2QKMA 4F7HA 3PZDA 3ODOA 3TO1A 3PG7A 3WA0A 4CYEA 2Z4DA 4MY6A 1NTYA 1WGQA 2UVMA 4C0AA 3IVFA 3PVWA 3FSSA 4HHVA 1V5MA 1ZYIA 1FAOA 1WGUA 1W1DA 1XODA 3TCAA 4TKNA 1P5TA 4GXBA 2IYBA 5HE2A 2EC1A 1SHCA 2YS3A 5IRSA 1BTNA 2GCJA 3DXEA 5HE3A 1X86A 1W1GA 1IRSA 3BJIA 2ROZB 5D3VA 2UZRA 2XQNM 1P6SA 2D9ZA 2P0HA 2UZSA 2V76A 1V88A 2GUMA 1U2BA 3PSCA 5I2SA 2M14A 5J3QA 1DDVA 5DHFB 1J19A 3M1IB 2DHIA 1V61A 1UEFA 3X23A 5D3WA 1Y5OA 3SV1A 2YT0A 1XR0B 1XCGA 3A58A 3QIJA 2Z13A 4IOYX 1NU2A 4NY0A 1LB1A 1QQGA 3OANA 1FGYA 1MK7B 2P0DA 2KR0A 4HB4B 1ZSQA 1EAZA 1I7AA 4BBKA 1N3HA 1WJ1A 1NI2A 1GG3A 4ZRJA 3CIKA 1X1GA 3TFMA 1AWEA 5C5BA 1WVHA 1ISNA 1M7RA 3MDBC 2MFQA 2P8VA 2Y7BA 3HK0A 3LJUX 2I5FA 3D8FA 4GOUA 3HQCA 2EJ8A 2RVBB 1GC6A 3AJ4A 1UNPA 1KZ7A 2LYDA 2ROVA 4L6EA 3A98B 2W2WA 2LOXA 1XX0A 2DYNA 1FGZA 2EMTA 4HB2B 5LG4B 2RLOA 2Z0QA 1KI1B 4QJ5B 1V5PA 4KHBB 2R2YA 3NSUA 5C79A 2Z0PA 3F0WA 4B6HA 2FJUB 2YT2A 5KCVA 2LG1A 4DBBA 5JHGA 4DIXA 4L1RA 2ZPYA 2PZ1A 3NWDA 4QJ3B 5LOPB 2K2JA 3ODWA 2D4QA 3CXBB 5CLQB 1WI1A 2FJLA 4EMOA 1U5FA 2J0JA 5L81A 4HAZB 5D3XA 4Z2MB 5C16A 2YF0A 4QXAB 1QC6A 1K5DB 4K2OA 2K00A 2CRFA 2DHJA 4GNKB
chains in the Genus database with same CATH topology
2COAA 4EJNA 4GZUA 4IFSA 5DIFB 1PLSA 2DX5A 2J0KA 4EKUA 2Y8GA 2KGXB 2OTXA 2W2XD 4KAXB 3U8ZA 1V5UA 2D11A 3FEHA 4A6FA 1MAIA 2R09A 4HAVB 3TVVA 1FHOA 4HB0B 2CAYA 4HDQA 2J59M 3RCPA 3SUZA 2DTCA 1MK9B 1FB8A 2H7EA 4DX8A 2N23A 3MPXA 3KRXA 3P6AA 2X18A 2NZ8B 1EF1A 2AEHA 2CY4A 4K81A 3D8EA 4ZRIA 1OY2A 1DDMA 2CY5A 4PNKA 2COFA 1X1FA 3AU4A 4HB3B 3UZTA 2YT1A 2H7DA 3KRWA 2VKIA 4YONA 2ADZA 3F5RA 3P7ZA 4IAPA 3BINA 1BTKA 2GCLA 2I1JA 5FI1A 1DROA 3SNHA 1U5GA 2Y8FA 5D3YA 3PEGA 4A6KA 2Z0OA 2R0DA 2M38A 4DX90 2VSZA 4GMVA 5KQ4A 2YS5A 2BCJA 2HTHB 4WVFB 5DH9B 3PVLA 3D8DA 2JP2A 2LKOA 2KUPA 4K2PA 4A5KA 2D9VA 1OQNA 2GS0A 5C5BB 4H8SA 2I1KA 2COCA 4CHJA 1UPQA 5CLLB 4WSFA 1DYNA 1GC7A 2DLWA 1P3RA 3VIAA 3FM8C 2YS1A 1WJMA 2GJYA 5DI9B 4HATB 1ZM0A 2D10A 2DN6A 4Y94A 1M7EA 4MK0A 4TYZA 5KQ1A 2L1CA 4PQ0A 3T06A 1KZGA 4DXAB 1Q67A 1WG7A 5DHAB 3ULBA 1U29A 4NSWA 4F7GA 1SGHA 2AL6A 5JP4A 1RRPB 5J3TA 3GYPA 2OQBA 2RNRB 3G9WA 2MKRA 4F7UP 2DKQA 5LONB 3KSYA 1DBHA 1RJ2A 2VRWB 3ML4A 1FOEA 3ULCA 1PMSA 2MWNB 5GOWB 5HE1A 1H4RA 3GYOA 4MT7A 5HE0A 2LOZA 4HAYB 2LULA 3A8PA 1FHWA 4KHAA 2YRYA 1LW3A 4HAXB 1ZC4B 2KCJA 2P0FA 1W1HA 1EGXA 2EMSA 1PFJA 1FHXA 1BAKA 1NTVA 3PVUA 1ZC3B 3QBVB 3PP2A 1DDWA 5FI0A 2D9YA 5C6RA 2IFSA 2QKLA 1MIXA 2RSGA 1UNRA 3SYXA 4A6FB 1U5EA 2NMBA 4ZRKA 3DXCA 3ZVRA 3WYFB 2RUKB 4KHOA 1BWNA 2CODA 3KZ1A 1TXDA 1X11A 4HAUB 2ELAA 1E5WA 1OMWA 3V5WA 2L2IA 2DKPA 2DYQA 3HW2B 5JLJB 2Q13A 1XD4A 4HDOA 1MIZB 4Z2NA 1MKEA 1EVHA 1V89A 2RGNB 2N0YA 2D9WA 1UNQA 2YSZA 2W2XC 1U27A 4GMXB 3AU5A 2YVCA 1MPHA 3O96A 1UPRA 2D2QA 5JHHA 2MDXA 3TW1A 2ELBA 1H10A 3ODXA 2D9XA 5J3YA 3A8QA 3KY9A 4GN1A 3QWMA 1J0WA 2DA0A 1B55A 3VOQA 4YL8A 2DX1A 2DHKA 4WJ7A 4K17A 4GPTB 5D27A 5EFXA 3ZDTA 1K5GB 4P7IA 1X05A 1TJ6A 3DXDA 2DFKA 4CHMA 2HE7A 4HAWB 1Y19B 3U7DA 1Z87A 3SO6A 4KVGB 2E2XA 2K2UA 4A6HA 4D0NB 3N7CA 2G35A 1TQZA 2I5CA 4XWXA 1XKEA 1I2HA 1AQCA 1U5DA 2J0MA 1ZVRA 2QKMA 4F7HA 3PZDA 3ODOA 3TO1A 3PG7A 3WA0A 4CYEA 4MY6A 1NTYA 1WGQA 2UVMA 4C0AA 3IVFA 3PVWA 3FSSA 4HHVA 1V5MA 1FAOA 1WGUA 1W1DA 1XODA 3TCAA 4TKNA 1P5TA 4GXBA 2IYBA 5HE2A 2EC1A 1SHCA 2YS3A 1BTNA 2GCJA 3DXEA 5HE3A 1X86A 1W1GA 1IRSA 3BJIA 2ROZB 5D3VA 2UZRA 2XQNM 1P6SA 2D9ZA 2P0HA 2UZSA 2V76A 1V88A 1U2BA 3PSCA 2M14A 5J3QA 1DDVA 5DHFB 1J19A 3M1IB 2DHIA 1V61A 1UEFA 3X23A 5D3WA 1Y5OA 3SV1A 2YT0A 1XR0B 1XCGA 3QIJA 4IOYX 1NU2A 4NY0A 1LB1A 1QQGA 3OANA 1FGYA 1MK7B 2P0DA 4HB4B 1ZSQA 1EAZA 1I7AA 4BBKA 1N3HA 1WJ1A 1NI2A 1GG3A 4ZRJA 3CIKA 1X1GA 3TFMA 1AWEA 5C5BA 1WVHA 1ISNA 1M7RA 3MDBC 2MFQA 2P8VA 2Y7BA 3HK0A 3LJUX 2I5FA 3D8FA 3HQCA 2EJ8A 2RVBB 1GC6A 3AJ4A 1UNPA 1KZ7A 2LYDA 2ROVA 4L6EA 3A98B 2W2WA 2LOXA 1XX0A 2DYNA 1FGZA 2EMTA 4HB2B 2RLOA 2Z0QA 1KI1B 1V5PA 4KHBB 3NSUA 5C79A 2Z0PA 3F0WA 4B6HA 5KCVA 2LG1A 4DBBA 5JHGA 2ZPYA 2PZ1A 5LOPB 2K2JA 3ODWA 2D4QA 3CXBB 5CLQB 1WI1A 2FJLA 4EMOA 1U5FA 2J0JA 5L81A 4HAZB 5D3XA 4Z2MB 5C16A 2YF0A 1QC6A 1K5DB 4K2OA 2K00A 2CRFA 2DHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COA A;  4EJN A;  4GZU A;  4IFS A;  5DIF B;  1PLS A;  2DX5 A;  2J0K A;  4EKU A;  2Y8G A;  2KGX B;  2OTX A;  2W2X D;  4KAX B;  3U8Z A;  1V5U A;  2D11 A;  3FEH A;  4A6F A;  1MAI A;  2R09 A;  4HAV B;  3TVV A;  1FHO A;  4HB0 B;  2CAY A;  4HDQ A;  2J59 M;  3RCP A;  3SUZ A;  2DTC A;  1MK9 B;  1FB8 A;  2H7E A;  4DX8 A;  2N23 A;  3MPX A;  3KRX A;  3P6A A;  2X18 A;  2NZ8 B;  1EF1 A;  2AEH A;  2CY4 A;  4K81 A;  3D8E A;  4ZRI A;  1OY2 A;  1DDM A;  2CY5 A;  4PNK A;  2COF A;  1X1F A;  3AU4 A;  4HB3 B;  3UZT A;  2YT1 A;  2H7D A;  3KRW A;  2VKI A;  4YON A;  2ADZ A;  3F5R A;  3P7Z A;  4IAP A;  3BIN A;  1BTK A;  2GCL A;  2I1J A;  5FI1 A;  1DRO A;  3SNH A;  1U5G A;  2Y8F A;  5D3Y A;  3PEG A;  4A6K A;  2Z0O A;  2R0D A;  2M38 A;  4DX9 0;  2VSZ A;  4GMV A;  5KQ4 A;  2YS5 A;  2BCJ A;  2HTH B;  4WVF B;  5DH9 B;  3PVL A;  3D8D A;  2JP2 A;  2LKO A;  2KUP A;  4K2P A;  4A5K A;  2D9V A;  1OQN A;  2GS0 A;  5C5B B;  4H8S A;  2I1K A;  2COC A;  4CHJ A;  1UPQ A;  5CLL B;  4WSF A;  1DYN A;  1GC7 A;  2DLW A;  1P3R A;  3VIA A;  3FM8 C;  2YS1 A;  1WJM A;  2GJY A;  5DI9 B;  4HAT B;  1ZM0 A;  2D10 A;  2DN6 A;  4Y94 A;  1M7E A;  4MK0 A;  4TYZ A;  5KQ1 A;  2L1C A;  4PQ0 A;  3T06 A;  1KZG A;  4DXA B;  1Q67 A;  1WG7 A;  5DHA B;  3ULB A;  1U29 A;  4NSW A;  4F7G A;  1SGH A;  2AL6 A;  5JP4 A;  1RRP B;  5J3T A;  3GYP A;  2OQB A;  2RNR B;  3G9W A;  2MKR A;  4F7U P;  2DKQ A;  5LON B;  3KSY A;  1DBH A;  1RJ2 A;  2VRW B;  3ML4 A;  1FOE A;  3ULC A;  1PMS A;  2MWN B;  5GOW B;  5HE1 A;  1H4R A;  3GYO A;  4MT7 A;  5HE0 A;  2LOZ A;  4HAY B;  2LUL A;  3A8P A;  1FHW A;  4KHA A;  2YRY A;  1LW3 A;  4HAX B;  1ZC4 B;  2KCJ A;  2P0F A;  1W1H A;  1EGX A;  2EMS A;  1PFJ A;  1FHX A;  1BAK A;  1NTV A;  3PVU A;  1ZC3 B;  3QBV B;  3PP2 A;  1DDW A;  5FI0 A;  2D9Y A;  5C6R A;  2IFS A;  2QKL A;  1MIX A;  2RSG A;  1UNR A;  3SYX A;  4A6F B;  1U5E A;  2NMB A;  4ZRK A;  3DXC A;  3ZVR A;  3WYF B;  2RUK B;  4KHO A;  1BWN A;  2COD A;  3KZ1 A;  1TXD A;  1X11 A;  4HAU B;  2ELA A;  1E5W A;  1OMW A;  3V5W A;  2L2I A;  2DKP A;  2DYQ A;  3HW2 B;  5JLJ B;  2Q13 A;  1XD4 A;  4HDO A;  1MIZ B;  4Z2N A;  1MKE A;  1EVH A;  1V89 A;  2RGN B;  2N0Y A;  2D9W A;  1UNQ A;  2YSZ A;  2W2X C;  1U27 A;  4GMX B;  3AU5 A;  2YVC A;  1MPH A;  3O96 A;  1UPR A;  2D2Q A;  5JHH A;  2MDX A;  3TW1 A;  2ELB A;  1H10 A;  3ODX A;  2D9X A;  5J3Y A;  3A8Q A;  3KY9 A;  4GN1 A;  3QWM A;  1J0W A;  2DA0 A;  1B55 A;  3VOQ A;  4YL8 A;  2DX1 A;  2DHK A;  4WJ7 A;  4K17 A;  4GPT B;  5D27 A;  5EFX A;  3ZDT A;  1K5G B;  4P7I A;  1X05 A;  1TJ6 A;  3DXD A;  2DFK A;  4CHM A;  2HE7 A;  4HAW B;  1Y19 B;  3U7D A;  1Z87 A;  3SO6 A;  4KVG B;  2E2X A;  2K2U A;  4A6H A;  4D0N B;  3N7C A;  2G35 A;  1TQZ A;  2I5C A;  4XWX A;  1XKE A;  1I2H A;  1AQC A;  1U5D A;  2J0M A;  1ZVR A;  2QKM A;  4F7H A;  3PZD A;  3ODO A;  3TO1 A;  3PG7 A;  3WA0 A;  4CYE A;  4MY6 A;  1NTY A;  1WGQ A;  2UVM A;  4C0A A;  3IVF A;  3PVW A;  3FSS A;  4HHV A;  1V5M A;  1FAO A;  1WGU A;  1W1D A;  1XOD A;  3TCA A;  4TKN A;  1P5T A;  4GXB A;  2IYB A;  5HE2 A;  2EC1 A;  1SHC A;  2YS3 A;  1BTN A;  2GCJ A;  3DXE A;  5HE3 A;  1X86 A;  1W1G A;  1IRS A;  3BJI A;  2ROZ B;  5D3V A;  2UZR A;  2XQN M;  1P6S A;  2D9Z A;  2P0H A;  2UZS A;  2V76 A;  1V88 A;  1U2B A;  3PSC A;  2M14 A;  5J3Q A;  1DDV A;  5DHF B;  1J19 A;  3M1I B;  2DHI A;  1V61 A;  1UEF A;  3X23 A;  5D3W A;  1Y5O A;  3SV1 A;  2YT0 A;  1XR0 B;  1XCG A;  3QIJ A;  4IOY X;  1NU2 A;  4NY0 A;  1LB1 A;  1QQG A;  3OAN A;  1FGY A;  1MK7 B;  2P0D A;  4HB4 B;  1ZSQ A;  1EAZ A;  1I7A A;  4BBK A;  1N3H A;  1WJ1 A;  1NI2 A;  1GG3 A;  4ZRJ A;  3CIK A;  1X1G A;  3TFM A;  1AWE A;  5C5B A;  1WVH A;  1ISN A;  1M7R A;  3MDB C;  2MFQ A;  2P8V A;  2Y7B A;  3HK0 A;  3LJU X;  2I5F A;  3D8F A;  3HQC A;  2EJ8 A;  2RVB B;  1GC6 A;  3AJ4 A;  1UNP A;  1KZ7 A;  2LYD A;  2ROV A;  4L6E A;  3A98 B;  2W2W A;  2LOX A;  1XX0 A;  2DYN A;  1FGZ A;  2EMT A;  4HB2 B;  2RLO A;  2Z0Q A;  1KI1 B;  1V5P A;  4KHB B;  3NSU A;  5C79 A;  2Z0P A;  3F0W A;  4B6H A;  5KCV A;  2LG1 A;  4DBB A;  5JHG A;  2ZPY A;  2PZ1 A;  5LOP B;  2K2J A;  3ODW A;  2D4Q A;  3CXB B;  5CLQ B;  1WI1 A;  2FJL A;  4EMO A;  1U5F A;  2J0J A;  5L81 A;  4HAZ B;  5D3X A;  4Z2M B;  5C16 A;  2YF0 A;  1QC6 A;  1K5D B;  4K2O A;  2K00 A;  2CRF A;  2DHJ A; 
#chains in the Genus database with same CATH topology
 2COA A;  4EJN A;  4GZU A;  4IFS A;  5DIF B;  1PLS A;  2DX5 A;  2J0K A;  4EKU A;  2Y8G A;  2KGX B;  2OTX A;  2ZKM X;  2W2X D;  4KAX B;  3U8Z A;  1V5U A;  2D11 A;  3FEH A;  4A6F A;  1MAI A;  2R09 A;  4HAV B;  3TVV A;  1FHO A;  4HB0 B;  2CAY A;  4HDQ A;  2J59 M;  3RCP A;  3SUZ A;  2DTC A;  1MK9 B;  1FB8 A;  2H7E A;  4DX8 A;  2N23 A;  3MPX A;  3KRX A;  3P6A A;  2X18 A;  2NZ8 B;  1EF1 A;  2AEH A;  2CY4 A;  4K81 A;  3D8E A;  4ZRI A;  4QJ4 B;  1OY2 A;  1DDM A;  2CY5 A;  4PNK A;  2COF A;  2KIG A;  1X1F A;  3AU4 A;  4HB3 B;  3UZT A;  2YT1 A;  3OHM B;  2H7D A;  3KRW A;  2VKI A;  4YON A;  2ADZ A;  2KIE A;  3F5R A;  3P7Z A;  4IAP A;  3BIN A;  1BTK A;  2GCL A;  2I1J A;  5FI1 A;  1DRO A;  3SNH A;  1U5G A;  2Y8F A;  5D3Y A;  3B77 A;  3PEG A;  4A6K A;  2Z0O A;  2R0D A;  2M38 A;  4DX9 0;  2VSZ A;  4GMV A;  5KQ4 A;  2YS5 A;  2BCJ A;  2HTH B;  4WVF B;  5DH9 B;  3PVL A;  3D8D A;  5M4Y B;  2JP2 A;  2LKO A;  2KUP A;  4K2P A;  4A5K A;  2D9V A;  1OQN A;  2GS0 A;  5C5B B;  4H8S A;  2I1K A;  2COC A;  4CHJ A;  1UPQ A;  2K49 A;  5CLL B;  4WSF A;  1DYN A;  1GC7 A;  2DLW A;  1P3R A;  3VIA A;  3FM8 C;  2YS1 A;  1WJM A;  2GJY A;  5DI9 B;  4HAT B;  1ZM0 A;  2D10 A;  2DN6 A;  4Y94 A;  1M7E A;  4MK0 A;  4TYZ A;  5KQ1 A;  2L1C A;  4PQ0 A;  3T06 A;  1KZG A;  4DXA B;  1Q67 A;  1WG7 A;  3DCX A;  5DHA B;  3ULB A;  1U29 A;  4NSW A;  4F7G A;  1SGH A;  2AL6 A;  5JP4 A;  1RRP B;  4HSI A;  5J3T A;  3GYP A;  2OQB A;  2RNR B;  3G9W A;  2MKR A;  4F7U P;  2DKQ A;  5LON B;  3KSY A;  1DBH A;  1RJ2 A;  2VRW B;  3ML4 A;  1FOE A;  3ULC A;  1PMS A;  2MWN B;  5GOW B;  5HE1 A;  2KUQ A;  4OSN A;  1H4R A;  3GYO A;  4MT7 A;  5HE0 A;  2LOZ A;  4HAY B;  5I2M A;  2Z14 A;  2LUL A;  3A8P A;  1FHW A;  4KHA A;  2YRY A;  1LW3 A;  4HAX B;  1ZC4 B;  2KCJ A;  2P0F A;  1W1H A;  1EGX A;  3FVC A;  2EMS A;  1PFJ A;  1T77 A;  2NBV A;  1FHX A;  3HSA A;  1BAK A;  1NTV A;  3PVU A;  1ZC3 B;  3QBV B;  3PP2 A;  1DDW A;  5FI0 A;  2D9Y A;  5C6R A;  2IFS A;  2QKL A;  1MIX A;  3NW8 A;  2RSG A;  1UNR A;  3SYX A;  3NWA A;  4A6F B;  1U5E A;  2NMB A;  4ZRK A;  3DXC A;  3ZVR A;  3WYF B;  2K8E A;  4CSQ A;  2RUK B;  4KHO A;  1BWN A;  2COD A;  3NWF A;  3KZ1 A;  1TXD A;  1X11 A;  4HAU B;  2ELA A;  1E5W A;  1OMW A;  3V5W A;  2L2I A;  2DKP A;  2DYQ A;  3HW2 B;  5JLJ B;  2Q13 A;  1XD4 A;  4HDO A;  1MIZ B;  4Z2N A;  1MKE A;  1EVH A;  1V89 A;  2RGN B;  2N0Y A;  2D9W A;  1UNQ A;  2YSZ A;  2W2X C;  1U27 A;  4GMX B;  3AU5 A;  3HIE A;  2YVC A;  1MPH A;  3O96 A;  1UPR A;  3U12 A;  2D2Q A;  5JHH A;  2MDX A;  3TW1 A;  2ELB A;  1H10 A;  3ODX A;  2D9X A;  5J3Y A;  3A8Q A;  3KY9 A;  4GN1 A;  4KHB A;  4OT1 A;  3QWM A;  1J0W A;  2DA0 A;  1B55 A;  3VOQ A;  4YL8 A;  2DX1 A;  2DHK A;  4WJ7 A;  4K17 A;  4D6W A;  4GPT B;  5D27 A;  5EFX A;  2Z59 A;  3ZDT A;  1K5G B;  4P7I A;  1X05 A;  1TJ6 A;  3DXD A;  2DFK A;  4CHM A;  2HE7 A;  4HAW B;  1Y19 B;  1MI1 A;  3U7D A;  1Z87 A;  3SO6 A;  4KVG B;  2RRF A;  2E2X A;  2K2U A;  4A6H A;  4D0N B;  3N7C A;  2G35 A;  1TQZ A;  2I5C A;  4XWX A;  1XKE A;  1I2H A;  1AQC A;  1U5D A;  2J0M A;  1ZVR A;  2QKM A;  4F7H A;  3PZD A;  3ODO A;  3TO1 A;  3PG7 A;  3WA0 A;  4CYE A;  2Z4D A;  4MY6 A;  1NTY A;  1WGQ A;  2UVM A;  4C0A A;  3IVF A;  3PVW A;  3FSS A;  4HHV A;  1V5M A;  1ZYI A;  1FAO A;  1WGU A;  1W1D A;  1XOD A;  3TCA A;  4TKN A;  1P5T A;  4GXB A;  2IYB A;  5HE2 A;  2EC1 A;  1SHC A;  2YS3 A;  5IRS A;  1BTN A;  2GCJ A;  3DXE A;  5HE3 A;  1X86 A;  1W1G A;  1IRS A;  3BJI A;  2ROZ B;  5D3V A;  2UZR A;  2XQN M;  1P6S A;  2D9Z A;  2P0H A;  2UZS A;  2V76 A;  1V88 A;  2GUM A;  1U2B A;  3PSC A;  5I2S A;  2M14 A;  5J3Q A;  1DDV A;  5DHF B;  1J19 A;  3M1I B;  2DHI A;  1V61 A;  1UEF A;  3X23 A;  5D3W A;  1Y5O A;  3SV1 A;  2YT0 A;  1XR0 B;  1XCG A;  3A58 A;  3QIJ A;  2Z13 A;  4IOY X;  1NU2 A;  4NY0 A;  1LB1 A;  1QQG A;  3OAN A;  1FGY A;  1MK7 B;  2P0D A;  2KR0 A;  4HB4 B;  1ZSQ A;  1EAZ A;  1I7A A;  4BBK A;  1N3H A;  1WJ1 A;  1NI2 A;  1GG3 A;  4ZRJ A;  3CIK A;  1X1G A;  3TFM A;  1AWE A;  5C5B A;  1WVH A;  1ISN A;  1M7R A;  3MDB C;  2MFQ A;  2P8V A;  2Y7B A;  3HK0 A;  3LJU X;  2I5F A;  3D8F A;  4GOU A;  3HQC A;  2EJ8 A;  2RVB B;  1GC6 A;  3AJ4 A;  1UNP A;  1KZ7 A;  2LYD A;  2ROV A;  4L6E A;  3A98 B;  2W2W A;  2LOX A;  1XX0 A;  2DYN A;  1FGZ A;  2EMT A;  4HB2 B;  5LG4 B;  2RLO A;  2Z0Q A;  1KI1 B;  4QJ5 B;  1V5P A;  4KHB B;  2R2Y A;  3NSU A;  5C79 A;  2Z0P A;  3F0W A;  4B6H A;  2FJU B;  2YT2 A;  5KCV A;  2LG1 A;  4DBB A;  5JHG A;  4DIX A;  4L1R A;  2ZPY A;  2PZ1 A;  3NWD A;  4QJ3 B;  5LOP B;  2K2J A;  3ODW A;  2D4Q A;  3CXB B;  5CLQ B;  1WI1 A;  2FJL A;  4EMO A;  1U5F A;  2J0J A;  5L81 A;  4HAZ B;  5D3X A;  4Z2M B;  5C16 A;  2YF0 A;  4QXA B;  1QC6 A;  1K5D B;  4K2O A;  2K00 A;  2CRF A;  2DHJ A;  4GNK B; 
#chains in the Genus database with same CATH homology
 2COA A;  4EJN A;  4GZU A;  4IFS A;  5DIF B;  1PLS A;  2DX5 A;  2J0K A;  4EKU A;  2Y8G A;  2KGX B;  2OTX A;  2W2X D;  4KAX B;  3U8Z A;  1V5U A;  2D11 A;  3FEH A;  4A6F A;  1MAI A;  2R09 A;  4HAV B;  3TVV A;  1FHO A;  4HB0 B;  2CAY A;  4HDQ A;  2J59 M;  3RCP A;  3SUZ A;  2DTC A;  1MK9 B;  1FB8 A;  2H7E A;  4DX8 A;  2N23 A;  3MPX A;  3KRX A;  3P6A A;  2X18 A;  2NZ8 B;  1EF1 A;  2AEH A;  2CY4 A;  4K81 A;  3D8E A;  4ZRI A;  1OY2 A;  1DDM A;  2CY5 A;  4PNK A;  2COF A;  1X1F A;  3AU4 A;  4HB3 B;  3UZT A;  2YT1 A;  2H7D A;  3KRW A;  2VKI A;  4YON A;  2ADZ A;  3F5R A;  3P7Z A;  4IAP A;  3BIN A;  1BTK A;  2GCL A;  2I1J A;  5FI1 A;  1DRO A;  3SNH A;  1U5G A;  2Y8F A;  5D3Y A;  3PEG A;  4A6K A;  2Z0O A;  2R0D A;  2M38 A;  4DX9 0;  2VSZ A;  4GMV A;  5KQ4 A;  2YS5 A;  2BCJ A;  2HTH B;  4WVF B;  5DH9 B;  3PVL A;  3D8D A;  2JP2 A;  2LKO A;  2KUP A;  4K2P A;  4A5K A;  2D9V A;  1OQN A;  2GS0 A;  5C5B B;  4H8S A;  2I1K A;  2COC A;  4CHJ A;  1UPQ A;  5CLL B;  4WSF A;  1DYN A;  1GC7 A;  2DLW A;  1P3R A;  3VIA A;  3FM8 C;  2YS1 A;  1WJM A;  2GJY A;  5DI9 B;  4HAT B;  1ZM0 A;  2D10 A;  2DN6 A;  4Y94 A;  1M7E A;  4MK0 A;  4TYZ A;  5KQ1 A;  2L1C A;  4PQ0 A;  3T06 A;  1KZG A;  4DXA B;  1Q67 A;  1WG7 A;  5DHA B;  3ULB A;  1U29 A;  4NSW A;  4F7G A;  1SGH A;  2AL6 A;  5JP4 A;  1RRP B;  5J3T A;  3GYP A;  2OQB A;  2RNR B;  3G9W A;  2MKR A;  4F7U P;  2DKQ A;  5LON B;  3KSY A;  1DBH A;  1RJ2 A;  2VRW B;  3ML4 A;  1FOE A;  3ULC A;  1PMS A;  2MWN B;  5GOW B;  5HE1 A;  1H4R A;  3GYO A;  4MT7 A;  5HE0 A;  2LOZ A;  4HAY B;  2LUL A;  3A8P A;  1FHW A;  4KHA A;  2YRY A;  1LW3 A;  4HAX B;  1ZC4 B;  2KCJ A;  2P0F A;  1W1H A;  1EGX A;  2EMS A;  1PFJ A;  1FHX A;  1BAK A;  1NTV A;  3PVU A;  1ZC3 B;  3QBV B;  3PP2 A;  1DDW A;  5FI0 A;  2D9Y A;  5C6R A;  2IFS A;  2QKL A;  1MIX A;  2RSG A;  1UNR A;  3SYX A;  4A6F B;  1U5E A;  2NMB A;  4ZRK A;  3DXC A;  3ZVR A;  3WYF B;  2RUK B;  4KHO A;  1BWN A;  2COD A;  3KZ1 A;  1TXD A;  1X11 A;  4HAU B;  2ELA A;  1E5W A;  1OMW A;  3V5W A;  2L2I A;  2DKP A;  2DYQ A;  3HW2 B;  5JLJ B;  2Q13 A;  1XD4 A;  4HDO A;  1MIZ B;  4Z2N A;  1MKE A;  1EVH A;  1V89 A;  2RGN B;  2N0Y A;  2D9W A;  1UNQ A;  2YSZ A;  2W2X C;  1U27 A;  4GMX B;  3AU5 A;  2YVC A;  1MPH A;  3O96 A;  1UPR A;  2D2Q A;  5JHH A;  2MDX A;  3TW1 A;  2ELB A;  1H10 A;  3ODX A;  2D9X A;  5J3Y A;  3A8Q A;  3KY9 A;  4GN1 A;  3QWM A;  1J0W A;  2DA0 A;  1B55 A;  3VOQ A;  4YL8 A;  2DX1 A;  2DHK A;  4WJ7 A;  4K17 A;  4GPT B;  5D27 A;  5EFX A;  3ZDT A;  1K5G B;  4P7I A;  1X05 A;  1TJ6 A;  3DXD A;  2DFK A;  4CHM A;  2HE7 A;  4HAW B;  1Y19 B;  3U7D A;  1Z87 A;  3SO6 A;  4KVG B;  2E2X A;  2K2U A;  4A6H A;  4D0N B;  3N7C A;  2G35 A;  1TQZ A;  2I5C A;  4XWX A;  1XKE A;  1I2H A;  1AQC A;  1U5D A;  2J0M A;  1ZVR A;  2QKM A;  4F7H A;  3PZD A;  3ODO A;  3TO1 A;  3PG7 A;  3WA0 A;  4CYE A;  4MY6 A;  1NTY A;  1WGQ A;  2UVM A;  4C0A A;  3IVF A;  3PVW A;  3FSS A;  4HHV A;  1V5M A;  1FAO A;  1WGU A;  1W1D A;  1XOD A;  3TCA A;  4TKN A;  1P5T A;  4GXB A;  2IYB A;  5HE2 A;  2EC1 A;  1SHC A;  2YS3 A;  1BTN A;  2GCJ A;  3DXE A;  5HE3 A;  1X86 A;  1W1G A;  1IRS A;  3BJI A;  2ROZ B;  5D3V A;  2UZR A;  2XQN M;  1P6S A;  2D9Z A;  2P0H A;  2UZS A;  2V76 A;  1V88 A;  1U2B A;  3PSC A;  2M14 A;  5J3Q A;  1DDV A;  5DHF B;  1J19 A;  3M1I B;  2DHI A;  1V61 A;  1UEF A;  3X23 A;  5D3W A;  1Y5O A;  3SV1 A;  2YT0 A;  1XR0 B;  1XCG A;  3QIJ A;  4IOY X;  1NU2 A;  4NY0 A;  1LB1 A;  1QQG A;  3OAN A;  1FGY A;  1MK7 B;  2P0D A;  4HB4 B;  1ZSQ A;  1EAZ A;  1I7A A;  4BBK A;  1N3H A;  1WJ1 A;  1NI2 A;  1GG3 A;  4ZRJ A;  3CIK A;  1X1G A;  3TFM A;  1AWE A;  5C5B A;  1WVH A;  1ISN A;  1M7R A;  3MDB C;  2MFQ A;  2P8V A;  2Y7B A;  3HK0 A;  3LJU X;  2I5F A;  3D8F A;  3HQC A;  2EJ8 A;  2RVB B;  1GC6 A;  3AJ4 A;  1UNP A;  1KZ7 A;  2LYD A;  2ROV A;  4L6E A;  3A98 B;  2W2W A;  2LOX A;  1XX0 A;  2DYN A;  1FGZ A;  2EMT A;  4HB2 B;  2RLO A;  2Z0Q A;  1KI1 B;  1V5P A;  4KHB B;  3NSU A;  5C79 A;  2Z0P A;  3F0W A;  4B6H A;  5KCV A;  2LG1 A;  4DBB A;  5JHG A;  2ZPY A;  2PZ1 A;  5LOP B;  2K2J A;  3ODW A;  2D4Q A;  3CXB B;  5CLQ B;  1WI1 A;  2FJL A;  4EMO A;  1U5F A;  2J0J A;  5L81 A;  4HAZ B;  5D3X A;  4Z2M B;  5C16 A;  2YF0 A;  1QC6 A;  1K5D B;  4K2O A;  2K00 A;  2CRF A;  2DHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...