The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
88
|
sequence length |
336
|
structure length |
336
|
Chain Sequence |
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Effect of the methionine ligand on the reorganization energy of the type-1 copper site of nitrite reductase.
pubmed doi rcsb |
molecule keywords |
Copper-containing nitrite reductase
|
source organism |
Alcaligenes faecalis
|
molecule tags |
Oxidoreductase
|
total genus |
88
|
structure length |
336
|
sequence length |
336
|
chains with identical sequence |
B, C
|
ec nomenclature |
ec
1.7.2.1: Nitrite reductase (NO-forming). |
pdb deposition date | 2006-01-03 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00394 | Cu-oxidase | Multicopper oxidase |
A | PF07732 | Cu-oxidase_3 | Multicopper oxidase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Cupredoxins - blue copper proteins | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Cupredoxins - blue copper proteins |