2FJSA

Crystal structure of anaerobically reduced wild type nitrite reductase from a. faecalis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
336
structure length
336
Chain Sequence
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Effect of the methionine ligand on the reorganization energy of the type-1 copper site of nitrite reductase.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 88
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2006-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fjsA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fjsA02
2XU9A 3S8FB 3V9CA 4HALA 1KYAA 4F7KA 1ILUA 2Q5BA 2CUAA 4BXSV 2YQBA 3FSVA 5B1BB 1BQ5A 4DP4X 3NT0A 3ABLB 3N55A 3FPXA 4PCYA 2OJ1A 1SHXA 1W6LA 1QNIA 3OMAB 4QKTA 2PCFA 1F56A 1NIBA 5AFAA 1RCYA 1NWPA 3X2QB 3NP3A 1L9QA 1JZJA 2PPAA 4YVNA 1AZRA 2EIMB 2FWLB 2VN3A 4YVUA 2CBPA 2H5UA 4G71B 3NJLA 2PPEA 3MX0B 2VM3A 4UAHA 3DKHA 1MG2C 4ZK8A 1XMEB 1RZPA 3DTUB 3SBRA 2JXMA 3UACA 1WS7A 3EHBB 2PP7A 4NAJA 4JHVA 2VW4A 3WKPA 1FWXA 3KW8A 3QJQB 2ZXWB 2PPFA 1SDDB 1AG0A 3H4FA 1KDJA 3PPSA 2BZ7A 3BVDB 1X9RA 3V9EA 1AR1B 2YARA 4KO7A 1PAZA 3QJVB 2QPDB 1AS8A 1NICA 1IUZA 1JERA 1SDDA 3NJGA 2HXAA 2ZONA 3FU8A 2FQEA 3IEAA 1AAJA 2UXVA 1IBYA 1NIEA 5B7FA 3ASOB 2GB2A 2I7OA 4Q89A 3CDZB 3S3BB 4A66A 4A2EA 3SQRA 4DP0X 3PAZA 4BXVA 2TSBA 2IH8A 1MZYA 1OCOB 3BQVA 1NIDA 5FC9A 1GS8A 2ZWNA 4HZ1A 3FSZA 3ASNB 4ENZA 1NIAA 5A7EA 1M9WA 4G7QB 1KCBA 3GDCA 4DP7X 1JXGA 1XB8A 5TK2A 3FU7B 3TBCA 4MFHA 3CDZA 4KNTA 3NSYA 1TEGA 4HCGA 4BDVB 1WA2X 2CAKA 3EH4B 4K9JA 5PCYA 1ETJA 3G5WA 3FU9A 3NSCA 2XV0A 1OF0A 2YXWA 4KNSA 4M4RB 7PAZA 1E5ZA 4AKOA 2UX7A 2FT7A 4YSPA 3FU7A 4E9SA 4YSQA 1W6WA 4E9XA 2VSKB 1L9PA 1NWOA 2QPEB 4BDVA 1URIA 3FSAA 2FTAA 3ABKB 3NJIA 1BXVA 2IH9A 3H4HA 2BZCA 3GXUB 3NP4A 2VW7A 2HX8A 3AG2B 3FQ1A 4M3HA 1E65A 1MDAA 2EIJB 2XV3A 4DP5X 1M56B 1N68A 4HHWA 5I5MA 2PPCA 2Y69B 2GI0A 2I85A 1JOIA 1HAWA 1V55B 3U25A 4G72B 3NJJA 3NJMA 5EHFA 2JKWA 1ZIBA 2WO2B 1ASOA 4X4KA 4F2EA 2LLNA 2XX1A 2OV0A 2YAQA 3AZUA 4GP4B 4EF3A 1IBZA 2DWTA 1NIFA 1HFUA 3ZIYA 2BP0A 4A2HA 2XUWA 4FAAB 1BXAA 1KBVA 2QDVA 2YAPA 4HIPA 1OE2A 4GP8B 2E86A 4YSAA 2PCYA 4RH4A 4YSSA 2IWEA 2DY2A 3AG1B 2H47C 2YXVA 6PCYA 1OCZB 1OV8A 4UANA 1NPJA 3CZUB 2CJ3A 3IBOA 4BWUA 1M57B 4DP8X 3EH5B 1WAEA 4KOCA 3MBWB 2BWIA 4E9VA 1W8EA 1WA0X 1ID2A 1JXFA 1JZGA 4KNUA 5D4JA 3X1EA 2XXGA 4JHUA 3NJFA 2X88A 1GR7A 5AZUA 2IDTA 3QPKA 2XXFA 1A65A 1L9SA 1L9OA 1KV7A 3T6XA 3AG3B 3UAAA 4DPCX 1AANA 1GS7A 4JKNA 1BYOA 2YAEA 2MRYA 3C75A 4E9QA 3HB3B 4WTQA 2HRHA 2BHFA 1JVLA 2NRDA 2P80D 4NERA 3TASA 4BWWA 1J5CA 2B08A 3QJTB 2PP9A 3SBQA 5E9NA 3OMNB 2RACA 5IY5B 4E9YA 1ET5A 1JZHA 4DPAX 1DZ0A 2FT8A 2BP8A 2VSMB 4W1TA 4CSZA 3NYKA 5TK4A 3UGEA 1AZUA 2GSMB 1IC0A 5D4IA 2Y1AA 1HAUA 2HX9A 3DIVA 3AY2A 3NSFA 2J56A 3AG4B 3WG7B 7PCYA 2Q9OA 1AS7A 2EIKB 1ZV2A 1NPNA 3PCYA 5B1JA 4F2FA 5F7AA 1SNRA 3UADA 2IWKA 1GY2A 1AZCA 1SF5A 1VLXA 2CCWA 1JZIA 2AZAA 1CYXA 1CUOA 3OQRA 3WI9A 1GY1A 4AI7A 3TU6A 2UXGA 1KBWA 5I6LA 3FS9A 2W8CA 3NJNA 3AW5A 3FPYA 5D4HA 5B3SB 1PLCA 1EHKB 2BO0A 3UAEA 5I6KA 5B7MA 3FT0A 1A3ZA 4N8UA 1NINA 2FT6A 5I5JA 4P5RA 1JVOA 2IWFA 2TSAA 3QJRB 4G7RB 2IDSA 3ZDWA 4YSOA 3S3CB 3WKQA 4E9TA 1GSKA 4BK5C 2XWZA 5B7EA 3X1BA 4A2GA 2FJSA 1ET8A 4KO5A 2GBAA 3OD3A 1CC3A 1TEFA 4UF7C 2PPDA 3ERXA 1OE1A 3NJKA 2P80A 2OCCB 1J9QA 1OE3A 5I6PA 3T71A 1SFDA 1FA4A 3X1FA 4TXVB 2IAAC 2HLEB 2BP0B 2WO3B 4PAZA 1A4BA 4W9ZA 2XVBA 1IKOP 1AACA 2FQGA 4HHGA 4NB7A 5I6NA 1B3IA 1ET7A 1A8ZA 4HAKA 5ANHA 1YLBB 4G70B 3GYRA 4QLWA 3QJUB 2BWDA 3T6VA 4YSDA 2UXTA 3ABMB 1E5YA 2IDUA 2GC4C 2YAMA 5I5IA 2AVFA 1GW0A 1NDTA 1RKRA 2VMJA 1PF3A 2YAOA 3X1GA 3WNIA 3CVDA 1GS6X 1PMYA 3EH3B 2BW4A 1JZEA 1QHQA 3ZX1A 4DP6X 2IDQA 1V10A 2XLLA 4YSRA 1KDIA 2HZHA 1ASQA 4A67A 3S8GB 2PP8A 4G7SB 2DV6A 1OCCB 1JZFA 3CG8A 4AKPA 3TBBA 1PZBA 3RYMA 2J57A 4KO6A 1J9RA 2BP8B 4GXFA 4YSUA 1AOZA 1J9TA 2XYBA 1J9SA 2PLTA 2EINB 1ASPA 4HCIA 4AZUA 2MTAA 3UABA 2AANA 3WNJA 4A2FA 1KCWA 2J5WA 2VM4A 4AX3A 1AG6A 1CYWA 1SJMA 5I28A 4GY4A 3S3DB 1EZLA 2YAHA 2FNWA 1AS6A 2CALA 2X87A 4DP1X 1BAWA 3QQXA 1BXUA 4AKQA 4GYBA 2IDFA 3JTBA 3CVCA 4N4YB 2I7SA 4YSTA 4DPBX 1A4CA 4E9WA 1BYPA 4A68A 1E30A 3T9WA 3FYIB 2W88A 1SF3A 2HX7A 5I6MA 2H3XC 2QDWA 1L9TA 1ZDSA 3L45A 1PZCA 3NJHA 1MG3C 3IE9A 5PAZA 2DYRB 3PXLA 2VW6A 4WKXA 1QLEB 1ZDQA 5B1JC 2B3IA 1CURA 4YSEA 1X9UA 1T5KA 1ZIAA 1TKWA 3D12B 1V54B 2ZOOA 3T6ZA 3PLYA 2FQDA 1XB6A 2EILB 3PAVA 3KW7A 2QT6A 1PNCA 1OCRB 3IN2A 4Q8BA 1AZBA 2AFNA 3OMIB 1WS8A 2GIMA 1BEXA 1AIZA 1TU2A 1ADWA 8PAZA 3ZBMA 1I53A 2XX0A 4KOBA 1JXDA 1PLAA 2XV2A 4FA7B 2GC7C 3CVBA 3NSDA 3SBPA 3FSWA 1SHWA 4DP2X 1N70A 3WIAA 3T6WA 1PCSA 4P5SA 1KGYE 3IN0A 5I26A 1BQKA 4HCFA 4DP9X 2FQFA 1MZZA 5I6OA 1ILSA 1SFHA 2J55A 4GP5B 4BWTA 3N2JA 1UATA 5LDUA 1A4AA 5F7BA 1AZNA 2AZUA 2GHZA 3JT2A 1NZRA 1L9RA 5AKRA 1AQ8A 2A3TA 1NTDA 1PZAA 1OOWA 2R7EB 2HRGA 9PCYA 2BW5A 2N0MA 2WSDA 4YL4A 2DWSA 1DYZA 5B1AB 5B1KA 3ABGA 3EF4A 2DYSB 1E67A 3H56A 1PY0A 2UX6A 1GYCA 2YAFA 3TA4D 4E9RA 1RZQA 4YSCA 4CSPA 1WA1X 1FFTB 3OM3B 1PLBA 3PAUA 6PAZA 3X1NA 1R1CA 4L0PB 3FQYA 1XB3A 1J5DA 2R7EA 1PNDA 3FYEB 3QJSB 2UXFA 3FQ2A 4A2DA 2JFCA 1BQRA 3HEIB 4KO9A 1ZPUA
chains in the Genus database with same CATH superfamily
3QIUC 1LLAA 1RY7B 4L3EA 4OZ4A 1F11A 4ZODA 5AOIA 2L7QA 1ILUA 3QQ4B 3EYOB 1UZ8B 3E9UA 1LDSA 3W3BA 4A7QA 5IHZA 2BERA 1BX2B 3TOPA 1CL7L 5JNYA 2WGXA 3N55A 4KNQA 3BWZA 4OT1H 2UYLA 1GZPA 5EU7C 3SDDB 2W65A 5KSAA 1IGIL 3L54A 1UB5B 3U0WH 4B95C 1G7QB 1UGKA 1PD6A 1YEFL 2IG2L 3K72A 4PS4L 4GG6F 1KGUA 1ZCRA 1YMHB 5HBBA 1V3MA 3ESOA 1OT4A 2BNQE 3JV6A 4ES9A 5GS0L 4JJHA 3LPPA 3WTYA 1N8ZA 4JEGB 3WDIA 4M9OA 1G5GA 3F7YA 1QVOB 3BPOC 3QZBA 4JFZL 4D8PA 1J05A 1MJJA 3LAFA 3X11A 3FT2B 4BFEA 1FO0A 1VADB 3CLEL 3GUTA 2HUHA 1KYOK 3FQ4A 4ZFFB 2BZ7A 5I0WA 3O2DA 4FYSA 3CVHB 4NRZB 4JM2D 4L1BA 3V4VB 4GW4B 3KVDD 2VLKA 3GLAA 4LOUC 4FTVA 3KDPB 4LCUA 4MNQA 1AHMA 3GSOB 4Y1AE 3LTVA 4R2GB 3FRPG 2IVFC 5AAMA 3BKMH 1AS8A 2J1WA 3MBXL 1YMME 2MOGA 5E2UH 4NO0D 3VRLF 4JZOA 2AEQL 1CE1H 3QUYD 2ZONA 1B2WL 1ZS8B 3LQMA 3OAUH 5F9OH 3BPNC 3IEAA 3PHQB 5LNDA 3EOAB 3BDXA 1NCHA 2X4SB 1AOHA 2WZ0A 4S1QL 3UL4A 5HYQA 4DEWA 3T0EE 1NJ9B 5J6HA 2IANE 3M7FB 4M7KL 3WBDA 4D9LL 1T0OA 4N86A 2Q7YA 3TO4B 3ZL2A 4DVBB 4FYTA 2ZNWA 3QNZA 4N20A 4OZFB 2QSCH 3DOIA 1RU9L 5K59F 4J1UB 2WANA 3ZKMC 1WG3A 4R3SA 1HOCA 3RY4A 3DGDA 1IEBB 1ZHNA 3LKPA 3MLVH 4OZGE 1M1SA 2DYPB 4OIBA 5TH2A 4P2QA 5BVPL 3QDME 4LRIC 2B4CL 5FO8B 3C8KA 4R6UA 3QK0A 5DJZA 1K2DB 3ZR5A 2EO1A 5JHAA 4ZFZA 4U1SA 3BP6B 1AHWA 3K6IA 5A7BA 1MKFA 3W0WE 4XR8C 3EKCA 3ARDD 3CZSA 4MS6A 3OMZA 1WAAE 1HU8A 2QVMA 3DTXB 2VUKA 4X4XB 2EDFA 1TEYA 3RL1B 1J0KA 2OM5A 4FXGB 3U7AA 3CFKB 1F11B 2IH9A 4JN2A 5FWQA 3NP4A 3F8UB 1KC5L 4O51A 2PR4H 3WN6A 3ULVD 3FJTA 4XTRD 2QMKA 3BPCA 5LWYL 3E6FB 4H4NA 3VH8G 2HPTA 5A3ID 4HHWA 2D8KA 4J3UA 4IHOA 3T1FB 2GI0A 4D0CA 3ZE1B 2W65B 4MA1B 1OGTA 2R27A 6TAAA 1HAWA 4M7JH 1X5ZA 1C9SA 5I1HL 4FP8H 1HHJA 2DMGA 3NIGE 4MA7L 5A2CA 5EHFA 3K72B 1NFDB 1FL6A 2PKDA 1F02I 4F2EA 3S37L 4EO5A 3IAGC 2DWTA 3K8LA 2WXOA 3RTQB 2R83A 1LL1A 2YC1A 4P05A 3I9IA 4WW2F 4WENB 4FAAB 1BXAA 3V6BR 1JHLH 2MNUA 4HIPA 4N1EA 4L3CA 4Y4HD 4P9ML 4WHDA 3T4AC 2WC7A 1AGEA 3I3DA 4AEIL 1PDKB 2J3SA 4MJ5A 3T2PA 5ILTL 3F7YB 4J3OC 5C9JB 1OCZB 4FYQA 4M5YH 4R5VA 1S5IH 3X11B 3NK3A 4S10A 3D08A 3WTXA 3MUGB 1CXIA 3HI1A 5TE7L 4L8SB 3IMTA 2PO6A 2V5MA 5EZIH 3CSTA 2VLKB 3Q5YA 4FTVB 2VDKL 5JOFA 2WXLA 1GR7A 3NGBC 3Q8BA 3TONA 4JRYD 5IJDC 1K72A 4AQAA 3SDDC 2BOCA 2ZNXA 4HWUA 3C75A 1P5UB 4JZOB 4ZUTA 1CTOA 1REIA 4KK8C 3RL2A 5L88H 4KY1H 5GISH 3TASA 2ZWKA 3NDZE 1XSKA 1NBZA 2B08A 2Z35A 1JZ4A 1BVZA 3UYPB 1NAML 1HZKA 5E08H 5ELIA 3LS5H 1E4XL 2OJZH 4PN6A 4ETYA 5J6HB 2DEWX 3BSZA 1KPUA 3NFSL 1OPGL 4M43H 3NQIA 1IC0A 1KT2A 1ITCA 3FCGA 3AT8A 3QXAB 2E9GA 2XHNA 3NSXA 3UXFA 1DEDA 4YPJA 4C8XA 4P23A 1PLGH 4E0RA 2HKFL 1MFCH 2TRHA 3IETB 1DN0A 1ZHNB 2R23A 2VR3A 4NZ8A 1AXSA 2DLFH 4ONGL 2EABA 3C8KB 3B2PA 2J5LB 1CGSL 2V33A 4QEGA 1CUOA 2CKNA 2AERT 5ADPH 2H3KA 1L5GA 2B20A 2G30A 4TSBH 4DN3L 1IJNA 1KWKA 3MREA 3RIKA 2Q3AA 5D7JD 3O2VH 3VSVA 2GKIA 3VG9B 1O9WA 2CUIA 1CLCA 1EJOL 1YZZA 2HFTA 5H2BA 4OLYH 4O51B 2OI9B 5E6UB 5CSZA 2VC2B 4U6XA 4E9TA 2X12A 2XWZA 4KROD 5I76A 3TO4C 4ORGA 4NNYB 4F91B 1TZIA 4PV9A 4OCNC 4LSRL 4H25A 4R90H 2J8UA 4NFDA 4D0CB 1EO5A 1CDYA 1JNLL 2ID5A 2PPDA 3ZGHA 5F88B 4G83A 1HHJB 4EIZC 3GSWB 5F1IB 3P2BA 5AG8A 1FCGA 5KBMA 2EP6A 2R1YB 2YEZA 2BHUA 4Z0BH 3TVMD 4LHUA 4PAZA 5TE6H 1P5VA 1M2VB 3L81A 4KY2A 5CMAB 5DRWA 4J3VA 1E5UI 1TVBA 4ZMOA 4KZDL 4HHGA 2VLRD 1U3HD 5DSCA 1B3IA 5KYXA 1RUMH 4QIRA 5H4YA 1OWWA 4B27A 5LLIC 5ISZE 4RIRA 4EIBA 1AFVH 5HDQH 2Y3NA 3ABMB 1S7SA 4F57L 2AITA 2ZUYA 4XPBL 3HI1B 4Z7UE 5IOPB 3HG0A 5JXAL 4FG2A 4OGYL 1JF5A 3O4LA 3DO7A 1RKRA 3QRGL 5F8QC 1HYRC 4JG1H 1ML0A 4XVSH 4W9IC 3TV3L 5BS0A 3NAAL 4L1LA 4R7XA 2G5BA 5CN2A 2R2CA 5JOFB 1MRCL 2D73A 1GS6X 1TQBC 4UBDC 4JFED 4B9ZA 4NFBA 4MA1C 2QKSA 1FH2A 4DP6X 5ADOH 2IDQA 5DFVD 3IFOB 3UFIA 4Q9QL 2XQBH 3D9AL 3Q1SH 4MS8C 5H35A 4G9DA 1E3ZA 1NBZB 3MUY1 4HWZB 4J3OG 3WXWL 1SJEA 3K6SB 3L4ZA 1ACXA 2B0SL 3TBBA 1YPZA 4R96A 1B4LA 2PF6A 1PZBA 4D3CL 4OD3H 3IMUA 1CF8L 3B2VL 3KXFB 4G7YH 5FO9A 2ADGA 3D3VB 3WEMA 1A1MA 1JUFB 4JPWH 3X14B 1SGKA 2EINB 1JWUA 4GXUN 4PRID 4ZNCD 3QT2A 4LGPB 4MJ6B 4BM7A 3T0WA 4Z1PA 2EXSA 1AG6A 3BI9X 4QY8A 4MASA 5I28A 2V0AA 3V0DA 2C3HA 4H8WL 2YAHA 3V4PA 1U30A 3HNVL 2CALA 4HLZG 1NDMA 4L8SC 3QQXA 2O61B 1D5BA 2HVKA 3QUMH 1XGTB 2MCPH 1QMUA 3BHBA 1DJIA 4NHCH 2G5RA 4Y19E 3HC3H 1UXWA 2P43B 2FGWL 4W4NA 4XCFL 4NQDD 5EN2A 4F24A 2JJTC 2W81C 3D18B 4PD4K 3P0YH 1L5GB 2HX7A 1BVLA 1P5UC 4P57A 5DJ0B 3MREB 2CCLA 1EZVY 4AW7A 4ZMQA 1T2QL 2FEDD 2BSED 2NQCA 4HEPG 4EQ3A 2B59B 2N1KA 5H2BB 3ZDYF 1OGSA 1TCMA 4HJJH 1NGQH 4L48A 2OMBA 1J18A 4JFDD 5FX3A 3SODB 1EVUA 4DKDC 4A55A 1P9MA 4PWIA 4HD5A 2B3RA 4LKXA 1I7RA 3PREA 1NL0L 4EI5D 3G9VA 4OR1A 5DQ9B 5C0RL 1TZIB 1JZ2A 1O0VA 3HE7B 3KLHD 4LL9A 3DO3A 2F18A 4XP4L 5DO8A 2CGYA 3D2UD 4A04A 4LZKA 3RWHA 4KDTC 5IB4B 3P30H 2LW3A 2K6WA 5EBWA 3PQYB 4PB9H 4P5KA 4X5WB 5FYLL 3B2DC 3TNNB 4LHUB 1SDYA 1P5VB 3CVBA 5LAXB 4J3SA 5JZ7C 5DRWB 1F58H 3MJ9H 4NENA 3WIAA 2K8QA 4YHNB 1N5AA 5DSCB 4HK3N 3UTQB 3QEQE 3K91A 3P2DA 5EORL 4PJHE 4RIRB 3U2IA 2CBTA 1Q9KA 5DF0A 2CRZA 1CU4L 2V17L 3L16A 5EU3B 1S7SB 3MV7D 1BZ8A 4H2CA 4UT6L 4OZFG 1H19A 4NT6A 3DO7B 4FABL 5BS0B 1FSKB 1GHFL 2K8MA 4U6VH 1OPOA 4FMFA 3FL7A 3KS0J 3R19A 2FCBA 4W9EC 3WE6B 2DLEA 5F0MB 4XX1E 2X38A 3MCLH 2R4SH 4MBOA 1G1KA 1LD9A 5FFGA 4IRJD 4KGJA 5EOCL 4J3WA 3BXNA 1RULH 1W80A 1ZGLP 1Z9PA 5H35B 2KPNA 1G1OA 2YAFA 1SJEB 5ACLA 1DJZA 3CCHA 4LCWA 4OI8A 1YPZB 3NA9L 4QLRA 1NGZB 5FO9B 2ADGB 3R4RA 2XV6B 1E6OH 2VDNL 3QJSB 4EUPH 2HPOA 4LDLB 1JWUB 3V5KB 4LOVA 1A1OA 1QLEH 3IDMA 3VFNA 3O81A 3CU1A 3QCUH 5AYTA 1T1WA 3S8FB 3V4PB 2DBJA 4BEIA 3QORB 4JRFA 1NDMB 1JDAA 1EAOA 3E1F1 3EDDA 2HVKB 4XO4A 5CLYA 3WU1A 4QYOA 4KPHH 2PCFA 4I0PD 2Y24A 4N26A 4RRPM 1UXWB 3GMLB 3B8YA 3RQ3A 4OZIE 3ILQC 4LPVA 1SBSH 3P02A 4YFDB 4X83A 5FOBA 1QR1A 1K6QL 1BVLB 2JQMA 4I3RL 3RWGB 4KHTL 3CV5A 5T1LA 1TMQA 3FTGB 3TBVA 3HG1A 4LP8A 1G7PA 1G84A 3WLWC 2AQQA 1E40A 1TZHA 5DMIH 4EN3A 5J1SC 3GO1L 5EU6D 3PWNB 4FNTA 2JXMA 4XI5D 1GGBL 3KYMA 2NNFA 5BW7A 2NXZC 5CSGA 2VW4A 4XNXL 1UWXH 1B4RA 4LKXB 1BF2A 1SDDB 1UG9A 2PPFA 1CCZA 2UY6A 3SEPA 1M05A 2UWEA 3PPSA 3SN6N 1EGJL 3VXME 5DURD 1LXMA 2AF2A 2ATKB 3MOBH 3RWHB 2B14A 3NDYE 4WV1A 1IGJA 1X5IA 4BH8B 1S7WB 4K7FA 1FG9C 3L4VA 5E4EB 5FDYA 2P46B 2FECI 2IG2H 4JPSA 1A9VA 4HJ1A 2DN7A 4HS6A 5EO9A 5T1DL 2APTA 5TDPB 1HXYA 3CSPA 3GLZA 4QTIL 3K5RA 3QUKB 4YDLB 3OB0H 3BJLA 4NENB 2GJPA 5GS0H 1ORQA 4KMTL 3HAEB 3L1FA 4KBPA 4RDQF 3QC5X 1T5WA 1UJ3B 2APBA 1WIOA 4ZO7A 1FO0L 4IHBA 4Z8FL 5CEZL 4FOMA 1DDHA 2Y06H 2IH8A 3O2DL 5T5NG 1M7DA 3MOAL 4RMQA 3PNWB 3BT2H 4NCDA 4NT6B 3TH3T 4BINA 1E90A 1MHEA 4DZBB 4F33B 2LQRA 3ASNB 2EKSB 1XR9A 4UIKL 3L4XA 4WO4A 5DVPA 4KQ4L 4H26A 2PETA 2Z7ZA 5CP7A 4N0FB 1QBBA 4F7EB 3HE7C 2UZYB 3WUWB 2F58L 3L7EA 2C9VA 5E00A 2WZPD 3VWKA 4ZZFA 2XWTA 1KIPB 1XT5A 2Y7MA 5CGMA 4NQTA 4LCWB 2W0LA 1PCXA 4OLVL 3DHUA 5E5MB 3HUJA 2WLZA 3BZEB 1JGVH 5GGSB 3FTSA 2WLIB 3UCRA 1KNOA 1BFVH 3CFDA 4KU1A 3BESR 4IRSA 3V6OC 3O8XD 5B39A 4H5SA 2FTAA 4ZW7A 4ZMLA 3MGAA 5DD5L 1YEJH 4JHBA 2C34A 3CN3A 3QB7C 1IGTA 5EIIB 3AG2B 5F7KC 3S2AA 5D7LD 9CGTA 3HMXH 1QOKA 4AGQA 1A3RL 3BPLB 3UAJC 1CO1A 4HLEA 1FSKC 1T1XA 2AP2A 2X0WA 1CXHA 2FO4B 3DSNB 1HCYA 4ZPVA 1IZJA 2Z31A 3Q2WA 4GQZA 2CO4A 2WLMA 5D7IA 3M88A 5F1NA 3B7RL 4NJAL 5FOBB 3VI3A 2NMSA 4G8GA 5DC2A 3Q2NA 4NQSB 4EF3A 2KLRA 1G7PB 1VDGA 2FX7H 3BFQG 1TZHB 3ZE0F 5DS8B 2XUWA 2WAQA 4QHKJ 2PCYA 4JQIL 3OZKA 5I1EL 2JIXA 2F53D 3JWNH 3BWAA 5E51A 2AK1H 3QEGL 4P2RB 1WWAX 3ZKXB 2X6BA 3VFVB 4K5LA 2ZP0T 2UY6B 4IIQB 4U1JA 1BMZA 2UWEB 3UTSA 1UEMA 5LXGL 2VTFA 3OXRA 5DFWH 4AG4H 3CSYA 3QORC 4WV1B 3RWJA 5HDRA 3DUSB 4R4FL 5AOJA 3G9AB 1BG1A 4BSVB 1M42A 5BQDA 2IDTA 5J11B 5EO9B 1HHHA 2F8XC 3MUZ1 2J8UF 3AG3B 1GS7A 4U3XA 1KTDA 2KPWA 4X80H 4DO6A 5FM8A 2FWOA 4EI0A 3HIZA 3VGDA 4PW3A 1XAKA 2Q3ZA 1I8MA 2VXSH 4QHPA 5DS2A 4TUUA 2AS5M 3GHEL 5AD0A 1HQRB 1OAXL 3MACL 3ZQWA 2C9RA 4IGBA 1DDHB 2RACA 5FHBH 5FOJA 3ZMEA 3CN1A 5E9AA 4XP5H 3N40F 2J1XA 4PJCA 4Y8AA 2UZXA 5TE7H 3ULVE 1AZUA 1KB5H 1SJHA 2H7WA 1LO0H 4OLXL 1YEHH 3AC0A 1U95A 3L5XH 2QTEA 3OLDA 4MHHG 4S1DC 2R1WA 4OLWH 4NUJA 4HDIA 3GMQA 2ZSVB 2OZ4L 3SKJH 3QIWD 5F7AA 2KZBA 4HG4J 1YY9D 1SNRA 2JELL 4DUVA 4MAUL 3B2MA 3MV9D 5E4EC 5IGXH 5JXEA 1JZ7A 1L6XA 2CCWA 1SEBA 4M62L 4QXWA 1WZLA 1T66D 3L4WA 2N7SA 4BQBA 3ASWA 4TVUA 3GXFA 4DW2L 4K7PY 3LQAL 3RB7A 5DC0A 1KBWA 1XQ4A 1QR4A 4N0YL 4QRRD 3QFGA 3TJHC 4LCCA 5GGVY 1HEHC 3BSZL 5MP6H 2R0ZL 1WVZA 1EBAA 1MLBA 3QUXA 1UJ3C 4U31A 2PWHA 1C08A 4IRSB 2P5ED 5B39B 3FF8A 3QJRB 3WELA 4PJXF 5SWQA 2UY7A 1DFXA 4H0LC 3QCVH 1KXQE 1TVDA 2FJSA 2JI2A 3RHWF 1ZPLA 2HKFH 1I8LA 1HSAB 2JTDA 2D03L 4FFYH 1WZAA 4ANVA 4LLDA 1U21A 1TYJA 5D7IB 2GITA 4JRYE 4Y4FC 2R51A 4LHUG 5F1NB 4J4PC 1INEH 2ITDB 1OE3A 1TZ8A 4G8GB 3O2WH 5HVWA 4HK3J 2DTMH 5GGUB 3VQ1C 2QKIA 4FULA 4DN3H 5E5LA 3CFIC 2EZ0C 1UACH 3VXRD 4D9QD 4G42B 3L13A 5K1NA 3D06A 3ZHLA 3OJVC 4MWFA 3KMDA 3ZZSA 2HTLD 1F90H 1SYVB 1OAUL 4HAKA 2JIXB 2FEEL 1WD9A 1YLBB 3BWAB 4PRPE 4U4BA 5ESAA 1T1YB 2V3DA 4ISVB 2EDDA 5HDWA 4KQ3H 1E5YA 3WNOA 5BUAA 2F54D 4G1MB 1E6JH 1WFOA 2AVFA 3OXRB 2Q87A 3LZQA 3U30B 3CSYB 4BZ2A 4QUOA 2YMTA 5JUEL 5TFSH 5HDBF 3RWJB 1C5CL 1QAWA 4EVNA 3H7LA 5BQ7A 5JORA 4PEEA 1KEGH 5F6IB 3SYAA 5DYOA 4LK4A 1FZKB 4HIHA 3KPTA 3IMWA 4AE0A 1TITA 4PS3A 2VR5A 3LV3A 2HJKA 4OM1L 3J27A 3T3PF 3ZE2E 1H6FA 3O0RL 4JHAL 4KZDH 5L6YL 2IALA 2J8HA 1D9KB 3C09B 2Y7SA 2E6PA 4AKPA 4Z3IA 5AD0B 3QPXH 4IGBB 4AVIA 5GRJH 4O5LL 3VU1A 4JY4A 1QLFA 4LCYA 2YD8A 1ZT7B 3GXTA 3I2CH 3U82B 2OS7A 2ODHA 1HVXA 3H9SB 2XYBA 2UZXB 1G7MA 3B9VA 3B7YA 3M1CA 4ZBJA 5JXAH 2ZUXA 4WWOA 5IFAH 1CTNA 4RMRA 1U3ZA 1MHCA 5ANMB 4U1NA 3P2TA 3TV3H 4GBXC 4N87A 1HN1A 4AGNA 4IIQC 4PJDA 4WRLA 1MOEA 2VCOA 5IFJA 4NUJB 1SXBA 2R8SL 3GMQB 3EO1A 1BXUA 2B9AA 3MUUA 3J2PA 4OI7A 4HKXB 1WF5A 4N4YB 1A7QL 4MZ2A 5EFIB 3O41A 2ESVD 2CK0H 4XNAA 4DEPB 1WBYB 4GIOA 3X12B 2Q8BH 4A68A 5HVHC 4UYQA 4FCHA 1N59B 2Z4QB 4FG6C 4LCCB 2H3XC 2P5WA 1L9TA 4QRTA 5E99L 1PZCA 1NOLA 3GXIA 5PAZA 4Y1AA 4GSXA 3KEDA 2WKOA 2VXTH 4WKXA 1G6RH 1ZVHA 1C08B 1RZGB 5C08E 1XZWA 3HCVA 4PCKA 3Q13A 1EQWA 2B3IA 1F8TL 2JKRM 3R06B 5EO0A 1YMMA 1OW0C 3ZHNA 3WV0A 4BA8A 4NSKA 2UY7B 1Q0EA 2V2TA 1CGVA 2FATL 3GM8A 1QI3A 3MR9B 3QQ3A 4LSVH 4XP1L 1BQUA 2WXIA 1D5ZA 1AZBA 1U8IB 4MVBC 2GITB 2L7UA 3T0EA 1ZANL 1UA7A 1DDTA 4HIIB 4YR6A 1AIZA 2IANA 4JFEE 5DQJA 1JPTH 4ZFGL 1T21B 1RIVH 3S97C 4PUBH 2ENSA 2KDYA 1Q0XH 3GZPA 2QKIB 1A4JA 1AXIB 3F7VA 1XV8A 2YUWA 4UV7L 4YHLH 4UILH 4B41A 1DQDL 5HGGS 3H85A 2VUOA 3CFJB 1YNKH 2VZTA 5F0LB 3UTPE 3VRIA 5ESAB 4LIQH 4OZGA 1SLVA 3QDMA 4N25A 3RDTD 1YAIA 2J55A 1FJ1A 1H6EA 4PVLA 2XXMB 3DVNA 3BZFB 2BWQA 5C0RH 4JS7A 4XAWH 2AQRA 4HULB 1NCWL 3WFCL 3WUWG 2VXQH 2VDQL 2ZUWA 4KUCF 4CN6A 1MJ7H 1IZKA 4J8QA 3VXPA 1WAAA 3GPEA 4Y88A 3AUVA 3B3IA 5EEVA 5F7DA 3GGWB 5JOPD 4HIHB 5DJ8A 4ODHH 4TQIA 1RK1A 3KPOA 3WSQH 5EZJA 2B16A 2D3VA 2Z92A 4DNLA 3QEHB 4OFQA 4CC4C 2IH3A 4D7PA 2IALB 1E7VA 5D1ZB 4Z95L 2VO5A 3DX1A 4FDWA 3JV5A 2FR4A 2YOAA 1QLFB 6PAZA 3SJVB 1Y7VA 2H6PA 4G6AD 3LOWA 3FYEB 2UXFA 3O6FD 4WEEA 1QHPA 1A6VH 3IS1X 2A83B 4LLUB 4JFDE 5EIIG 4E41A 5BOJA 1MHCB 1QYGH 1G7IB 1GYWA 2BNQB 5ABAA 1AR1D 2VT0A 4XBEL 2E7LA 1BPLB 4K3JL 5T3XL 2XT1B 4FFTA 2YQBA 3RX8A 5B1BB 4DP4X 5AOKA 3U30C 5I1JH 4QRQA 2YXFA 3PP4H 1RP9A 4YOKA 4UINH 1S7RA 5EOCH 3O41B 3RGHA 5EEWA 3GEWB 4XNYL 5F6IC 2ZYIA 1CI5A 5E2WL 1QWHA 2DMHA 3RFRA 5T1MA 1AZRA 4AIXA 4M48H 1IBDA 2H5UA 2VH5L 5D1QD 3AT9A 2MPAL 3R18A 1M7XA 1OB1A 4LP5A 2ARWA 4JQXA 2VM3A 1D9KC 4JMNA 4ZK8A 1RZPA 3CFCH 3HCVB 4KTDL 1U9KA 5EO0B 3RA7L 2Q7NA 1YMMB 1RJCA 3HUJF 4XZ4A 1N6QL 4RCAA 2NSQA 2JI3A 4TNEA 4UB0H 4X7SL 3WNLA 2V2TB 4OB5H 3QQ3B 4JO1H 4MQ7B 3QJHA 2A6IA 3KLSA 1D5ZB 3DXAB 2P9RA 4L29B 1JFQH 5DMGC 3T0EB 4KXCA 2AQ2A 3SE9L 1LE9A 2XG4A 3DYOA 1S9YA 4OU3A 1DQKA 3B3BA 1QO3B 2EDXA 1COBA 2WWKT 1A4JB 1FVCA 4XPFL 1E8WA 2I24N 3IVKA 1IBFA 1XGRB 2F74B 1F3JB 2R2EA 3ULUF 1GPOL 4J7RA 3AACA 4MD5A 3GO1H 1FRGL 5AZEL 3VI3F 4AL8C 4KI5C 3WIIL 4GKSA 2AC0A 3IF1A 4OZGB 4XXWC 1LTXA 1G0XA 2WN2A 3QI9D 1FJ1B 2W0FA 3HBQA 4F15B 3TL5A 3DVNB 3ISYA 3UYRL 1A7BA 2CM5A 4BFBD 2Q10A 4BJLA 7FABH 4MNGB 4ZXBD 3W0WB 1BAFL 2DQUH 2VQ4A 3JWOL 2I32A 4AUYA 5F7DB 3ETBF 1XB8A 3J07A 1RK1B 3FU7B 3JVGA 5EZJB 4HHAB 3MV01 2WP3T 4X4ME 5T3ZD 1SRDA 3TYFB 3DJZA 4DGYH 2Q8AH 2EE6A 5DRXA 1PIFA 3G5WA 2IH3B 4JB9L 4HXAH 1KULA 1USZA 3W39A 2NCEA 1GH7A 2BDNL 2D7TH 2NY4C 3O3AB 1OF0A 5C6WH 2P1YA 2ZG3A 5HTSA 2H6PB 5EU6E 5B39G 1T7ZA 2NYKA 4TQEH 2AK4D 4GSRA 2Y2TA 2VSKB 2F2HA 1EPFA 5H37H 1MRFL 2Q3XA 2H3NA 1KB3A 4WZ9A 2GBTA 4MXQC 3X13A 2DQHH 3CXFA 4I9WD 1QBML 4LLYA 5D70L 5KUMA 1JMXA 3T04D 2NOYA 4FQPA 3GT6A 2D7NA 3OC8A 3NCCB 2H8PB 4I2XE 4PJCF 1EA9C 2XV3A 4QRQB 5ISZA 5LJYH 3QDAA 1S7RB 3OJ2C 4MXWH 3T8XB 2XXCB 3DRQA 1TIUA 3G6AA 5EZOH 3MLZL 3FQTA 3RIAF 2X0VA 1XHHA 1MWAH 3FTVA 3BKJH 4XHJC 4EIUA 3WIFA 1JAEA 2JKWA 2WD0A 5F6HJ 3REWB 4X6EB 4GP4B 2WV3A 1DVQA 2Y2YA 1OLZA 1Z3RA 2ZF9A 2RHEA 4MKMA 5DFTA 5HHQA 3VXNB 5D1ZC 1R3HB 4FEMA 1OE2A 2F5BL 3IDUA 3RAJH 4PSPA 2H47C 1F4YL 5JW3L 1SXCA 1N5YH 1UD4A 4DP8X 1IC1A 1A5FL 1QTPA 4HT1H 3O9WC 1LILA 2IAMD 4UTBA 1UYWH 3A0OA 1W8EA 3SPIA 2XG4B 1JZGA 3FU0A 1D5IL 2ZUSA 3H54A 2X88A 4NJAH 5DZOA 4HVBA 3N04A 4S1SL 2YO3A 2HH0L 4LP4A 1FVCB 3IU4H 1DBJH 2YEVB 2A0LD 3T6XA 3TWYA 4A6YH 3IVKB 3WHE1 1CFSA 1WUNT 1TCRB 4MD5B 2NZ1A 4K07A 2H41A 1XGQA 3VFPB 3MLSH 2VDLB 3IF1B 3SBQA 4WWKB 2K45A 3HE6D 4TUOA 1M9SA 4Y19A 2EJ1A 1KY6A 3EUUA 3QXTA 4JFTA 2W0FB 4LLAA 1ET5A 3CMOL 3WJJC 2FUQA 1IAKB 4OSUH 1NKRA 1B6UA 4HKZB 5JIPA 2DEXX 3SGKA 4UUJA 1FVDA 2Y72A 32C2B 1KCKA 5IVNA 5D7LE 4M6NL 5CJQL 1TO4A 4NUMA 1Y6KR 4XPAH 4PP2A 4GMTL 5BZDB 1E4WH 1U8OB 5C0DA 1Y1UA 4AYID 5C2BL 1A9EA 1WPCA 2Q9OA 2EIKB 2FSDA 5CKAA 5JMRA 1OWRM 1IE4A 2NNXA 3ILDA 4HGWB 1HEZB 5JW4R 1P7QB 1PGRB 1FPTL 2FH8A 2WM0A 2QJDA 1JZIA 2DIEA 3U46A 1HL4A 4PRDA 1VCBC 5LBSA 3WENA 4RFOL 4ODXA 1GY1A 1H3TA 1KCRL 4AI7A 3GS4A 3MUJA 3MACH 4U2ZA 1R3KA 1PLCA 1EO8H 1XR8A 4X98A 3EDJA 2OSLA 2GSIA 5B7MA 2F53E 3QQDB 4CADA 1MIEL 2H3NB 1FYTD 2W07A 4OLXH 4LLYB 4NQED 4F15C 3NZUA 4NHUA 2YQ3A 4PHZA 5EIVA 1Q8MA 4BK5C 3NEEA 5F6HI 4JM4H 5J5EA 3EYQD 1AKJD 2F7PA 3ISWA 4Y4KB 3S3JA 1IM9A 4FNLL 2DQFA 1CC3A 3KYKH 4I0CC 4K8RL 4UF7C 3BZ4A 1YJDL 4Z7UB 4PJDF 3BVUA 4U1LA 2OCCB 1QFWL 1DN2A 1P4LB 1PFCA 1T0NB 1FAIL 4XXCA 3WTUA 4MD4A 3DTDA 5BOPA 1IVTA 1EZVX 4XPHH 2H2PC 3LQAH 4UV4L 2VR7A 5KVGH 5E2VL 2ICCA 1YEDA 3CFBA 3PAYA 5D2NE 3WTTA 4ELKA 4HIQA 4ODSH 5HPMA 1ZWIA 2ZE0A 1A1NA 3A4FA 5C0CD 4QTHB 2FQGA 2H6OA 1F5WA 1WTGT 1IGML 1XGYL 1J1PH 4PJ9C 1LEIB 3H2WA 1PQZB 3KYOA 4MDRA 1WRFA 3L6FB 5EG6C 3WEAA 2OSYA 3VNYA 3SBWA 5FECA 1G7JB 1RJZA 1ORSA 1RLBA 1A6TA 1Q1JL 2GC4C 2Y1YA 3C60A 5GJTH 2D03H 3MHZA 2EYTA 2ED6A 2A9AA 4OFPA 3RZCD 3PJLA 2O6EA 5F96L 4FQXA 4OF8A 1WWWX 4JJOA 4E5XB 3DI2B 4HCRL 4M4PA 5FDWB 3ZZ1A 4H44C 3MV9E 4R4ND 2JJUA 3FF7A 3QO0A 4JRLA 3SDCB 4O02H 3K71B 3NCXA 1QWNA 1TYRA 1V10A 3HC0A 3JT0A 1XGQB 5KTEL 3O6KL 4GAFB 1FGNL 3FQXA 4KKBD 4QRRE 3DV4A 3MRHB 3HZKB 3G5VA 4YNYA 2N0KA 4AYMC 4EMZA 2YJQA 1OSPL 2WSPA 5T5FH 1NCIA 4APQD 1A6UL 4P4KA 4ZMWA 4OJDH 1FH5L 2P5EE 2L04A 3V0JA 4OZIA 5CP3H 1WUZA 4BZ2L 2VZOA 1AJ7H 2B5IC 1QSVA 2J5WA 2ED9A 4MMXB 1SJMA 2X1OA 1DBKL 1MREL 3ZYIA 3BVWA 1AS6A 1A9EB 4PJ7E 5HXMA 4DIXA 3BCFA 3F7RA 4HBCL 5IQ7H 4FS0A 1CGTA 5EF1A 1LEKA 1EVTC 2CDEA 1PD0A 4PYHA 1LO3L 2DQJL 4LLQA 3O0RH 3U46B 2WXGA 3VXMA 1FFNB 3CC1A 3QYMA 3VXRE 1HE8A 4GW5A 4D9QE 1CVSC 4PJIA 1MFNA 3D4CA 5I73B 2C5DC 1M6OA 3NCYS 2MTPA 5C07B 3NPSB 4X98B 1UEYA 4WUKL 1JGLL 2OSLB 1XEDA 3G5YB 5H94A 4WWKC 4AYFB 2NNAA 4J12A 2Y9RT 3A22A 1ZDQA 4OQTA 4Y16D 4YXKH 1T5KA 5FYKH 2HFFA 3FO0L 2F54E 5AYUL 4NHUB 3NIGF 3P73A 5E2TH 3QEQB 4NKIL 4WF7A 3WS6C 4PJHB 3W57A 2ZOLA 4BHUI 1IM9B 3ECWA 2ENYA 5C0NC 2AFNA 5GS0D 3TIDA 5DQDH 4QR7A 5F44A 4LU5L 3QRLA 4U1LB 1C1EH 5C0AB 2OX5A 4XNQB 2GK2A 1JPFB 3FT3B 3OKLB 5K9QI 3LQZB 1T6BX 3V6ZA 1Q72L 1NLDL 1JXDA 2F7QA 3CFBB 5AW2B 3VYOA 4KK6D 5IVOA 3QWOB 4ELKB 4LVOC 5HPMB 1Y07A 1ZWIB 4JLRB 3KJ4B 3VE0A 1VZIA 3JYBA 3MTRA 4FZ8L 3UO1L 1GGTA 1BQKA 1RVFL 4PSRA 2UZIH 2CA3A 1YEEH 4N0UA 2FB4H 3DPBB 3G5ZB 4HIJA 3FB8A 1RJZB 1ORSB 2W9EL 1VFUA 2WTOA 1MFDL 5AKRA 4GRMB 3UMTA 3ZZQA 1ZANH 4QHMA 2FD6H 5D7KD 4WTZA 1J0YA 5CU5A 4FQXB 5CWSA 1PSKL 3RILA 3EGXB 3SPVA 2JKXA 2HJFA 5F89B 4YL4A 5IMKB 2AJSH 3FT4B 4WWNA 3TEXA 1KYFA 2QQKH 1P69B 4PJ5A 2XWEA 3KPMA 4N2EA 4UV7H 4XNUH 1KIUA 1FBIL 1T04A 3FQXB 4JM2A 5A2JH 5A16A 3DV4B 3G5VB 1BIIB 3LNGA 2WLYA 4YNYB 4GRWF 4E9RA 4IEFB 1AD9B 4CSPA 1FNEA 1XL4A 2I26N 1A2YA 4LEOA 1NBCA 2VLLA 1IKNA 5KANI 4OZIB 4DOHE 2CRIA 4XPTH 3HMWH 4YHZL 3FQYA 5KSBF 1BP3B 2QVTA 4NO0A 2JFCA 2KZ1B 1J0IA 1BQRA 1GJUA 2HRPL 2OMUA 1P7BA 3E9TA 3GZOA 1CGYA 3QUYA 4GSDH 4KO9A 4CW1A 3EXLA 2DL2A 3MROA 3PWPE 2PTVA 3G6DL 3KZ8A 4TL4A 1VGEL 5IHUH 4WNQB 4Y5VA 5A1AA 3G04A 3HZYA 5DWUL 3IXAA 2GJZA 2CDEB 2A4ZA 4OD2A 3HI5L 2Z8VC 4NYLA 3JWDH 5KVEH 1ETA1 3SDCC 3GBNL 3MMEB 4U6YA 2CBPA 2DIBA 5F7WC 4YXLL 1NPUA 3R7RA 3HHMA 1SM3H 3FO2B 3DKHA 2NNAB 2OMWA 4MAYD 4ZTPL 3DTUB 2GBUA 4QGYA 3KWUA 3K8KA 3EHBB 4TLKA 1TDQA 3KWVA 2X3BA 4GUPB 3P73B 1KENL 2CBMA 4S1RL 1G7HB 5T3XH 1KCLA 4H8PA 2MCG1 3QR0A 1U33A 4HAGA 2DJSA 4MMXC 5C97A 1JIBA 2QHRH 3FZUC 3STZA 2GEQA 1QX1A 2CIKA 5A2AA 3TIDB 5DHVA 1P0SE 4XNYH 2V9UA 2XFXB 3L3DB 1UWYA 3QJXA 2OX5B 4KO7A 2LTQB 4JKPL 3NABH 5DR5L 1KACB 1LE5A 3P0VL 4G8AC 4IBTA 3AREA 3SCMC 5DK3A 3FUKA 1NUFA 5E0QA 4CU7A 3D1MC 4IOFD 3H9HA 2NZ9D 1ZLWH 1GAFH 4EN2A 3GSUB 5AW3B 4DTGL 3B7UX 2YK1L 3IDIA 5I73C 3OKOA 1N6QH 4Q89A 3NPSC 3PAZA 3GTNA 1E2ZA 3OHXC 3ME0B 2EC9T 5I1DA 3L9YA 2DM4A 1HIMH 4ZS7L 2CE6A 5L4FA 2ZWNA 3VFWA 2VDPB 4G8FB 4JY6A 3BUPA 4Y4HA 2VDRB 3ILEA 3VJ6A 4MRBA 4QHMB 1M3IA 1KUMA 1CDGA 5E03A 1QLRA 3VB8A 35C8H 4TQHA 1HZHL 2HJFB 3K8MA 4N3UA 3NSYA 5FW6A 4M7ZB 3VX1A 1AC6A 4HUWB 3OLEA 1CG9A 1T04B 4JM2B 5PCYA 5A16B 1KXQA 3L3HA 5D1QE 2JJSA 1BZEA 4OVUA 4ECNA 5EWIL 2Z34A 8FABA 4KKCD 4QRSA 3N0AA 3MFFA 4OD1H 2ADYA 4PR5B 2UX7A 1QQDA 4NO0B 2B8OT 4NKQB 4R7DB 2OMUB 1MN4A 2QPEB 3FFDB 1R24A 1NC4D 3V0FA 4OLUL 1XGUB 2FHCA 5IVZB 4OCWL 2BZCA 3OXSB 4XCEA 5F7FA 3SOTA 4HJGA 4Y2OB 1TNNA 4YDZA 3IJHB 4WQOA 4HJUA 4Q9BA 2NY7H 3NCYP 3PWVB 4OH2A 4RAUB 4PRPA 5IB2A 1RZ8A 3G04B 5CILL 4JPVL 1CLZL 1GC1C 4HMDA 4TV3A 5BZXA 3L4TA 3OKMB 2DIJA 3D0LA 4NYLB 4K7PH 4QCIA 3U25A 4K7PX 2KZWA 1OQXA 5GGVH 2BDNH 4L4TB 1ZIBA 2P8MB 3U0TA 3H3PL 5CGBA 5GXBB 3IB4A 2XN1A 2PTUA 4YHML 5I19L 2IOMA 1HFUA 1YO4A 5FGBA 4BBWA 3CPLA 2OMWB 4KXDA 2O93L 3VTAA 1FQ9C 1PVHA 2Y5TB 1ZEAL 4U3CA 3LNIA 2NY1C 3T8MA 5ICZA 4CC0A 3ZSSA 2VLJD 4QXUL 3HC4L 3JTTA 4JN1L 3OX8A 4BRJA 2BVPA 5DHEA 3QG7L 4X7TB 2WNXA 3CZUB 1INDH 1NM9A 2RALA 3ARDB 4WW1B 4F8QA 3STZB 3F85A 5L2KD 5JLZA 4C58B 5JPMB 5DO2D 2DI8A 1Q0YL 3OKNA 3PABB 4E5XG 5DHVB 1F3RB 3KBHE 1U6AL 3DGGB 3FFCA 6CGTA 5FFOA 5T3ZE 1ANUA 1AQDA 3HI6L 1MCSA 3MBED 4ZUWA 3VFTA 3OR7A 3VFMA 3OAWA 3WS3A 1XBDA 2XXFA 4HIEA 1MH5B 1DQQA 4KV5E 4RGND 5E0FA 2BMKA 5IMLA 3LEXB 1YRKA 2CBOA 4DK5A 4MAZA 2CRYA 3IDIB 3BIKA 5HYJA 2VERN 3S6CA 4V1DA 1J5CA 4BUHA 2XY1A 4NP4H 2AK4E 3LKRA 5JW3H 3SYOA 2KYIA 5I1DB 2GTWA 1U8PA 1JZHA 4O2FB 4RFNB 3TVMA 1Z3GH 1CT8B 4I9WE 4EZKA 4L8BB 1MIML 3EHBC 3NYKA 3VFWB 3ULUH 5CAYB 4Y4HB 3VJ6B 4HF5H 25C8L 3E3QE 3QG6A 4XWGL 1I85C 5D2LA 1UUNA 3MLRL 4OZHA 5C08A 4S1SH 4PY7A 4EAEA 1JV5B 2HH0H 4U7KA 5B1JA 3U9WA 4NCC2 5CZRA 1EX0A 4EDXB 3DOSA 2RA1A 4PRAA 2EUVA 3L3HB 3SOBL 1TPXB 4OQ1A 2X3CA 3LSOA 4IU3A 4FMKA 1CYXA 1N10A 3OKDB 3OQRA 4GOSA 5GZND 3RZWA 3VD9A 1HDMB 3MFFB 3KGUA 4JRYB 5KEZA 2RCSL 5C0IA 3OV6A 1UH3A 3O6LH 2ZZUT 2H32A 4C4UA 1NFDF 2YGOA 3QDJD 4HZLA 4UNIA 4FEIA 1NINA 1R24B 3MXVL 4GAYB 1EEUA 1JZ5A 5EF3A 4PH8A 3TN0A 4OGXH 4GMTH 5C2BH 3X1BA 3VAEA 4FQHA 3N43F 2R56H 4HG4K 1W0VB 1G6VK 2W1NA 5T8IA 5MERA 1JWSB 4OUUA 4Y4FA 5LBSL 3RVWD 2YPVL 4QCIB 2JSFA 4NJ9L 4XH2B 4ZSOE 1CYGA 4BKSC 3NJKA 5EU4A 4BZ1A 3QZWA 5IP4A 2PCPB 1MI5E 2IV9A 4M7ZC 5E8PA 4AVHA 3MRMA 4ZMTA 2M1KA 4XX1G 1KF9B 4GO9A 1FA4A 4PJ8D 5BZZA 4Z7NB 5E7BA 3BISA 2Q2EB 3NZ8B 2HLEB 2DJUA 5IROC 5BNXD 4W9ZA 4JQVC 2BS71 4X6DF 3V0EA 2Z1PA 4LKCA 1Q9OB 1B4JL 3ARFA 5ICZB 2AW2A 3LZPA 4UIMB 5LN8A 4PJIF 5LGHL 2MQ0A 3ZE2B 1QEWB 3JTTB 4JO4H 3OX8B 5HGHA 2BVPB 2J6EA 2ZCKH 1YYLL 4LT7A 5JA9A 3WFBH 5FYLD 5D7JB 3QXDB 3BAIA 3ECVA 1LWJA 4W9FC 3NZHH 3TBWB 4K8RH 1Y18A 3IJYB 2I60H 3IPEA 5I0DA 2WJ5A 2NQDA 1ONQB 3PG2A 4R83A 1AQDB 1QFWH 3CIAA 4QRUB 4JFDA 5G5DA 3VFMB 4YXHH 4KROB 3VGFA 3VMNA 5D5ME 5F7NC 3IXTB 2BMKB 5E8DH 1Q4NX 2GFBA 4YLCA 1U93A 3BO8B 3KPLA 5FA3A 3MJGX 2EDKA 3VWJA 2NY5C 1ASQA 3D2UA 5CIPH 3S8GB 1IGMH 3UTOA 3BQUD 3IKKA 5ALBL 7TAAA 2P48B 3MJ6A 1H3GA 3RYMA 2CQVA 1VEMA 3TVMB 1FYTE 2CKBH 1EXUA 5CR8A 2YPLA 4QJ4B 1A0QH 4NQEE 5K93A 2ZXAA 1ZGLA 2AANA 2VLRB 3GMPA 1U3HB 4DVRH 3DETD 3QG6B 2A4EA 2NCMA 3ARDC 3OAZH 3M45A 5F96H 2OK0L 5FHAH 5JPMC 1CDJA 2ZT9C 3KYAA 5ETUB 2FLBT 4HCRH 5JW4M 4LAQH 1W0WA 4WWPA 1AD0A 5J12B 3O6KH 5DD3L 1BLNA 1FGNH 3LSOB 1UD8A 1TZGL 4L0YA 4NDMA 5A3IC 4Y8DC 2P24B 5ES4B 5B8CB 4JFEB 5C0CE 1SVCP 4YE4L 2H32B 2XZCL 5K9OB 4IRJA 5FYJH 3WJLC 1AGCA 4TQPA 3PXLA 4KVCL 2BSBA 2AABL 4MLIA 4APXB 5EUOF 4AQEA 4KRMB 1IGFL 1DVFB 1DBKH 1MUJB 2VWEC 1PPIA 3NCMA 3A3YB 4K2UL 4FQHB 1FYHB 2CZNA 3Q3GA 4FQCL 4WKZA 5DC9B 3RIFK 1WZ1L 2WZ5A 3NCFB 4PRIB 5MERB 5A6LA 5CR1A 5K9JH 3ROLA 3OMIB 3SE3C 1LK3L 3NQKA 4L3ED 2DQJH 5EU4B 4RESB 3QZWB 4G8EB 3MNVB 3IDXL 3PGFH 3HZMA 1LWHA 1OARL 1IM3D 1K3IA 4IIZA 1ERNA 3PL6D 4G5ZH 4OQTL 4Z7VA 1TPXC 4NZUL 5KSAD 3BUDA 3KPPB 4I0PA 5F7HA 5HJ3A 3QZPA 4LKCB 4NQDB 4X4MA 4ALAC 4U1IA 2WLKA 4CGUB 5HGHB 4ICXA 1YEIH 1ZHLB 2APXA 3FKUS 4NKIH 2CMRH 2OMZB 4LRNH 3SE8H 1GKEA 5C0GA 2DI9A 4YGVA 5F7BA 2BY2A 4D9RD 1BZ9B 3NCBB 2G60L 3RGVB 2PTTA 2QVIA 2GHZA 1Y18B 1NZRA 4PJAE 4AM0Q 1E28A 4HFUH 4XMZA 3A24A 1QSED 1A4KA 5G5DB 1TJIH 4MXVF 5CJXA 4JFDB 1C5DA 4JDVB 3KNBB 5CEZD 4GKNB 2ROXA 1XVSA 1SXAA 2N0MA 4I18C 2DQEH 4EI5B 2LVEA 3QJZA 1G0YR 3UX9B 5AW9B 5FA3B 2X2HA 4V2CB 3ZT6A 4I2XA 1E67A 2R2HA 2V8LA 3D2UB 4MNQD 4AH2A 3D34A 1PY0A 2UVEA 4POUB 5GGSY 3LN4A 3LPOA 3T2QA 3MN8A 2BS8A 1RVFH 3LNDA 2E6QA 2ALWA 2VDMH 1FZJB 3EFDL 1SXNA 4M9PA 1NGXB 5JIHA 3L17A 3GUFA 4HFWA 5E8NA 1IJ9A 3RJQB 3FOLA 5EOCJ 2GTZA 3G6JE 4Q9RL 3QQ9D 4J8RA 3S8WA 2Y7NA 4HUCA 2EUXA 4JAMA 2FBRA 4XO3A 5D7JC 3TA3A 3RG1C 1NDGA 4K4KA 4RISH 3MV7B 1FFPB 4DKEL 3IJEB 1DJHA 4WSJA 1J87A 1AD0B 1OTUD 1JE6A 4DGUA 1BLNB 1E4JA 4UT9H 3S37X 4FMVA 3P69A 4X9HA 4ODWA 1WJ3A 2BNUB 2D7OA 1HILB 2CUHA 2EE2A 2VMFA 5EC2B 3O6ML 4P3CH 3NJLA 3ULAB 4IRJB 2BRRL 4TTDC 1EHAA 1RZFL 2IPTL 2WZPA 1XZ0A 4PG9A 1T5XB 4P2QD 4IBZA 5HHOD 4Y5YA 4FJZA 2NY6D 2G3MA 2OMYA 5TE4H 4DERA 1NCDH 3ZRCC 3DUHA 4GRLC 4KDWA 1FGVH 1HT6A 4MA3A 4L0ZA 3RY6A 4OLZL 2QSVA 2K7PA 1AG0A 3ECUA 1BD2A 4Z3TA 4WKZB 1U3HC 2HG5A 2Z93B 5DWUH 4AOFA 3PXJA 2W9DL 1AYRA 3BVDB 3IFNH 3MBWA 3O8XA 2WNKA 4FXKC 4GI8A 1UXSB 1HNGA 3HZMB 5HHMD 1ETB1 5TQ0H 1Z5HA 4IS6B 4LQFH 2N7BA 1RIUL 2OW7A 5D7LA 4CAGA 3EO0A 5KVMC 5GZOA 4UNTA 3FN9A 5IJVA 1RIHH 3GJFK 3ZW3A 3SDAC 5IHHA 3LPWA 3BDBA 4LVHC 1A6PA 5B8CC 4U1IB 1DVXA 5J3HD 1T89A 2K9FB 1NSNH 2XTJD 5CBEB 5DFVC 4MQXC 3OJDB 4S1RH 1LDPH 3ZKND 3DA0A 3U4BL 5C0GB 4FQQA 2VLMD 4YGVB 3I6GA 1QFPA 2PTTB 3MYJA 3NSJA 5EU6B 1DVFC 4J3TA 3FSZA 1E28B 3GBLA 3GNMH 4B6ZA 5GIRB 3NTCH 1MY5A 3QXWA 4RQQB 5I2IA 5BZWA 2ICWI 1F1AA 2A77L 2F53A 2X9WA 1C5DB 1E4HA 1N19A 2JB5H 4JKPH 4MJ4A 4U6HB 3AFLA 4NWTL 5I71B 1UT2A 3CDZA 4NXSA 1TTUA 2CDFB 2Y2WA 2DDQL 2X4NA 4RVBA 2PO6D 2VQ1A 4XGZA 2HKAA 2MCMA 3JWNE 4I2XB 3Q0HA 1GYAA 3R4DA 2H6UA 2R2HB 3M7OA 4DTGH 4M6ML 1T20B 1X4ZA 3FTYA 4GG6E 2CPUA 2BNRD 4GG8B 1BV8A 3DX6A 4PGBB 1T3FB 4H88H 2XV0A 2YXWA 3VQ2C 2C3VA 2NY2D 1TVHA 2JB6B 2XA8L 5ACZA 4WTXA 2XWCA 1WHPA 3QS2A 4HFWB 5IFHL 1BW8A 3QHFL 1R34A 2ZCHH 4DGVH 1TTRA 4AEHH 3QRFM 4PU2A 3L5WA 4JDTH 1AMXA 4HUNB 3UP1A 5I23A 3ROOB 1NDGB 1SY6A 3C6EA 1XIWB 3RGVC 4DQOL 1BVKA 3F83A 1HEJC 3DK0A 4D94A 3ENEA 2FUTA 4N2BA 1VRSA 1NLBH 4KKLD 4DAGL 5AEAA 1MFAL 5D2LF 4ZAKD 4OZHF 4ODWB 5CCHE 1RUPL 4RSYA 5GRYA 4EI5C 1BJ8A 3BVVA 2C1PA 3V4UL 3VVWA 4PQXA 1E3XA 3VW3H 4PG9B 3M1BB 5IBTH 2BP0A 4Y5YB 4KI1A 3LNFA 4UQ3B 4F9PC 3MV9A 1HWWA 2OMYB 2WWMC 4RH4A 3P11L 1BSIA 1WICA 4MA3B 3CDGB 2E7DA 3HFFA 3S34H 4F7TA 5J0BA 2GJ6D 3ZTNL 4UZGA 4B53A 4BWUA 3E7JA 5MEPB 2GAZA 4LAJH 2C3GA 5DJDA 2HG5B 1X5MA 3MRLA 4JPVH 3AITA 1PG7H 3MBWB 2P5EA 1PG7X 5K59E 4TLSA 1BWMA 5D9SA 1JZ8A 1BGXH 4N2OA 2R0WL 5DD1H 4IJ3B 3TZVC 1H9DA 4JHUA 4F93B 1FLTX 3C5ZC 3SQBA 1BFTA 5D7LB 3QPKA 1DBAH 3EO0B 3H3PH 2AJYH 4HK0B 3B9KA 3Q8EA 5AW4B 1V7NH 1YDPA 2F8VA 4E9QA 5D71L 4PJ7A 3DX3A 4F27A 3IJ8A 4ZFOL 2RFXA 3HPJB 4I77L 4BWWA 1AY1L 4N0CD 5AZ2L 3ZMRA 2A1WL 2ITCA 2Y4SA 3WO4C 3HC4H 5IY5B 3BAEH 2AV7B 3OSKA 2DQCL 2G2RA 4PRHE 3CZJA 4DPAX 3VMOA 2IV8A 2VDOL 3BKYH 3I6GB 3RNQB 4J3BA 5BVJA 1F2XK 2WTRA 5JHLH 4UMSA 3CFUA 3QNXA 4AK2A 2F53B 1OAJA 3RY5A 1JFHA 2P45B 3HI6H 1KCUL 3P9WB 4PG2A 2I9TB 4CJ1A 1HL9A 5JW4N 5IBLD 3O4LD 1QFUH 4UTAH 2VQ1B 4ZOBA 3B4NA 4E36A 4J3OH 1UM6L 1TQWA 2X6MA 4N0RA 3T3ME 3P77A 4U05A 4KX8A 5FYKD 3DX6B 4MJ2A 1DSWA 2WXRA 1U3JA 3WI9A 1YNTA 3U83A 1NCCL 4K94C 2DLTA 3ARPA 1EFXA 5KN5A 1UB6B 3D52A 2DM2A 3N40P 2MOQA 1R5WA 4NWUL 1MIMH 4LLWA 2VLJE 3II1A 5I1CH 5D2NB 1E4KA 3L5WB 2TSAA 4JFOB 4HLZH 3ZN6A 4XWGH 1EH9A 3N42F 1U8HA 5L2KE 1H3UA 5I16B 5E6YA 1B88A 5LBVA 1HKLL 4Q56A 5SWZA 1BVKB 1QACA 3QIBC 4XI5C 2IPKB 4ZYKB 5ABZA 2ISDA 3QZWG 3QDGA 1QRND 5FCUL 5T33H 3OC5A 1UM5H 1MCEA 2F61A 4RGNE 5HGAA 1J9QA 1ID5I 2C1PB 4QYAA 3GJEA 5J13B 3H3BC 5DRNB 1FN4B 5KS9A 3QIWB 2BP0B 3CSBA 1HI6A 3WFEH 2HAZA 3U36A 3TNMB 3NN8B 3MRBB 3V0IA 2M8XA 3AM8A 4F7TB 4UU9A 3V4VH 2FBJL 2OMVA 5FO7B 1KFAH 2GIXA 4QRRB 5AL8A 1G9NL 1IAOB 1T0PB 2GAZB 4BFJA 4IBWA 3HG5A 5DJDB 3MRLB 3U6RA 3EOTH 3THMH 3NJVA 4BZ1L 5ITBL 2P5EB 3F6LA 3HS0B 4TYUA 1XIWC 2BVYA 4NJ9H 4BRVA 4ZD3H 2VR4A 4M00A 3SQBB 1KLFA 4WCYL 1YEGH 3EH3B 4F2MB 3INUH 2XIIA 2ADIA 2EDMA 3PWPA 1P84K 3FAXA 1Z9MA 1KXHA 1YDPB 2XYCA 2ZUUA 4PJ7B 3U4EA 2A9MH 4JREB 1OP3K 3C5SB 3CQPA 3TT1L 2J6EL 1B4JH 1IC5L 5IW6B 1KJ2B 5LGHH 1MQKH 3QDJE 4OZFH 4Z7VF 2GUOA 1H3PL 2EE3A 4KO6A 5I30L 4UQ9A 2V9QA 1UZ6F 3O3BA 3VXRB 1Q94B 3O45A 1JGDA 2Y6SC 4F8OA 3SSGA 3NIDE 4TTGA 2WTRB 4OJYA 3HPLB 3FN0H 2HLAA 3FQRB 3OGCB 5EA0H 4LSUH 3S3DB 2V2WA 5IKCA 4G43A 5JYLA 1J5HA 2EUZA 1A6WH 4M5SA 2F54B 5A6IA 4JDEB 1RZ7L 4P3DB 2FK9A 4NIYE 1L4IA 4NQXA 3D0AA 4UQ2A 3IMSA 3E1ZA 4TLTA 3FYIB 3T9WA 5ALBH 5T3XD 4WK4B 3EDEA 2ORBL 4H8HA 2AHIA 3WMPA 3DX7A 5KZCD 1GL4B 1R5WB 2BM3A 2NTFB 2VW6A 4L23A 2KH2B 3I6KB 4M02A 4F7PA 1XSOA 5SX5H 4YGAB 4YSEA 5FYLE 3VSUA 5BV7C 1XAUA 3HFML 3K2UL 1T1ZA 3MI6A 2RQ8A 1I9RH 3MLUH 1T22A 1ZA6A 3N9GH 4P2AA 3BLBA 1UXMA 2KHAA 3LEYL 4KKRA 3UDWA 4R0LB 1CDUA 3LRKA 5HGAB 5B38B 1TO5A 2J43A 5TF1L 5K33A 4I7ZC 4WHTA 2I5YL 1ZTXH 3D30A 3KR3H 2WB7A 4KH9A 2Y5QA 4FA7B 4CMHC 5KYYA 4MD0B 2XZCH 4I3SH 3WUZA 3O4OC 4LOFA 3U36B 3LHPH 4KVCH 1PKQB 2ESVB 4PYGA 4Z9KB 3IN0A 1IGFH 5J1TC 4K3HA 5E2JA 1MCKA 3OPZL 4HCFA 2CJSA 3LXAA 5T1LD 5D1QA 3HG1D 1SFHA 2GY5A 4QHNB 5DEFB 1CQKA 4H20L 4EN3D 4FQCH 1O6SA 3GJFB 3GKWL 4ZDHB 4CNIA 2NY3C 1YEKH 5I8CA 1R75A 3JT2A 3MLXH 1J8HD 1E9PA 2ZKMX 1HNFA 1CI3M 4NM4L 4KUCD 3DARA 5E5UB 1HH9B 2PWFA 5HGBA 4MDJB 4R8WL 1DSFH 1Y6MR 5FUZL 4ZFQA 3BGAA 2RMNA 2ADIB 2VXVH 2DWSA 2VKWA 4UM8A 1C16B 1FC2D 2BFVH 2ZJSL 5B1AB 4Y5XA 3EF4A 1B0IA 2DYSB 4NZUH 3IWUA 4Z0XB 4LPTA 4YAQA 3HVDA 1OM9A 5J13C 4NNXB 1MAML 4HJ0D 3IDNB 4UT7H 1KMGA 1RZQA 3QIWC 1E42A 5ABDE 1YY9C 4RWYH 3FU6A 4YBQD 1S78C 1AGBA 4UQBA 4KXAA 3CD4A 2ZX5A 3O3BB 3O45B 3ZDYE 3GMMA 4KI5F 1JGDB 1JTOA 2PYFB 4ZT1A 3IAPA 4P46C 2Z1KA 2PYED 3GHPA 1XMWA 1NCOA 4OJAA 3N41F 3RDTB 4BXSV 3QI9A 2M26A 3HS0C 3DMMD 4JR9H 1XF1A 3ZDXF 2DH2A 1VPOH 3MPCA 2B1HL 2CIIA 2MQGA 4CBZA 2E75C 4HH9B 3TBYA 4NQXB 2ZXDA 1Z9LA 4FZEL 3NP3A 4F7MA 2WBXA 1P1ZB 4UQ2B 4FQLL 4MB5A 4Q0XH 2B2XL 2AQTA 1BQLL 2MQ3A 2VN3A 2QGEA 4RRPA 5C0BD 2OULB 2WWOA 3VWKD 5CCKH 2VC2H 3DX7B 1T7XA 4TSAL 1ZSDB 3T65A 3FXIC 5LGYA 3DX8B 5IF0A 5IZ7A 1R17A 1MG2C 5D1XA 1I3UA 4EDWH 1NUGA 2ZXGA 3K2IA 1WS7A 3ZUCA 3CVIH 2Q7AA 1WLHA 2GT9A 2NW2A 2G9HB 3LS4H 3RNKA 3W37A 3B6SA 2J73A 1KSRA 4D9RE 3QJQB 2KC0A 2CGZA 5I0XA 2AEPL 2VITA 1T22B 1QSEE 1ZA6B 3O6FB 4M61A 1BFOA 4NZDA 1ZA3A 3MX0A 4JFWA 5D7HA 3TBSB 1B0RB 5CEZE 1FFOB 2BC4B 3D39D 1AR1B 2CJTA 5E5RB 2E27L 2DLHA 3C2SA 1F4AA 1UWXK 2RH0A 3U2SA 4NBZB 3O6MH 5C6TL 5KYYB 3V2AR 2SEBA 5E23A 3UBXI 1DSYA 3D33A 3ESUF 1JERA 2IPTH 2Z31D 4F58L 3ULUD 1J86A 1MCRA 4AXWA 4LSPH 4YK4B 2VRKA 3KH3A 1J12A 4GQ9L 3LYRA 3GZQA 4NKMA 4V2BA 1OP9A 4A2EA 3AQXA 4DN4L 3DIFA 4DP0X 4BHUA 5F7LB 2YQGA 3BQVA 1PJ9A 1O6SB 3OB0K 1LWRA 3EDFA 4YE0A 4PS8A 1L9NA 2W9DH 3BH4A 5FO2A 2A4CA 2XI9A 4FI6A 4G7QB 3LCYA 5KAQG 3N85H 4NZTL 1JXGA 4GQQA 2W95A 3E0GA 4GXVL 4PJBA 5AG9A 1ZS2A 3TBCA 2SODB 5AAWC 3UIYA 1MCPL 4KVNH 4OCRL 4Y5XB 5AW5B 4R0LC 4K9JA 3CDFA 1MVUA 2AJXH 3WEXA 1CFNA 3IPFA 3G3LA 2EECA 1G1CA 4I1NB 4N9OB 4RAVA 4IMKA 4N8PA 4P2QE 5HHOE 4X8XA 4XPGL 4TNWK 3BUYA 3TO2A 2O1AA 1E5ZA 1MI5A 5GRUL 1INQB 1SBBA 4LMQI 4YUEL 4ZQKB 3M07A 1NWOA 2EAEA 3UZQA 2A74A 3AY4A 1NMBL 5BRPA 1W15A 2GJJA 1JTTA 4C57C 3MFGB 2BPBA 3HLAB 2WXNA 1VENA 1WFJA 3HE6A 2A77H 1IT9H 1KPRA 2APWA 2HX8A 3HBPA 4Q4IA 3JXAA 3QWQB 2X9ZA 3HTLX 4FCAA 3AGWA 3BEWB 2CLRA 3I50H 2CIIB 1J48A 2QADD 5HHME 5IB3B 3GIVA 4ZXBB 4L5FL 5F7EL 5DK2B 4ZQTA 5IVXA 1D7DA 4YBLB 5IHWA 3FT9A 2WWNA 3TYGH 1BCIA 2CJUH 2AJVL 1FNSH 2EYRA 3N1QC 4FQ2L 3FU5A 3MRPB 1IAIH 2YGNA 3CC5B 3CLFL 1L3WA 4LBAA 1CZ8L 5JXED 1KBVA 3S3SA 1E27B 4K8RD 5D5MA 4YX2H 1UA6L 4MX7B 4XMLL 4YSAA 1YNTF 2NYZA 1I3GL 2GT9B 2B9BA 3TCLA 5A6MA 2OJEA 2HT4D 2VLME 3B6SB 1I7ZA 4B5EA 4HEME 1BBJB 4M1GH 5SX4H 5DDHB 3GPSA 4UANA 4BKLA 5JYMA 1NGYB 2LU4A 3IBOA 3QUXD 5IMMA 3IFLL 2MPVA 2JKTM 3SE4C 4EKJA 2AK4B 1BFOB 4WFED 3MA9H 3QYCA 2E9IA 3GSNB 5E6ID 4CJ0A 3RDTC 2NXYD 4RGOH 3X1EA 1C5BH 3Q06A 4PJEB 4QWWD 1F4XL 1FFQA 1FNGB 5DEGB 3U2SB 2EE9A 1K5NB 2XPZA 4FQJL 4G3YL 4N90D 5HHXH 1KV7A 3PJSA 1L9MA 3OLGA 3TH2T 2BNRE 3IJ7A 1B0WA 1DQMH 3MJ9A 3IDGA 2HRHA 2GSGA 3TJEH 5DHDA 1CGUA 4OFVA 5DI8B 3ETTA 3ARQA 5A2FA 1H8NA 4U1KA 4Z3EA 5KS9F 2YSTA 5G4OA 3TEWA 3KLAB 1YUKB 4W9JC 4JUTA 5CJBA 2EVJA 3P4NA 5C0CA 1I85A 3BWSA 5HYSB 1ND0A 4G6AC 1HAUA 2HX9A 3WD5L 3DX9B 3NSFA 3SIKA 1VFBB 4LBEB 3ALPA 3ETBJ 3O6FC 3S36L 3QRBA 4FQIH 1BMWA 4LCIL 2V37A 3FHQA 4FFWC 1KN4H 2IAMB 1H5BA 1XTMA 4QHLB 3GHBH 4AMXA 1CBVL 4IRZL 4PIRF 1T0MA 2R29H 4RAVB 4PMEA 5BXFA 3G08B 3ZE0E 5HYEA 4ZSOB 2X6AA 5TQ2H 3EZ8A 2FAUA 4R4BA 1A14H 2R4RL 2LAAA 4YDIH 3BH9B 4NQCA 5TPWL 1MRDH 3L3OB 3UZVB 1EHKB 3UAEA 4EUPA 2VDOH 4FFZH 1SUJA 4Y9FA 3UZQB 1JPGB 2GJ6E 3FUIA 1Z9NA 3U79A 2XZAL 3RVUD 3ZDWA 1UVQA 2ZUTA 4APQA 3WFDL 2H2SD 1FIGL 1G9ML 3VI4A 1WFNA 5F3HA 1RZJC 5B38G 2YN5A 1EERB 2VRQA 2AXFA 1TEFA 2WBJD 3FN3A 1N26A 1WEJH 4HS8H 1UM6H 2NYYD 1L7TH 1DE4B 4LSQL 3SPGA 2J8UE 3I75A 3JWDC 5JIMA 3OZ9H 4PJAA 1ACZA 1PZ2A 4GAGH 3N1GC 2L7JA 3QHZL 1BYNA 1CFBA 3NIFF 4L1DA 5IR1A 1TJXA 1SXZA 2D2OA 3TURA 2FHFA 4NB7A 3ZVVA 3RFZC 1OTTC 1I7UA 1JXKA 3PV7A 3PS6A 3C6LA 1I7ZB 2P5WD 3O3DB 4TPRH 4LB8A 4OT1L 2XC8A 1AI1H 2UXTA 4GINA 4Y1AD 2X9YA 5IMMB 1KGWA 4QKXB 4UQDA 3LZLA 3CHXA 2DWEA 3VFOA 3FBQA 4OTXH 4KKAD 1PG7W 3KAAA 1KXVC 4Y16A 1FYTB 3U0WL 3QBTB 1HHGB 2YAOA 4U1GB 1LP9E 4NQEB 3HAEH 2BVQA 1N3NB 2IXQA 3MA7A 2VIRB 3QEUA 2IBBA 4Y2NA 3I9AA 4G6KL 1I1YB 3JZ7A 4ZXBC 3BEVB 3M8OH 1AKJB 4PRBA 5FYKE 3OKKA 4HXBH 1T6VN 3IDGB 4YBLC 5LNGA 2IAND 4P5TB 2HZHA 5FYKU 4W93A 3SKNA 3MRKB 2JK5B 3W1ZA 2V7NA 2AQ3A 2G3NA 4PJGE 4Q6IA 3B5TA 4EBQH 3DDGA 3IGUA 2AEWA 1NGWB 1D2PA 5FKPA 1SOKA 3GFUA 4PGJA 1AOZA 2UZPA 2PLTA 3EGSB 4PJXE 3P4NB 5CUSH 5C0CB 5IUCA 4HCIA 4HAFA 5BJTA 1UOVA 3BKML 1ND0B 1QRNE 2ZOKB 3L9RB 1FE8H 5E2UL 4KJWC 4JFYA 3QO1B 4WCYH 2H1LM 3TP4A 2P28B 2AMUA 4GYBA 4XNBA 5IESH 5F9OL 3OAUL 1H5BB 2Z7WA 1ECYA 4HOWA 3NRFA 3QYNA 4NRYA 3WTWA 1J8KA 4NO5A 3RZCB 2ENJA 3IKCA 3WTVA 4WEBH 1E30A 1I7TB 1E5CA 5IQ9A 2GTQA 3FTWA 4R4BB 3V55A 2DM3A 1MFEH 2HA1A 1H3PH 2VL5A 2ICEC 5GQBA 2D31A 1UH2A 1M71B 1QLEB 1TQSA 2QSCL 4FFVD 4ILDA 1SN5A 1K8IA 2FSEA 3KLQA 3FCBA 1UVQB 5E8EA 1OANA 4APQB 3VD1A 3HJ0A 3HMXA 1Y0LA 3MLVL 3NK4A 1H8LA 3P9LB 4W6WB 3GLEA 5F3HB 4E41D 5HDBE 1KCVH 3SDXB 1DBBH 3KW7A 1E8YA 5AB9A 1RK0A 3NRQA 1DUZA 4NX0A 3RWDB 5I1IH 5IV2B 4NN5B 3LY6A 3VFRA 2MQCA 4P4RB 2UV3A 4A7UA 1IAIM 2IAMC 3FNKA 3GTVA 3T3PE 2A73A 1QFWI 3B9EA 2ORBH 4M93C 3UG5A 2C9AA 3O11A 2PW1B 2XQYK 4DUWA 2PR4L 4P5SA 3VXTA 4ZUVA 1OZTG 3ZLQC 5LGKA 3VA2C 4Z76A 3IDJB 2A0LC 2NLJA 3GSVA 5F7UA 3MRDA 3L3OC 4X6FA 3K80A 3DVGA 3K2UH 4P2YA 2VJ0A 4YEEA 1JI1A 1BECA 1CLOH 4JZJC 2D4DA 4M7JL 4G6FD 1PTZA 2AZUA 4FP8L 4MAYA 5KVEE 4Y16B 3N44F 3C9NB 4KJYB 5KYWA 2A6DB 5B1CA 4JO5A 2Y7QA 2ADFL 2IXQB 3MA7B 1NTDA 3G6JB 1FC1A 2G4GA 4YDKH 3PDOA 9PCYA 5CFHA 2X1XR 1JHLL 4PRBB 2J2ZA 3FUDA 2Z3FA 4LOUD 4ACPA 4JY5L 3UPRA 4WI9A 4Y2DC 4AM0A 4YO0A 4D0DA 2CH8A 5T3XE 4M5YL 1S5IL 1Z9SB 3FQWA 2UX6A 3WEOA 1J5OH 4M1CC 4WAFA 5HHPA 5KW9H 4EOWH 2YPKA 5E4IA 3TPUB 3B1UA 2COVD 1F13A 1XB3A 5EZIL 4DQAA 3U9PL 2EKJA 3LZOA 3AXIA 1FVEA 2WINA 3GKWH 3WNNA 2A7BA 4AGLA 3U0PA 1KB5A 2Z64C 1R5IA 5CZVL 2HT2C 2MKWA 5F71A 3WIHH 5FS5A 4ZNEE 3CUPA 3IM1A 4H40A 2HTKD 2Q5BA 4JFYB 2CUAA 4WY7H 1I1AA 5DLMH 4BELD 4KITB 3I85A 5AVQB 5L88L 4K3DH 4U1GC 4LLVA 5LB1A 5KVFL 4M56A 1SHXA 5GISL 1QNIA 3TCXA 2E46A 4CUCA 3L3IA 1U2CA 4HPYH 4NO5B 5AVZB 5GS1A 3ZKMD 4Z7WB 5E08L 4PJBF 3UH8A 2EIMB 1I1CA 3LS5L 2OJZL 3EYQC 1T80A 1WWCA 5IQ9B 4YVUA 1HC1A 3ZDZF 3N3EA 2WUBL 5IMOA 2OPCA 1NGPL 2FX9H 4P5TC 4M43L 2VL5B 2XDHA 3QUZA 3Q6FA 2EDLA 3HHRB 3GB7A 3SBRA 4HU2A 4J23A 1TUPA 4RA3A 5EBLA 4GKLA 4WVRA 3HG1E 2X09A 2UUDK 2FSEB 4XC3H 1PLGL 1FWXA 1G5AA 5E8EB 2EC9U 2GCYB 1MFCL 3ZU8A 1Y0LB 3BAXA 3O3EB 1J8HE 2WKGA 3SY6A 3ZO9A 4GEJA 5CZKA 2P52A 4JFQA 4WUUB 4XVJH 5I1LA 1KDJA 1MLCA 1RK0B 3DRTA 2DBLH 4FFYA 1NA8A 4KRPD 5IEHA 5KJRH 4PRHA 2VYRE 1NC4A 5ADPL 4D0BA 2OR9H 4TSBL 2OTWA 1I9JH 2KLTA 2H45A 4HLJA 3O2VL 5DJCA 3QZNA 3R1GH 1BAGA 3ETSA 2X1WL 5IVXF 3RZCC 2WIMA 1SQ2N 5EU5A 4LARH 1FHGA 1OAKH 5DK0B 4ZUVB 3VXTB 2NLJB 3GSVB 5G2NA 3ASOB 3BX7C 4X6FB 1CE6B 2V7HB 4B96A 4GG6B 1O75A 3DVGB 2N01B 3PHOB 4ZW3A 3KYNA 4KKBC 4NO3A 5HYSG 3WMQA 1M4KA 2PYEE 3AROA 2VQTA 3QFDA 5EV7A 1OM3H 1IO4C 4R26H 4DP7X 3L5HA 4Z0BL 2IQ9H 2VLJA 5TE6L 1CK0H 2BVOB 1DFBH 4I4WA 4WTWA 3LIUA 1VZHA 2JKIS 1JP5A 2O5YH 4PTTA 2J2ZB 1DR9A 3OWRA 5L2KA 3UPRB 4GW1A 2P49B 1KG0A 3VXOA 4H0IA 1IB5A 2L0DA 2WCGA 4JFPA 4D0DB 3NSCA 1NCNA 5C0BE 3ZHFA 3AB0B 3FQWB 5HHPB 1AFVL 5HDQL 4DSYA 2VABB 2YPKB 4U1HB 1IL1A 7PAZA 3QCTH 1TJMA 3GSQB 4KK8D 1QWUA 4BGLA 4XVSL 3JUYA 2WINB 1K4CB 4E9SA 5L2JB 1G94A 4LCVA 1R5IB 3IFPB 2NDFA 1NCUA 2BVTA 3CQQA 3HG4A 1I1RA 2VDKB 5FPIA 4Y19D 1V8HA 1BZDA 3GXUB 1EHLH 1X9QA 4N3TA 2VW7A 4OFDA 1VKXB 1R5VA 5ADOL 1XGZA 2C9UA 2VZ3A 3EFOA 3FUNA 1M7IA 3L3KB 5E1AA 5JIKA 2Q86B 3Q1SL 4XBPA 3D39E 5F72S 4AL8H 4A2MA 5C0EA 2W92A 3TCTA 1MNNA 2I85A 4MCZA 4GFTB 4DO5A 1P2CB 1BM3H 5HI4D 2GQHA 2WW8A 4OD3L 1HESA 1LMKA 1NAMB 1JK8A 3BD5A 3IJSA 4G6JH 4G7YL 4PJFF 5I1KH 2YD2A 3VGHA 2CHDA 5IMOB 3ULUE 1X4XA 1IBZA 3U7YH 5GRUH 3VI3E 3I74A 3Q6FB 2MMXA 4A7TA 3GB7B 1G6RA 5AVTB 3P4MA 4JGNA 3H6AA 4BK8A 5EBLB 2ZYSA 2E86A 3AG1B 3IMRA 1QFOA 1ECZA 1N67A 2PN5A 3EFFA 5HJGA 4AQZA 5KSVA 3QUML 3K0YA 1JI2A 3T2LA 3V8OA 4HOXA 2MCPL 1DLHA 4LO9A 1P53A 1AE6H 2CXKA 3MODH 4F3FB 1HXKA 1WAEA 1MLCB 3MU3A 4XAKD 3STLA 3AUWB 5IEHB 2VL4A 2BSRB 4L5FH 1NC4B 3P0YL 5AQ0A 4D0BB 5B3JF 4JPIA 3V0VB 1JXFA 1RUQH 5D4JA 5K39A 3TO4D 3ARWA 3B9AA 3Q5TA 1OF2A 2A9NH 1P7KB 3VACA 3VI4F 1ZK9A 1CD1A 3UAAA 4JKNA 4O58H 4N68A 5I75B 3CLFH 4ADJA 4ODBD 4HJJL 4QPEA 1NGQL 4WEMB 2ZYRA 5E6RB 5EU5B 1SOSA 4OGQC 4LFHD 2FJGA 3DURA 5DVNA 2VAAA 3WFHB 4PJAF 4W6YB 3CMGA 3IYLW 5CCJA 2PP9A 2DM7A 2N1TE 5C3LD 1G0DA 3GXDA 3MRNB 1X5FA 5D4QA 3BAJA 3PV6B 1RPQA 3QJFA 4NO3B 3QW9A 3IFLH 4WW2B 3V5HA 2WO4A 3P30L 2ATPA 2GSMB 3QFDB 4KTGA 2YLHA 3MGTB 2VXQA 1OCWH 1VHPA 4PB9L 4PJCE 2Y5EA 3JZYA 3DIVA 4GT0A 2ARJB 4F8TA 2VLJB 3JV0A 2Z8SA 4HS3B 1OGAD 2CHZA 4I4WB 1F58L 3TPKA 3PCYA 4CN4A 3MJ9L 1SPDA 4I48A 4PTTB 1FZMB