2FJRA

Crystal structure of bacteriophage 186
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
189
structure length
189
Chain Sequence
b'DSLGWSNVDVLDRICEAYGFSQKIQLANHFDIASSSLSNRYTRGAISYDFAAHCALETGANLQWLLTGEGEAFVNNRESSDAKRIEGFTLSEEILKSDKQLSVDAQFFTKPLTDGMAIRSEGKIYFVDKQASLSDGLWLVDIKGAISIRELTKLPGRKLHVAGGKVPFECGIDDIKTLGRVVGVYSEVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repressor protein CI
publication title The structural basis of cooperative regulation at an alternate genetic switch
pubmed doi rcsb
source organism Enterobacteria phage 186
molecule tags Transcription regulator
total genus 41
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07022 Phage_CI_repr Bacteriophage CI repressor helix-turn-helix domain
A PF16452 Phage_CI_C Bacteriophage CI repressor C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2fjrA01
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 2fjrA02
3BS3A 3ZHMA 1LLIA 1KCAA 5A7LA 3KZ3A 2LYKA 4J1XA 1EFAA 2IUOA 1JHHA 3D1NI 3GN5A 1ZZ6A 4PU8A 4Z5DA 1RZRA 2LYJA 4JCYA 3QF3A 3FYMA 3DNVB 1CJGA 2PUAA 3KXAA 4PU7A 3BDNA 1JFSA 2BNNA 2IV1A 4Y42A 1JH9A 1BDHA 4X4IA 3LFPA 4MCXA 4IWRA 1PERL 4FN3A 2OFYA 4YG4A 1IC8A 2HSGA 2R63A 3LISA 4YG7B 3GBFA 4N31A 2LYRA 1UXDA 4NV4A 2PPXA 1RPEL 1ZS4A 1Y7YA 2XJ3A 3RZZA 4ME8A 2FJRA 2LYPA 4X4EA 3QYXA 2CSFA 2EF8A 3B7HA 3OMTA 2AUWA 2XIUA 4Z58A 1LQCA 4X4GA 2GRMA 3G7DA 3OQNA 3U3WA 3BD1A 1XWRA 1QP7A 2H8RA 1UMUA 2AXUA 4O8BA 3UFDA 2D5VA 2IVBA 2GRLA 3OQOA 1B0NA 1X57A 3F51A 3JSOA 1AY9A 1ZAYA 4NDWA 4I6UA 4MCTA 2AW6A 4K8WA 1SQ8A 1I4VA 1PRVA 2LYSA 3F6WA 1QQAA 2O4AA 1E3OC 1HF0A 2O38A 3PXPA 1WH8A 1NERA 2WUSR 2GZUA 1Y9QA 3G5GA 1RZRD 2FKDA 3CLCA 5K98B 2HINA 1B12A 2EWTA 4FBIA 1ZZ7A 2PIJA 3EUSA 3FMYA 1QPZA 4I8TA 3QQ6A 2PUFA 1BDIA 2AXZA 1L1MA 1ZZ9A 4I6TA 3TRBA 3CECA 2JVLA 4YARA 4X4BA 1YSEA 1QP0A 3K2ZA 1X2LA 2JCGA 4JQDA 2HNFA 2BJCA 2PE5A 2IVQA 1QP4A 2ICTA 2EBYA 2LYLA 4PU3C 1JHCA 2L49A 4Z5HA 1JFTA 1T7DA 1DW9A 2CROA 1QQBA 3SCHA 3CROL 1PNRA 1WETA 2XCJA 1UTXA 2IU7A 2LCVA 4X4FA 4X4DA 1ZPQA 3ZHIA 3VK0A 1RIOA 1ZVVA 4Z5CA 1F39A 3L1PA 1WH6A 3OQMA 4JCXA 1RZSA 1JHFA 2PUCA 2AWIA 3H5TA 4IVZA 3O9XA 1WIZA 2WIUB 4J1WA 4YG1A 2OR1L 1ZZBA 3S8QA 2HO0A 4I6RA 2KEKA 3JXDL 2IVGA 2B5AA 2L8NA 2ICPA 2R1JL 3SCGA 1LMB3 3ZKCA 4F8DA 1NEQA 3R1FA 1ZZCA 2LYQA 1OSLA 1ADRA 1ZZ8A 3FYAA 3JSPA 2KEIA 1O4XA 1OCTC 3S04A 4GHJA 4X4CA 2A6CA 1VPWA 3SCFA 3GN5B 4X4HA 2XSDC 4OB4A 3HZIB 4PU4C 1GT0C 2PUDA 1KN9A 2KPJA 1CQTA 1DWKA 3IIQA 1UXCA 3MLFA 3JXBC 2AXVA 2PUGA 2KEJA 2O49A 3JXCL 2PUEA 2BNMA 2BNOA 3OP9A 1AU7A 1LCDA 1R63A 2MQKA 1JHEA 4GQMA 4Z59A 3KJXA 1LCCA 1ZUGA 2PUBA 1PRAA 3IVPA 3QWGA 4YBAA 1R69A 1S7EA 4IA8A 1PRUA 1JWLA 1POUA 2XI8A 2MEZA 2KZ8A 3F52A
chains in the Genus database with same CATH superfamily
2IUOA 1JHHA 3D1NI 4PU8A 2LYJA 2PXEA 1CJGA 3FYMA 2PUAA 1JH9A 4Y42A 2IV1A 1BDHA 4IWRA 3LFPA 1PERL 2J7UA 2FFHA 5DRTA 1IC8A 3LISA 4N31A 1UXDA 1ZS4A 2LNMA 2FJRA 2PXFA 2LYPA 4X4EA 2EF8A 4EKIA 4ER0A 3TELA 4EZIA 1X57A 4NDWA 4MCTA 1I4VA 2AW6A 5DTRA 2HFZA 3NDBB 1U2ZA 2WUSR 2GZUA 1NW3A 2EWTA 3EUSA 3FMYA 3QQ6A 3NXHA 3K2ZA 2V3CC 2PE5A 2IVQA 4PU3C 1JHCA 4Z5HA 1JFTA 2L1PA 1PNRA 2IU7A 1ZPQA 4ER6A 1RIOA 4Z5CA 4JCXA 3OQMA 2PUCA 2AWIA 3O9XA 1WIZA 4YG1A 1ZZBA 3S8QA 2KEKA 3TFLA 2R1JL 3SCGA 3OWQA 3QOXA 3NROA 2LYQA 1ADRA 2MXDA 3GN5B 1QZXA 2PUDA 2KPJA 2PXQA 3JXCL 3OP9A 1LCDA 1R63A 2MQKA 4Z59A 1WETA 3ZHMA 1KCAA 4J1XA 1RZRA 3QF3A 3KXAA 4WVLA 2BNNA 3R09A 2PXVA 2HSGA 2R63A 2PPXA 3RZZA 4ME8A 3B7HA 3SX0A 3OQNA 2GRMA 3G7DA 4O8BA 2XXQA 1MFQC 3NZLA 4K8WA 4I6UA 4EQZA 1SQ8A 2LYSA 3F6WA 2O4AA 1HF0A 4Q2JA 2HCNA 2XXPA 2PXUA 3GZDA 1HQ1A 3GUUA 3CLCA 4FBIA 4DE9A 2AXZA 4I6TA 3TRBA 3CECA 2ODRD 4YARA 4X4BA 2JCGA 5DTMA 4HRAA 2L49A 3CROL 3A9YA 5DSXA 2HCSA 1ZVVA 1F39A 3L1PA 2XXAA 5DRYA 3TEPA 3ZPXA 1QB2A 4I6RA 2IVGA 1LMB3 1NEQA 3GZDC 1ZZCA 4EKGA 2M4HA 3UWPA 1O4XA 4GHJA 3SCFA 4X4HA 2XSDC 2PXTA 1CQTA 1DWKA 3IIQA 2PUGA 1DULA 3PE5A 2PUEA 2O49A 1LCCA 3QWGA 1S7EA 1JWLA 1PRUA 2XI8A 2KZ8A 2LLVA 4ER3A 2LYKA 1EFAA 4Z5DA 4JCYA 2JQEA 3KL4A 3DNVB 4PU7A 3BDNA 3VWSA 4X4IA 4FN3A 4YG4A 4YG7B 2PXBA 5GAGi 4NV4A 2XJ3A 4DE8A 3QYXA 3OMTA 2AUWA 2XIUA 4Z58A 1LQCA 4X4GA 3U3WA 2H8RA 3BD1A 1XWRA 2AXUA 2D5VA 3UFDA 2GRLA 1B0NA 1AY9A 1PRVA 1QQAA 3SR4A 2PXLA 3DM5A 2O38A 3PXPA 3MEJA 1NERA 1Y9QA 3G5GA 1B12A 1QPZA 2PUFA 1L1MA 2JVLA 1YSEA 1QP0A 3LQXA 2HNFA 2BJCA 2ICTA 2LYLA 1DW9A 2CROA 1QQBA 3SCHA 1UTXA 2LCVA 4X4DA 5JUWA 3ZHIA 3VK0A 1WH6A 1JHFA 3H5TA 2WIUB 4J1WA 2OR1L 2PXPA 2L8NA 2ICPA 1OSLA 1ZZ8A 1VPWA 4OB4A 1GT0C 1UXCA 3MLFA 3OKZA 3JXBC 2KEJA 1JHEA 4GQMA 5DT2A 3IVPA 3G0TA 4IA8A 3OQOA 3F52A 3BS3A 4ER5A 1LLIA 3QFIA 5A7LA 3KZ3A 3M9LA 3GN5A 1ZZ6A 2PXKA 1JFSA 4MCXA 3QOWA 2OFYA 3GBFA 2PXDA 2LYRA 3GZCA 1RPEL 1Y7YA 4EK9A 2CSFA 1UMUA 1QP7A 2IVBA 3F51A 3JSOA 1ZAYA 4ER7A 1E3OC 2VEOA 1WH8A 3A9XA 1RZRD 2FKDA 5K98B 2HINA 1ZZ7A 2PIJA 5GAHi 4I8TA 1BDIA 1ZZ9A 2J7WA 1X2LA 4JQDA 2YBDA 1QP4A 4OBMA 2EBYA 3ME5A 1T7DA 2XCJA 4X4FA 2LLWA 1RZSA 4IVZA 2HO0A 3JXDL 2B5AA 3ZKCA 4F8DA 3R1FA 3FYAA 3JSPA 2KEIA 1OCTC 3S04A 4X4CA 2A6CA 3A9ZA 3HZIB 4PU4C 1KN9A 2AXVA 2BNMA 2BNOA 1AU7A 5DTQA 3KJXA 1ZUGA 2PUBA 1PRAA 4YBAA 1R69A 1POUA 2MEZA
chains in the Genus database with same CATH topology
3BS3A 3ZHMA 1LLIA 1KCAA 5A7LA 3KZ3A 2LYKA 4J1XA 1EFAA 2IUOA 1JHHA 3D1NI 3GN5A 1ZZ6A 4PU8A 4Z5DA 1RZRA 2LYJA 4JCYA 3QF3A 3FYMA 3DNVB 1CJGA 2PUAA 3KXAA 4PU7A 3BDNA 1JFSA 2BNNA 2IV1A 4Y42A 1JH9A 1BDHA 4X4IA 3LFPA 4MCXA 4IWRA 1PERL 4FN3A 2OFYA 4YG4A 1IC8A 2HSGA 2R63A 3LISA 4YG7B 3GBFA 4N31A 2LYRA 1UXDA 4NV4A 2PPXA 1RPEL 1ZS4A 1Y7YA 2XJ3A 3RZZA 4ME8A 2FJRA 2LYPA 4X4EA 3QYXA 2CSFA 2EF8A 3B7HA 3OMTA 2AUWA 2XIUA 4Z58A 1LQCA 4X4GA 2GRMA 3G7DA 3OQNA 3U3WA 3BD1A 1XWRA 1QP7A 2H8RA 1UMUA 2AXUA 4O8BA 3UFDA 2D5VA 2IVBA 2GRLA 3OQOA 1B0NA 1X57A 3F51A 3JSOA 1AY9A 1ZAYA 4NDWA 4I6UA 4MCTA 2AW6A 4K8WA 1SQ8A 1I4VA 1PRVA 2LYSA 3F6WA 1QQAA 2O4AA 1E3OC 1HF0A 2O38A 3PXPA 1WH8A 1NERA 2WUSR 2GZUA 1Y9QA 3G5GA 1RZRD 2FKDA 3CLCA 5K98B 2HINA 1B12A 2EWTA 4FBIA 1ZZ7A 2PIJA 3EUSA 3FMYA 1QPZA 4I8TA 3QQ6A 2PUFA 1BDIA 2AXZA 1L1MA 1ZZ9A 4I6TA 3TRBA 3CECA 2JVLA 4YARA 4X4BA 1YSEA 1QP0A 3K2ZA 1X2LA 2JCGA 4JQDA 2HNFA 2BJCA 2PE5A 2IVQA 1QP4A 2ICTA 2EBYA 2LYLA 4PU3C 1JHCA 2L49A 4Z5HA 1JFTA 1T7DA 1DW9A 2CROA 1QQBA 3SCHA 3CROL 1PNRA 1WETA 2XCJA 1UTXA 2IU7A 2LCVA 4X4FA 4X4DA 1ZPQA 3ZHIA 3VK0A 1RIOA 1ZVVA 4Z5CA 1F39A 3L1PA 1WH6A 3OQMA 4JCXA 1RZSA 1JHFA 2PUCA 2AWIA 3H5TA 4IVZA 3O9XA 1WIZA 2WIUB 4J1WA 4YG1A 2OR1L 1ZZBA 3S8QA 2HO0A 4I6RA 2KEKA 3JXDL 2IVGA 2B5AA 2L8NA 2ICPA 2R1JL 3SCGA 1LMB3 3ZKCA 4F8DA 1NEQA 3R1FA 1ZZCA 2LYQA 1OSLA 1ADRA 1ZZ8A 3FYAA 3JSPA 2KEIA 1O4XA 1OCTC 3S04A 4GHJA 4X4CA 2A6CA 1VPWA 3SCFA 3GN5B 4X4HA 2XSDC 4OB4A 3HZIB 4PU4C 1GT0C 2PUDA 1KN9A 2KPJA 1CQTA 1DWKA 3IIQA 1UXCA 3MLFA 3JXBC 2AXVA 2PUGA 2KEJA 2O49A 3JXCL 2PUEA 2BNMA 2BNOA 3OP9A 1AU7A 1LCDA 1R63A 2MQKA 1JHEA 4GQMA 4Z59A 3KJXA 1LCCA 1ZUGA 2PUBA 1PRAA 3IVPA 3QWGA 4YBAA 1R69A 1S7EA 4IA8A 1PRUA 1JWLA 1POUA 2XI8A 2MEZA 2KZ8A 3F52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BS3 A;  3ZHM A;  1LLI A;  1KCA A;  5A7L A;  3KZ3 A;  2LYK A;  4J1X A;  1EFA A;  2IUO A;  1JHH A;  3D1N I;  3GN5 A;  1ZZ6 A;  4PU8 A;  4Z5D A;  1RZR A;  2LYJ A;  4JCY A;  3QF3 A;  3FYM A;  3DNV B;  1CJG A;  2PUA A;  3KXA A;  4PU7 A;  3BDN A;  1JFS A;  2BNN A;  2IV1 A;  4Y42 A;  1JH9 A;  1BDH A;  4X4I A;  3LFP A;  4MCX A;  4IWR A;  1PER L;  4FN3 A;  2OFY A;  4YG4 A;  1IC8 A;  2HSG A;  2R63 A;  3LIS A;  4YG7 B;  3GBF A;  4N31 A;  2LYR A;  1UXD A;  4NV4 A;  2PPX A;  1RPE L;  1ZS4 A;  1Y7Y A;  2XJ3 A;  3RZZ A;  4ME8 A;  2FJR A;  2LYP A;  4X4E A;  3QYX A;  2CSF A;  2EF8 A;  3B7H A;  3OMT A;  2AUW A;  2XIU A;  4Z58 A;  1LQC A;  4X4G A;  2GRM A;  3G7D A;  3OQN A;  3U3W A;  3BD1 A;  1XWR A;  1QP7 A;  2H8R A;  1UMU A;  2AXU A;  4O8B A;  3UFD A;  2D5V A;  2IVB A;  2GRL A;  3OQO A;  1B0N A;  1X57 A;  3F51 A;  3JSO A;  1AY9 A;  1ZAY A;  4NDW A;  4I6U A;  4MCT A;  2AW6 A;  4K8W A;  1SQ8 A;  1I4V A;  1PRV A;  2LYS A;  3F6W A;  1QQA A;  2O4A A;  1E3O C;  1HF0 A;  2O38 A;  3PXP A;  1WH8 A;  1NER A;  2WUS R;  2GZU A;  1Y9Q A;  3G5G A;  1RZR D;  2FKD A;  3CLC A;  5K98 B;  2HIN A;  1B12 A;  2EWT A;  4FBI A;  1ZZ7 A;  2PIJ A;  3EUS A;  3FMY A;  1QPZ A;  4I8T A;  3QQ6 A;  2PUF A;  1BDI A;  2AXZ A;  1L1M A;  1ZZ9 A;  4I6T A;  3TRB A;  3CEC A;  2JVL A;  4YAR A;  4X4B A;  1YSE A;  1QP0 A;  3K2Z A;  1X2L A;  2JCG A;  4JQD A;  2HNF A;  2BJC A;  2PE5 A;  2IVQ A;  1QP4 A;  2ICT A;  2EBY A;  2LYL A;  4PU3 C;  1JHC A;  2L49 A;  4Z5H A;  1JFT A;  1T7D A;  1DW9 A;  2CRO A;  1QQB A;  3SCH A;  3CRO L;  1PNR A;  1WET A;  2XCJ A;  1UTX A;  2IU7 A;  2LCV A;  4X4F A;  4X4D A;  1ZPQ A;  3ZHI A;  3VK0 A;  1RIO A;  1ZVV A;  4Z5C A;  1F39 A;  3L1P A;  1WH6 A;  3OQM A;  4JCX A;  1RZS A;  1JHF A;  2PUC A;  2AWI A;  3H5T A;  4IVZ A;  3O9X A;  1WIZ A;  2WIU B;  4J1W A;  4YG1 A;  2OR1 L;  1ZZB A;  3S8Q A;  2HO0 A;  4I6R A;  2KEK A;  3JXD L;  2IVG A;  2B5A A;  2L8N A;  2ICP A;  2R1J L;  3SCG A;  1LMB 3;  3ZKC A;  4F8D A;  1NEQ A;  3R1F A;  1ZZC A;  2LYQ A;  1OSL A;  1ADR A;  1ZZ8 A;  3FYA A;  3JSP A;  2KEI A;  1O4X A;  1OCT C;  3S04 A;  4GHJ A;  4X4C A;  2A6C A;  1VPW A;  3SCF A;  3GN5 B;  4X4H A;  2XSD C;  4OB4 A;  3HZI B;  4PU4 C;  1GT0 C;  2PUD A;  1KN9 A;  2KPJ A;  1CQT A;  1DWK A;  3IIQ A;  1UXC A;  3MLF A;  3JXB C;  2AXV A;  2PUG A;  2KEJ A;  2O49 A;  3JXC L;  2PUE A;  2BNM A;  2BNO A;  3OP9 A;  1AU7 A;  1LCD A;  1R63 A;  2MQK A;  1JHE A;  4GQM A;  4Z59 A;  3KJX A;  1LCC A;  1ZUG A;  2PUB A;  1PRA A;  3IVP A;  3QWG A;  4YBA A;  1R69 A;  1S7E A;  4IA8 A;  1PRU A;  1JWL A;  1POU A;  2XI8 A;  2MEZ A;  2KZ8 A;  3F52 A; 
#chains in the Genus database with same CATH topology
 2IUO A;  1JHH A;  3D1N I;  4PU8 A;  2LYJ A;  2PXE A;  1CJG A;  3FYM A;  2PUA A;  1JH9 A;  4Y42 A;  2IV1 A;  1BDH A;  4IWR A;  3LFP A;  1PER L;  2J7U A;  2FFH A;  5DRT A;  1IC8 A;  3LIS A;  4N31 A;  1UXD A;  1ZS4 A;  2LNM A;  2FJR A;  2PXF A;  2LYP A;  4X4E A;  2EF8 A;  4EKI A;  4ER0 A;  3TEL A;  4EZI A;  1X57 A;  4NDW A;  4MCT A;  1I4V A;  2AW6 A;  5DTR A;  2HFZ A;  3NDB B;  1U2Z A;  2WUS R;  2GZU A;  1NW3 A;  2EWT A;  3EUS A;  3FMY A;  3QQ6 A;  3NXH A;  3K2Z A;  2V3C C;  2PE5 A;  2IVQ A;  4PU3 C;  1JHC A;  4Z5H A;  1JFT A;  2L1P A;  1PNR A;  2IU7 A;  1ZPQ A;  4ER6 A;  1RIO A;  4Z5C A;  4JCX A;  3OQM A;  2PUC A;  2AWI A;  3O9X A;  1WIZ A;  4YG1 A;  1ZZB A;  3S8Q A;  2KEK A;  3TFL A;  2R1J L;  3SCG A;  3OWQ A;  3QOX A;  3NRO A;  2LYQ A;  1ADR A;  2MXD A;  3GN5 B;  1QZX A;  2PUD A;  2KPJ A;  2PXQ A;  3JXC L;  3OP9 A;  1LCD A;  1R63 A;  2MQK A;  4Z59 A;  1WET A;  3ZHM A;  1KCA A;  4J1X A;  1RZR A;  3QF3 A;  3KXA A;  4WVL A;  2BNN A;  3R09 A;  2PXV A;  2HSG A;  2R63 A;  2PPX A;  3RZZ A;  4ME8 A;  3B7H A;  3SX0 A;  3OQN A;  2GRM A;  3G7D A;  4O8B A;  2XXQ A;  1MFQ C;  3NZL A;  4K8W A;  4I6U A;  4EQZ A;  1SQ8 A;  2LYS A;  3F6W A;  2O4A A;  1HF0 A;  4Q2J A;  2HCN A;  2XXP A;  2PXU A;  3GZD A;  1HQ1 A;  3GUU A;  3CLC A;  4FBI A;  4DE9 A;  2AXZ A;  4I6T A;  3TRB A;  3CEC A;  2ODR D;  4YAR A;  4X4B A;  2JCG A;  5DTM A;  4HRA A;  2L49 A;  3CRO L;  3A9Y A;  5DSX A;  2HCS A;  1ZVV A;  1F39 A;  3L1P A;  2XXA A;  5DRY A;  3TEP A;  3ZPX A;  1QB2 A;  4I6R A;  2IVG A;  1LMB 3;  1NEQ A;  3GZD C;  1ZZC A;  4EKG A;  2M4H A;  3UWP A;  1O4X A;  4GHJ A;  3SCF A;  4X4H A;  2XSD C;  2PXT A;  1CQT A;  1DWK A;  3IIQ A;  2PUG A;  1DUL A;  3PE5 A;  2PUE A;  2O49 A;  1LCC A;  3QWG A;  1S7E A;  1JWL A;  1PRU A;  2XI8 A;  2KZ8 A;  2LLV A;  4ER3 A;  2LYK A;  1EFA A;  4Z5D A;  4JCY A;  2JQE A;  3KL4 A;  3DNV B;  4PU7 A;  3BDN A;  3VWS A;  4X4I A;  4FN3 A;  4YG4 A;  4YG7 B;  2PXB A;  5GAG i;  4NV4 A;  2XJ3 A;  4DE8 A;  3QYX A;  3OMT A;  2AUW A;  2XIU A;  4Z58 A;  1LQC A;  4X4G A;  3U3W A;  2H8R A;  3BD1 A;  1XWR A;  2AXU A;  2D5V A;  3UFD A;  2GRL A;  1B0N A;  1AY9 A;  1PRV A;  1QQA A;  3SR4 A;  2PXL A;  3DM5 A;  2O38 A;  3PXP A;  3MEJ A;  1NER A;  1Y9Q A;  3G5G A;  1B12 A;  1QPZ A;  2PUF A;  1L1M A;  2JVL A;  1YSE A;  1QP0 A;  3LQX A;  2HNF A;  2BJC A;  2ICT A;  2LYL A;  1DW9 A;  2CRO A;  1QQB A;  3SCH A;  1UTX A;  2LCV A;  4X4D A;  5JUW A;  3ZHI A;  3VK0 A;  1WH6 A;  1JHF A;  3H5T A;  2WIU B;  4J1W A;  2OR1 L;  2PXP A;  2L8N A;  2ICP A;  1OSL A;  1ZZ8 A;  1VPW A;  4OB4 A;  1GT0 C;  1UXC A;  3MLF A;  3OKZ A;  3JXB C;  2KEJ A;  1JHE A;  4GQM A;  5DT2 A;  3IVP A;  3G0T A;  4IA8 A;  3OQO A;  3F52 A;  3BS3 A;  4ER5 A;  1LLI A;  3QFI A;  5A7L A;  3KZ3 A;  3M9L A;  3GN5 A;  1ZZ6 A;  2PXK A;  1JFS A;  4MCX A;  3QOW A;  2OFY A;  3GBF A;  2PXD A;  2LYR A;  3GZC A;  1RPE L;  1Y7Y A;  4EK9 A;  2CSF A;  1UMU A;  1QP7 A;  2IVB A;  3F51 A;  3JSO A;  1ZAY A;  4ER7 A;  1E3O C;  2VEO A;  1WH8 A;  3A9X A;  1RZR D;  2FKD A;  5K98 B;  2HIN A;  1ZZ7 A;  2PIJ A;  5GAH i;  4I8T A;  1BDI A;  1ZZ9 A;  2J7W A;  1X2L A;  4JQD A;  2YBD A;  1QP4 A;  4OBM A;  2EBY A;  3ME5 A;  1T7D A;  2XCJ A;  4X4F A;  2LLW A;  1RZS A;  4IVZ A;  2HO0 A;  3JXD L;  2B5A A;  3ZKC A;  4F8D A;  3R1F A;  3FYA A;  3JSP A;  2KEI A;  1OCT C;  3S04 A;  4X4C A;  2A6C A;  3A9Z A;  3HZI B;  4PU4 C;  1KN9 A;  2AXV A;  2BNM A;  2BNO A;  1AU7 A;  5DTQ A;  3KJX A;  1ZUG A;  2PUB A;  1PRA A;  4YBA A;  1R69 A;  1POU A;  2MEZ A; 
#chains in the Genus database with same CATH homology
 3BS3 A;  3ZHM A;  1LLI A;  1KCA A;  5A7L A;  3KZ3 A;  2LYK A;  4J1X A;  1EFA A;  2IUO A;  1JHH A;  3D1N I;  3GN5 A;  1ZZ6 A;  4PU8 A;  4Z5D A;  1RZR A;  2LYJ A;  4JCY A;  3QF3 A;  3FYM A;  3DNV B;  1CJG A;  2PUA A;  3KXA A;  4PU7 A;  3BDN A;  1JFS A;  2BNN A;  2IV1 A;  4Y42 A;  1JH9 A;  1BDH A;  4X4I A;  3LFP A;  4MCX A;  4IWR A;  1PER L;  4FN3 A;  2OFY A;  4YG4 A;  1IC8 A;  2HSG A;  2R63 A;  3LIS A;  4YG7 B;  3GBF A;  4N31 A;  2LYR A;  1UXD A;  4NV4 A;  2PPX A;  1RPE L;  1ZS4 A;  1Y7Y A;  2XJ3 A;  3RZZ A;  4ME8 A;  2FJR A;  2LYP A;  4X4E A;  3QYX A;  2CSF A;  2EF8 A;  3B7H A;  3OMT A;  2AUW A;  2XIU A;  4Z58 A;  1LQC A;  4X4G A;  2GRM A;  3G7D A;  3OQN A;  3U3W A;  3BD1 A;  1XWR A;  1QP7 A;  2H8R A;  1UMU A;  2AXU A;  4O8B A;  3UFD A;  2D5V A;  2IVB A;  2GRL A;  3OQO A;  1B0N A;  1X57 A;  3F51 A;  3JSO A;  1AY9 A;  1ZAY A;  4NDW A;  4I6U A;  4MCT A;  2AW6 A;  4K8W A;  1SQ8 A;  1I4V A;  1PRV A;  2LYS A;  3F6W A;  1QQA A;  2O4A A;  1E3O C;  1HF0 A;  2O38 A;  3PXP A;  1WH8 A;  1NER A;  2WUS R;  2GZU A;  1Y9Q A;  3G5G A;  1RZR D;  2FKD A;  3CLC A;  5K98 B;  2HIN A;  1B12 A;  2EWT A;  4FBI A;  1ZZ7 A;  2PIJ A;  3EUS A;  3FMY A;  1QPZ A;  4I8T A;  3QQ6 A;  2PUF A;  1BDI A;  2AXZ A;  1L1M A;  1ZZ9 A;  4I6T A;  3TRB A;  3CEC A;  2JVL A;  4YAR A;  4X4B A;  1YSE A;  1QP0 A;  3K2Z A;  1X2L A;  2JCG A;  4JQD A;  2HNF A;  2BJC A;  2PE5 A;  2IVQ A;  1QP4 A;  2ICT A;  2EBY A;  2LYL A;  4PU3 C;  1JHC A;  2L49 A;  4Z5H A;  1JFT A;  1T7D A;  1DW9 A;  2CRO A;  1QQB A;  3SCH A;  3CRO L;  1PNR A;  1WET A;  2XCJ A;  1UTX A;  2IU7 A;  2LCV A;  4X4F A;  4X4D A;  1ZPQ A;  3ZHI A;  3VK0 A;  1RIO A;  1ZVV A;  4Z5C A;  1F39 A;  3L1P A;  1WH6 A;  3OQM A;  4JCX A;  1RZS A;  1JHF A;  2PUC A;  2AWI A;  3H5T A;  4IVZ A;  3O9X A;  1WIZ A;  2WIU B;  4J1W A;  4YG1 A;  2OR1 L;  1ZZB A;  3S8Q A;  2HO0 A;  4I6R A;  2KEK A;  3JXD L;  2IVG A;  2B5A A;  2L8N A;  2ICP A;  2R1J L;  3SCG A;  1LMB 3;  3ZKC A;  4F8D A;  1NEQ A;  3R1F A;  1ZZC A;  2LYQ A;  1OSL A;  1ADR A;  1ZZ8 A;  3FYA A;  3JSP A;  2KEI A;  1O4X A;  1OCT C;  3S04 A;  4GHJ A;  4X4C A;  2A6C A;  1VPW A;  3SCF A;  3GN5 B;  4X4H A;  2XSD C;  4OB4 A;  3HZI B;  4PU4 C;  1GT0 C;  2PUD A;  1KN9 A;  2KPJ A;  1CQT A;  1DWK A;  3IIQ A;  1UXC A;  3MLF A;  3JXB C;  2AXV A;  2PUG A;  2KEJ A;  2O49 A;  3JXC L;  2PUE A;  2BNM A;  2BNO A;  3OP9 A;  1AU7 A;  1LCD A;  1R63 A;  2MQK A;  1JHE A;  4GQM A;  4Z59 A;  3KJX A;  1LCC A;  1ZUG A;  2PUB A;  1PRA A;  3IVP A;  3QWG A;  4YBA A;  1R69 A;  1S7E A;  4IA8 A;  1PRU A;  1JWL A;  1POU A;  2XI8 A;  2MEZ A;  2KZ8 A;  3F52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...