2FJRA

Crystal structure of bacteriophage 186
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
189
structure length
189
Chain Sequence
DSLGWSNVDVLDRICEAYGFSQKIQLANHFDIASSSLSNRYTRGAISYDFAAHCALETGANLQWLLTGEGEAFVNNRESSDAKRIEGFTLSEEILKSDKQLSVDAQFFTKPLTDGMAIRSEGKIYFVDKQASLSDGLWLVDIKGAISIRELTKLPGRKLHVAGGKVPFECGIDDIKTLGRVVGVYSEVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of cooperative regulation at an alternate genetic switch
pubmed doi rcsb
source organism Enterobacteria phage 186
molecule tags Transcription regulator
molecule keywords Repressor protein CI
total genus 41
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07022 Phage_CI_repr Bacteriophage CI repressor helix-turn-helix domain
A PF16452 Phage_CI_C Bacteriophage CI repressor C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2fjrA01
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 2fjrA02
1PRVA 3ZKCA 2JCGA 2AUWA 3OQOA 1JWLA 4PU3C 2FKDA 2OFYA 4X4EA 1Y7YA 2OR1L 1ADRA 1XWRA 1BDHA 1QP4A 4K8WA 1LLIA 1R69A 2ICTA 3D1NI 2O38A 2PUGA 1X57A 2O49A 1JHHA 2FJRA 3CLCA 1POUA 3F6WA 2AXUA 3GBFA 2EBYA 2WIUB 4MCTA 1JHEA 1DWKA 3GN5A 4JCYA 4X4BA 1F39A 3G5GA 1WH8A 3R1FA 2CROA 3BD1A 1RIOA 1BDIA 3OP9A 4I6UA 4MCXA 1JFTA 4J1XA 4YG7B 1QP0A 1QQBA 4X4HA 3LISA 1AY9A 4Z5HA 4FN3A 1T7DA 1E3OC 2LYJA 3B7HA 1ZZ7A 3U3WA 1X2LA 4OB4A 1OCTC 1WETA 2IVGA 1JHCA 2O4AA 1RZRA 3ZHMA 3OMTA 1RZSA 1B0NA 3QYXA 1S7EA 1SQ8A 3F52A 4YG1A 1ZAYA 2GRMA 3FYAA 3QQ6A 3HZIB 2KZ8A 2KEIA 4IWRA 3UFDA 2LCVA 3OQNA 2B5AA 4J1WA 1WIZA 2GZUA 2IU7A 4Z5CA 4JQDA 4ME8A 2PUDA 2EF8A 4X4IA 1RPEL 2D5VA 1KN9A 2PUBA 2PPXA 3IVPA 3PXPA 3QF3A 2LYKA 3TRBA 2PUEA 2R1JL 1JFSA 3JXDL 1ZZBA 2PUCA 1PRUA 1ZUGA 2HINA 3ZHIA 2GRLA 1RZRD 4GQMA 4PU4C 3O9XA 2KEKA 2KEJA 1KCAA 4I8TA 2LYRA 4Z58A 3KJXA 1UTXA 1ZZCA 3LFPA 1AU7A 4O8BA 2AXZA 1ZS4A 1O4XA 2PIJA 4I6RA 2L8NA 4I6TA 1WH6A 4NDWA 2A6CA 1ZZ8A 2KPJA 3FYMA 1QPZA 2IUOA 4FBIA 1B12A 2JVLA 2XCJA 1NERA 4Z59A 3L1PA 1CJGA 1EFAA 2HNFA 2R63A 1PERL 4JCXA 4N31A 2HSGA 3JXBC 1YSEA 4X4DA 2WUSR 3CROL 1LMB3 1Y9QA 1PNRA 2BNMA 2AWIA 2XJ3A 2XI8A 1JH9A 1ZZ6A 4X4GA 4Z5DA 3GN5B 2BJCA 1CQTA 3K2ZA 3MLFA 2AXVA 2CSFA 2IV1A 2L49A 2EWTA 2XSDC 3S8QA 4NV4A 2LYQA 3KZ3A 1UXDA 1HF0A 1QP7A 1QQAA 2PE5A 1ZVVA 2BNOA 2XIUA 3IIQA 3BS3A 1VPWA 2PUAA 3QWGA 1LCCA 2ICPA 1UXCA 2LYPA 3FMYA 4Y42A 2LYLA 3CECA 1NEQA 4YG4A 2MEZA 5K98B 1L1MA 2IVQA 3VK0A 1R63A 4IVZA 3SCHA 3F51A 1OSLA 2PUFA 3JXCL 1ZPQA 3H5TA 4PU7A 4YARA 4X4FA 2H8RA 2HO0A 3S04A 3SCFA 4PU8A 4X4CA 3EUSA 3KXAA 2LYSA 1GT0C 1UMUA 3BDNA 4GHJA 2IVBA 4IA8A 1PRAA 5A7LA 2AW6A 3G7DA 1DW9A 1I4VA 1IC8A 1LQCA 2BNNA 3DNVB 1LCDA 3JSPA 3RZZA 3OQMA 3JSOA 4YBAA 1JHFA 4F8DA 1ZZ9A 2MQKA 3SCGA
chains in the Genus database with same CATH superfamily
3ZKCA 1QB2A 2OFYA 4X4EA 1U2ZA 2OR1L 1XWRA 1BDHA 1R69A 3TFLA 5DRTA 3NDBB 4X4BA 1F39A 2J7WA 3QOXA 4MCXA 1JFTA 2PXKA 1QQBA 3PE5A 1MFQC 4Z5HA 1T7DA 1DULA 3U3WA 3OMTA 1RZSA 1ZAYA 4YG1A 3QQ6A 3OQNA 4J1WA 4JQDA 5DTQA 2LYKA 1JFSA 2PUCA 4EZIA 3ZHIA 2GRLA 3O9XA 1KCAA 4I8TA 3DM5A 1UTXA 4HRAA 1AU7A 4FBIA 3L1PA 1EFAA 4ER6A 4JCXA 3GZDC 1PNRA 2XJ3A 4X4GA 2BJCA 3GN5B 2XSDC 2CSFA 2IV1A 2EWTA 1HF0A 1QQAA 2PE5A 1ZVVA 1VPWA 2KEJA 2ICPA 3FMYA 3CECA 5K98B 1R63A 1OSLA 2V3CC 4YARA 3SCFA 2LYSA 2IVBA 3TELA 3G7DA 1DW9A 3LQXA 1LQCA 2BNNA 3OKZA 3VWSA 3NXHA 3OQMA 5GAHi 4YBAA 5DRYA 2PXTA 3UFDA 2MQKA 3SCGA 2PUGA 2MXDA 3GBFA 4MCTA 1DWKA 3GN5A 3MEJA 3R1FA 3BD1A 4YG7B 3B7HA 1OCTC 2IVGA 1RZRA 3ZHMA 2HFZA 1B0NA 3QYXA 1SQ8A 3F52A 2GRMA 3SX0A 2JQEA 4IWRA 1WIZA 3GZCA 4X4IA 2ODRD 1KN9A 2PPXA 4DE9A 3IVPA 2R1JL 1PRUA 3ZPXA 1RZRD 4PU4C 2LYRA 3KJXA 1ZZCA 1ZS4A 2PIJA 4I6TA 1WH6A 3FYMA 1B12A 2IUOA 5JUWA 2XCJA 2LNMA 2HNFA 1PERL 3R09A 3JXBC 2WUSR 3CROL 1Y9QA 2AWIA 3K2ZA 2LYQA 1QP7A 2BNOA 2XIUA 3BS3A 5DSXA 4Y42A 2J7UA 2IVQA 5DTMA 3SR4A 1ZPQA 3JXCL 4X4FA 2HO0A 2M4HA 4X4CA 3EUSA 3KXAA 1GT0C 3BDNA 1PRAA 5A7LA 1I4VA 3JSPA 4OB4A 2FFHA 1PRVA 3OQOA 4PU3C 2FKDA 3M9LA 1QP4A 3D1NI 2O38A 3F6WA 2AXUA 2EBYA 4DE8A 4ER7A 4ER0A 3G5GA 1WH8A 2CROA 1RIOA 3OP9A 4X4HA 4FN3A 1E3OC 2LYJA 1WETA 3FYAA 3HZIB 2LCVA 4ME8A 2IU7A 2PUDA 2EF8A 1RPEL 2PUBA 4ER3A 1ZZBA 1ZUGA 2HINA 3OWQA 4Z58A 2PXVA 3LFPA 3TEPA 1O4XA 4EKIA 4I6RA 3QFIA 4NDWA 2KPJA 1QPZA 4Z59A 1CJGA 3GUUA 4N31A 4X4DA 2BNMA 2XXQA 2LLWA 2XI8A 1JH9A 1ZZ6A 4Z5DA 1CQTA 2AXVA 2L49A 3S8QA 3KZ3A 3IIQA 3QWGA 1NW3A 1LCCA 2MEZA 3SCHA 4IVZA 3H5TA 4PU7A 2H8RA 3GZDA 4GHJA 2PXFA 4IA8A 1IC8A 3DNVB 1JHFA 4F8DA 4Q2JA 4OBMA 4EK9A 2JCGA 2AUWA 1JWLA 1Y7YA 1ADRA 4K8WA 1LLIA 2ICTA 2LLVA 3A9YA 1X57A 2O49A 1JHHA 2FJRA 3CLCA 1POUA 2WIUB 1JHEA 4EQZA 3ME5A 4JCYA 2PXLA 2YBDA 1BDIA 4I6UA 1QP0A 3LISA 1AY9A 3NZLA 1ZZ7A 1JHCA 1X2LA 2O4AA 1S7EA 2KZ8A 2KEIA 2HCNA 2B5AA 2GZUA 4Z5CA 2HCSA 2D5VA 3PXPA 3QF3A 3TRBA 2PUEA 4EKGA 2PXQA 3JXDL 5DT2A 4GQMA 3NROA 2KEKA 2PXDA 2PXEA 4O8BA 2AXZA 2L8NA 2A6CA 1ZZ8A 2PXBA 2JVLA 3KL4A 1NERA 3G0TA 4WVLA 2R63A 2HSGA 1YSEA 3A9ZA 1LMB3 2L1PA 2VEOA 5GAGi 2PXUA 3MLFA 3UWPA 4NV4A 1UXDA 2PUAA 3A9XA 1HQ1A 1UXCA 2LYPA 4YG4A 1QZXA 2LYLA 1NEQA 2XXPA 1L1MA 3VK0A 2PUFA 3F51A 2XXAA 3S04A 4PU8A 4ER5A 1UMUA 2PXPA 2AW6A 5DTRA 3QOWA 1LCDA 3RZZA 3JSOA 1ZZ9A 4J1XA
chains in the Genus database with same CATH topology
1PRVA 3ZKCA 2JCGA 2AUWA 3OQOA 1JWLA 4PU3C 2FKDA 2OFYA 4X4EA 1Y7YA 2OR1L 1ADRA 1XWRA 1BDHA 1QP4A 4K8WA 1LLIA 1R69A 2ICTA 3D1NI 2O38A 2PUGA 1X57A 2O49A 1JHHA 2FJRA 3CLCA 1POUA 3F6WA 2AXUA 3GBFA 2EBYA 2WIUB 4MCTA 1JHEA 1DWKA 3GN5A 4JCYA 4X4BA 1F39A 3G5GA 1WH8A 3R1FA 2CROA 3BD1A 1RIOA 1BDIA 3OP9A 4I6UA 4MCXA 1JFTA 4J1XA 4YG7B 1QP0A 1QQBA 4X4HA 3LISA 1AY9A 4Z5HA 4FN3A 1T7DA 1E3OC 2LYJA 3B7HA 1ZZ7A 3U3WA 1X2LA 4OB4A 1OCTC 1WETA 2IVGA 1JHCA 2O4AA 1RZRA 3ZHMA 3OMTA 1RZSA 1B0NA 3QYXA 1S7EA 1SQ8A 3F52A 4YG1A 1ZAYA 2GRMA 3FYAA 3QQ6A 3HZIB 2KZ8A 2KEIA 4IWRA 3UFDA 2LCVA 3OQNA 2B5AA 4J1WA 1WIZA 2GZUA 2IU7A 4Z5CA 4JQDA 4ME8A 2PUDA 2EF8A 4X4IA 1RPEL 2D5VA 1KN9A 2PUBA 2PPXA 3IVPA 3PXPA 3QF3A 2LYKA 3TRBA 2PUEA 2R1JL 1JFSA 3JXDL 1ZZBA 2PUCA 1PRUA 1ZUGA 2HINA 3ZHIA 2GRLA 1RZRD 4GQMA 4PU4C 3O9XA 2KEKA 2KEJA 1KCAA 4I8TA 2LYRA 4Z58A 3KJXA 1UTXA 1ZZCA 3LFPA 1AU7A 4O8BA 2AXZA 1ZS4A 1O4XA 2PIJA 4I6RA 2L8NA 4I6TA 1WH6A 4NDWA 2A6CA 1ZZ8A 2KPJA 3FYMA 1QPZA 2IUOA 4FBIA 1B12A 2JVLA 2XCJA 1NERA 4Z59A 3L1PA 1CJGA 1EFAA 2HNFA 2R63A 1PERL 4JCXA 4N31A 2HSGA 3JXBC 1YSEA 4X4DA 2WUSR 3CROL 1LMB3 1Y9QA 1PNRA 2BNMA 2AWIA 2XJ3A 2XI8A 1JH9A 1ZZ6A 4X4GA 4Z5DA 3GN5B 2BJCA 1CQTA 3K2ZA 3MLFA 2AXVA 2CSFA 2IV1A 2L49A 2EWTA 2XSDC 3S8QA 4NV4A 2LYQA 3KZ3A 1UXDA 1HF0A 1QP7A 1QQAA 2PE5A 1ZVVA 2BNOA 2XIUA 3IIQA 3BS3A 1VPWA 2PUAA 3QWGA 1LCCA 2ICPA 1UXCA 2LYPA 3FMYA 4Y42A 2LYLA 3CECA 1NEQA 4YG4A 2MEZA 5K98B 1L1MA 2IVQA 3VK0A 1R63A 4IVZA 3SCHA 3F51A 1OSLA 2PUFA 3JXCL 1ZPQA 3H5TA 4PU7A 4YARA 4X4FA 2H8RA 2HO0A 3S04A 3SCFA 4PU8A 4X4CA 3EUSA 3KXAA 2LYSA 1GT0C 1UMUA 3BDNA 4GHJA 2IVBA 4IA8A 1PRAA 5A7LA 2AW6A 3G7DA 1DW9A 1I4VA 1IC8A 1LQCA 2BNNA 3DNVB 1LCDA 3JSPA 3RZZA 3OQMA 3JSOA 4YBAA 1JHFA 4F8DA 1ZZ9A 2MQKA 3SCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRV A;  3ZKC A;  2JCG A;  2AUW A;  3OQO A;  1JWL A;  4PU3 C;  2FKD A;  2OFY A;  4X4E A;  1Y7Y A;  2OR1 L;  1ADR A;  1XWR A;  1BDH A;  1QP4 A;  4K8W A;  1LLI A;  1R69 A;  2ICT A;  3D1N I;  2O38 A;  2PUG A;  1X57 A;  2O49 A;  1JHH A;  2FJR A;  3CLC A;  1POU A;  3F6W A;  2AXU A;  3GBF A;  2EBY A;  2WIU B;  4MCT A;  1JHE A;  1DWK A;  3GN5 A;  4JCY A;  4X4B A;  1F39 A;  3G5G A;  1WH8 A;  3R1F A;  2CRO A;  3BD1 A;  1RIO A;  1BDI A;  3OP9 A;  4I6U A;  4MCX A;  1JFT A;  4J1X A;  4YG7 B;  1QP0 A;  1QQB A;  4X4H A;  3LIS A;  1AY9 A;  4Z5H A;  4FN3 A;  1T7D A;  1E3O C;  2LYJ A;  3B7H A;  1ZZ7 A;  3U3W A;  1X2L A;  4OB4 A;  1OCT C;  1WET A;  2IVG A;  1JHC A;  2O4A A;  1RZR A;  3ZHM A;  3OMT A;  1RZS A;  1B0N A;  3QYX A;  1S7E A;  1SQ8 A;  3F52 A;  4YG1 A;  1ZAY A;  2GRM A;  3FYA A;  3QQ6 A;  3HZI B;  2KZ8 A;  2KEI A;  4IWR A;  3UFD A;  2LCV A;  3OQN A;  2B5A A;  4J1W A;  1WIZ A;  2GZU A;  2IU7 A;  4Z5C A;  4JQD A;  4ME8 A;  2PUD A;  2EF8 A;  4X4I A;  1RPE L;  2D5V A;  1KN9 A;  2PUB A;  2PPX A;  3IVP A;  3PXP A;  3QF3 A;  2LYK A;  3TRB A;  2PUE A;  2R1J L;  1JFS A;  3JXD L;  1ZZB A;  2PUC A;  1PRU A;  1ZUG A;  2HIN A;  3ZHI A;  2GRL A;  1RZR D;  4GQM A;  4PU4 C;  3O9X A;  2KEK A;  2KEJ A;  1KCA A;  4I8T A;  2LYR A;  4Z58 A;  3KJX A;  1UTX A;  1ZZC A;  3LFP A;  1AU7 A;  4O8B A;  2AXZ A;  1ZS4 A;  1O4X A;  2PIJ A;  4I6R A;  2L8N A;  4I6T A;  1WH6 A;  4NDW A;  2A6C A;  1ZZ8 A;  2KPJ A;  3FYM A;  1QPZ A;  2IUO A;  4FBI A;  1B12 A;  2JVL A;  2XCJ A;  1NER A;  4Z59 A;  3L1P A;  1CJG A;  1EFA A;  2HNF A;  2R63 A;  1PER L;  4JCX A;  4N31 A;  2HSG A;  3JXB C;  1YSE A;  4X4D A;  2WUS R;  3CRO L;  1LMB 3;  1Y9Q A;  1PNR A;  2BNM A;  2AWI A;  2XJ3 A;  2XI8 A;  1JH9 A;  1ZZ6 A;  4X4G A;  4Z5D A;  3GN5 B;  2BJC A;  1CQT A;  3K2Z A;  3MLF A;  2AXV A;  2CSF A;  2IV1 A;  2L49 A;  2EWT A;  2XSD C;  3S8Q A;  4NV4 A;  2LYQ A;  3KZ3 A;  1UXD A;  1HF0 A;  1QP7 A;  1QQA A;  2PE5 A;  1ZVV A;  2BNO A;  2XIU A;  3IIQ A;  3BS3 A;  1VPW A;  2PUA A;  3QWG A;  1LCC A;  2ICP A;  1UXC A;  2LYP A;  3FMY A;  4Y42 A;  2LYL A;  3CEC A;  1NEQ A;  4YG4 A;  2MEZ A;  5K98 B;  1L1M A;  2IVQ A;  3VK0 A;  1R63 A;  4IVZ A;  3SCH A;  3F51 A;  1OSL A;  2PUF A;  3JXC L;  1ZPQ A;  3H5T A;  4PU7 A;  4YAR A;  4X4F A;  2H8R A;  2HO0 A;  3S04 A;  3SCF A;  4PU8 A;  4X4C A;  3EUS A;  3KXA A;  2LYS A;  1GT0 C;  1UMU A;  3BDN A;  4GHJ A;  2IVB A;  4IA8 A;  1PRA A;  5A7L A;  2AW6 A;  3G7D A;  1DW9 A;  1I4V A;  1IC8 A;  1LQC A;  2BNN A;  3DNV B;  1LCD A;  3JSP A;  3RZZ A;  3OQM A;  3JSO A;  4YBA A;  1JHF A;  4F8D A;  1ZZ9 A;  2MQK A;  3SCG A; 
#chains in the Genus database with same CATH topology
 3ZKC A;  1QB2 A;  2OFY A;  4X4E A;  1U2Z A;  2OR1 L;  1XWR A;  1BDH A;  1R69 A;  3TFL A;  5DRT A;  3NDB B;  4X4B A;  1F39 A;  2J7W A;  3QOX A;  4MCX A;  1JFT A;  2PXK A;  1QQB A;  3PE5 A;  1MFQ C;  4Z5H A;  1T7D A;  1DUL A;  3U3W A;  3OMT A;  1RZS A;  1ZAY A;  4YG1 A;  3QQ6 A;  3OQN A;  4J1W A;  4JQD A;  5DTQ A;  2LYK A;  1JFS A;  2PUC A;  4EZI A;  3ZHI A;  2GRL A;  3O9X A;  1KCA A;  4I8T A;  3DM5 A;  1UTX A;  4HRA A;  1AU7 A;  4FBI A;  3L1P A;  1EFA A;  4ER6 A;  4JCX A;  3GZD C;  1PNR A;  2XJ3 A;  4X4G A;  2BJC A;  3GN5 B;  2XSD C;  2CSF A;  2IV1 A;  2EWT A;  1HF0 A;  1QQA A;  2PE5 A;  1ZVV A;  1VPW A;  2KEJ A;  2ICP A;  3FMY A;  3CEC A;  5K98 B;  1R63 A;  1OSL A;  2V3C C;  4YAR A;  3SCF A;  2LYS A;  2IVB A;  3TEL A;  3G7D A;  1DW9 A;  3LQX A;  1LQC A;  2BNN A;  3OKZ A;  3VWS A;  3NXH A;  3OQM A;  5GAH i;  4YBA A;  5DRY A;  2PXT A;  3UFD A;  2MQK A;  3SCG A;  2PUG A;  2MXD A;  3GBF A;  4MCT A;  1DWK A;  3GN5 A;  3MEJ A;  3R1F A;  3BD1 A;  4YG7 B;  3B7H A;  1OCT C;  2IVG A;  1RZR A;  3ZHM A;  2HFZ A;  1B0N A;  3QYX A;  1SQ8 A;  3F52 A;  2GRM A;  3SX0 A;  2JQE A;  4IWR A;  1WIZ A;  3GZC A;  4X4I A;  2ODR D;  1KN9 A;  2PPX A;  4DE9 A;  3IVP A;  2R1J L;  1PRU A;  3ZPX A;  1RZR D;  4PU4 C;  2LYR A;  3KJX A;  1ZZC A;  1ZS4 A;  2PIJ A;  4I6T A;  1WH6 A;  3FYM A;  1B12 A;  2IUO A;  5JUW A;  2XCJ A;  2LNM A;  2HNF A;  1PER L;  3R09 A;  3JXB C;  2WUS R;  3CRO L;  1Y9Q A;  2AWI A;  3K2Z A;  2LYQ A;  1QP7 A;  2BNO A;  2XIU A;  3BS3 A;  5DSX A;  4Y42 A;  2J7U A;  2IVQ A;  5DTM A;  3SR4 A;  1ZPQ A;  3JXC L;  4X4F A;  2HO0 A;  2M4H A;  4X4C A;  3EUS A;  3KXA A;  1GT0 C;  3BDN A;  1PRA A;  5A7L A;  1I4V A;  3JSP A;  4OB4 A;  2FFH A;  1PRV A;  3OQO A;  4PU3 C;  2FKD A;  3M9L A;  1QP4 A;  3D1N I;  2O38 A;  3F6W A;  2AXU A;  2EBY A;  4DE8 A;  4ER7 A;  4ER0 A;  3G5G A;  1WH8 A;  2CRO A;  1RIO A;  3OP9 A;  4X4H A;  4FN3 A;  1E3O C;  2LYJ A;  1WET A;  3FYA A;  3HZI B;  2LCV A;  4ME8 A;  2IU7 A;  2PUD A;  2EF8 A;  1RPE L;  2PUB A;  4ER3 A;  1ZZB A;  1ZUG A;  2HIN A;  3OWQ A;  4Z58 A;  2PXV A;  3LFP A;  3TEP A;  1O4X A;  4EKI A;  4I6R A;  3QFI A;  4NDW A;  2KPJ A;  1QPZ A;  4Z59 A;  1CJG A;  3GUU A;  4N31 A;  4X4D A;  2BNM A;  2XXQ A;  2LLW A;  2XI8 A;  1JH9 A;  1ZZ6 A;  4Z5D A;  1CQT A;  2AXV A;  2L49 A;  3S8Q A;  3KZ3 A;  3IIQ A;  3QWG A;  1NW3 A;  1LCC A;  2MEZ A;  3SCH A;  4IVZ A;  3H5T A;  4PU7 A;  2H8R A;  3GZD A;  4GHJ A;  2PXF A;  4IA8 A;  1IC8 A;  3DNV B;  1JHF A;  4F8D A;  4Q2J A;  4OBM A;  4EK9 A;  2JCG A;  2AUW A;  1JWL A;  1Y7Y A;  1ADR A;  4K8W A;  1LLI A;  2ICT A;  2LLV A;  3A9Y A;  1X57 A;  2O49 A;  1JHH A;  2FJR A;  3CLC A;  1POU A;  2WIU B;  1JHE A;  4EQZ A;  3ME5 A;  4JCY A;  2PXL A;  2YBD A;  1BDI A;  4I6U A;  1QP0 A;  3LIS A;  1AY9 A;  3NZL A;  1ZZ7 A;  1JHC A;  1X2L A;  2O4A A;  1S7E A;  2KZ8 A;  2KEI A;  2HCN A;  2B5A A;  2GZU A;  4Z5C A;  2HCS A;  2D5V A;  3PXP A;  3QF3 A;  3TRB A;  2PUE A;  4EKG A;  2PXQ A;  3JXD L;  5DT2 A;  4GQM A;  3NRO A;  2KEK A;  2PXD A;  2PXE A;  4O8B A;  2AXZ A;  2L8N A;  2A6C A;  1ZZ8 A;  2PXB A;  2JVL A;  3KL4 A;  1NER A;  3G0T A;  4WVL A;  2R63 A;  2HSG A;  1YSE A;  3A9Z A;  1LMB 3;  2L1P A;  2VEO A;  5GAG i;  2PXU A;  3MLF A;  3UWP A;  4NV4 A;  1UXD A;  2PUA A;  3A9X A;  1HQ1 A;  1UXC A;  2LYP A;  4YG4 A;  1QZX A;  2LYL A;  1NEQ A;  2XXP A;  1L1M A;  3VK0 A;  2PUF A;  3F51 A;  2XXA A;  3S04 A;  4PU8 A;  4ER5 A;  1UMU A;  2PXP A;  2AW6 A;  5DTR A;  3QOW A;  1LCD A;  3RZZ A;  3JSO A;  1ZZ9 A;  4J1X A; 
#chains in the Genus database with same CATH homology
 1PRV A;  3ZKC A;  2JCG A;  2AUW A;  3OQO A;  1JWL A;  4PU3 C;  2FKD A;  2OFY A;  4X4E A;  1Y7Y A;  2OR1 L;  1ADR A;  1XWR A;  1BDH A;  1QP4 A;  4K8W A;  1LLI A;  1R69 A;  2ICT A;  3D1N I;  2O38 A;  2PUG A;  1X57 A;  2O49 A;  1JHH A;  2FJR A;  3CLC A;  1POU A;  3F6W A;  2AXU A;  3GBF A;  2EBY A;  2WIU B;  4MCT A;  1JHE A;  1DWK A;  3GN5 A;  4JCY A;  4X4B A;  1F39 A;  3G5G A;  1WH8 A;  3R1F A;  2CRO A;  3BD1 A;  1RIO A;  1BDI A;  3OP9 A;  4I6U A;  4MCX A;  1JFT A;  4J1X A;  4YG7 B;  1QP0 A;  1QQB A;  4X4H A;  3LIS A;  1AY9 A;  4Z5H A;  4FN3 A;  1T7D A;  1E3O C;  2LYJ A;  3B7H A;  1ZZ7 A;  3U3W A;  1X2L A;  4OB4 A;  1OCT C;  1WET A;  2IVG A;  1JHC A;  2O4A A;  1RZR A;  3ZHM A;  3OMT A;  1RZS A;  1B0N A;  3QYX A;  1S7E A;  1SQ8 A;  3F52 A;  4YG1 A;  1ZAY A;  2GRM A;  3FYA A;  3QQ6 A;  3HZI B;  2KZ8 A;  2KEI A;  4IWR A;  3UFD A;  2LCV A;  3OQN A;  2B5A A;  4J1W A;  1WIZ A;  2GZU A;  2IU7 A;  4Z5C A;  4JQD A;  4ME8 A;  2PUD A;  2EF8 A;  4X4I A;  1RPE L;  2D5V A;  1KN9 A;  2PUB A;  2PPX A;  3IVP A;  3PXP A;  3QF3 A;  2LYK A;  3TRB A;  2PUE A;  2R1J L;  1JFS A;  3JXD L;  1ZZB A;  2PUC A;  1PRU A;  1ZUG A;  2HIN A;  3ZHI A;  2GRL A;  1RZR D;  4GQM A;  4PU4 C;  3O9X A;  2KEK A;  2KEJ A;  1KCA A;  4I8T A;  2LYR A;  4Z58 A;  3KJX A;  1UTX A;  1ZZC A;  3LFP A;  1AU7 A;  4O8B A;  2AXZ A;  1ZS4 A;  1O4X A;  2PIJ A;  4I6R A;  2L8N A;  4I6T A;  1WH6 A;  4NDW A;  2A6C A;  1ZZ8 A;  2KPJ A;  3FYM A;  1QPZ A;  2IUO A;  4FBI A;  1B12 A;  2JVL A;  2XCJ A;  1NER A;  4Z59 A;  3L1P A;  1CJG A;  1EFA A;  2HNF A;  2R63 A;  1PER L;  4JCX A;  4N31 A;  2HSG A;  3JXB C;  1YSE A;  4X4D A;  2WUS R;  3CRO L;  1LMB 3;  1Y9Q A;  1PNR A;  2BNM A;  2AWI A;  2XJ3 A;  2XI8 A;  1JH9 A;  1ZZ6 A;  4X4G A;  4Z5D A;  3GN5 B;  2BJC A;  1CQT A;  3K2Z A;  3MLF A;  2AXV A;  2CSF A;  2IV1 A;  2L49 A;  2EWT A;  2XSD C;  3S8Q A;  4NV4 A;  2LYQ A;  3KZ3 A;  1UXD A;  1HF0 A;  1QP7 A;  1QQA A;  2PE5 A;  1ZVV A;  2BNO A;  2XIU A;  3IIQ A;  3BS3 A;  1VPW A;  2PUA A;  3QWG A;  1LCC A;  2ICP A;  1UXC A;  2LYP A;  3FMY A;  4Y42 A;  2LYL A;  3CEC A;  1NEQ A;  4YG4 A;  2MEZ A;  5K98 B;  1L1M A;  2IVQ A;  3VK0 A;  1R63 A;  4IVZ A;  3SCH A;  3F51 A;  1OSL A;  2PUF A;  3JXC L;  1ZPQ A;  3H5T A;  4PU7 A;  4YAR A;  4X4F A;  2H8R A;  2HO0 A;  3S04 A;  3SCF A;  4PU8 A;  4X4C A;  3EUS A;  3KXA A;  2LYS A;  1GT0 C;  1UMU A;  3BDN A;  4GHJ A;  2IVB A;  4IA8 A;  1PRA A;  5A7L A;  2AW6 A;  3G7D A;  1DW9 A;  1I4V A;  1IC8 A;  1LQC A;  2BNN A;  3DNV B;  1LCD A;  3JSP A;  3RZZ A;  3OQM A;  3JSO A;  4YBA A;  1JHF A;  4F8D A;  1ZZ9 A;  2MQK A;  3SCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...