2FJSA

Crystal structure of anaerobically reduced wild type nitrite reductase from a. faecalis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Effect of the methionine ligand on the reorganization energy of the type-1 copper site of nitrite reductase.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 88
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2006-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fjsA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fjsA02
3FQYA 3FPYA 2PPDA 4W1TA 5I26A 1GW0A 1PZCA 1PMYA 1ADWA 3NJNA 2R7EB 2J5WA 1MG3C 3AZUA 5B1BB 1DZ0A 3EH4B 2BO0A 4DP6X 4BWWA 2VW4A 1GS6X 1BEXA 3KW8A 1ILUA 3UADA 4GY4A 5IY5B 1AS6A 1A65A 4YSRA 1OCZB 1FA4A 4YVUA 3UAAA 4YSPA 1E65A 3OD3A 5A7EA 5TK4A 1OE2A 1W6WA 2I7OA 1IUZA 1OCCB 3ZDWA 2I85A 1IBZA 3AG1B 4TXVB 3N2JA 3FPXA 4E9SA 1TKWA 1PZAA 3UGEA 3H4HA 3JTBA 4E9QA 4KOBA 5I6OA 3WIAA 2XX0A 4BWTA 1BYOA 3FU9A 1X9UA 2DWSA 4WTQA 1V10A 3X1NA 1JZEA 2WO2B 3V9CA 4Q8BA 3DKHA 2BP0B 1E5YA 3TASA 1CUOA 2XV2A 2UXFA 3CDZB 2XLLA 3T9WA 1GY2A 2FQGA 4BK5C 3G5WA 1JZGA 1NIBA 2FTAA 3WNIA 1NPNA 1TEFA 2WO3B 4L0PB 3S8FB 2VSKB 1FWXA 4PCYA 2YXVA 2QPDB 2PCFA 3S3DB 4FAAB 1PLBA 2XWZA 3WG7B 4JHUA 3IBOA 3SBPA 1AACA 3BQVA 3ABGA 3NSYA 2YQBA 2XUWA 5E9NA 2PPFA 4P5SA 3KW7A 2ZOOA 1A4BA 2JKWA 1ASPA 6PAZA 1CC3A 4YSTA 2EIMB 2HX7A 1WA1X 3EF4A 4DP9X 3ZIYA 1NIEA 2GC4C 2YAMA 1AS8A 5B1JC 3V9EA 5I6LA 3X2QB 2VM4A 4M4RB 4AX3A 4HHGA 5F7BA 2HX9A 1XMEB 3FQ1A 3CVDA 1E30A 2HRHA 3FU7B 3ASNB 2DWTA 2VMJA 1KCWA 3SQRA 4G7SB 5FC9A 4E9RA 1PF3A 1KDIA 1L9TA 4ENZA 1JXGA 2UX7A 2BP8A 4P5RA 2BWDA 1GSKA 2FJSA 3ZX1A 3FSVA 1N68A 1L9QA 2ZONA 3T6ZA 3TBBA 1CYXA 1XB6A 1PLAA 2CBPA 1EHKB 3MBWB 2YAFA 4G70B 3AG3B 1BQKA 3AW5A 3OM3B 1SHXA 4DP0X 1J9RA 4ZK8A 5B1KA 2BW4A 1OE3A 1RCYA 3AY2A 2HX8A 2J57A 1SDDA 2YXWA 2AANA 2A3TA 4YSDA 3NP3A 1ET5A 4E9XA 4A2GA 1KYAA 3S8GB 1A4CA 3WNJA 5AFAA 1ZDQA 3FQ2A 3UABA 2GBAA 4NAJA 4DP7X 2J55A 4KNSA 2HRGA 4YSAA 5B1JA 2IWFA 2QT6A 1KDJA 3PXLA 3NJGA 9PCYA 4N4YB 1FFTB 1XB8A 1SFDA 4GXFA 1KBVA 4FA7B 1TEGA 1HFUA 3T71A 3NYKA 2J56A 4HHWA 5B7EA 4AKOA 2B3IA 2PPAA 3PAZA 4AKPA 3NJKA 4DPAX 2UX6A 3PLYA 4DP8X 2IDFA 2PPEA 2IWKA 3CVBA 2XU9A 5B7FA 1BQRA 2EILB 4BDVB 3N55A 1JVOA 1L9RA 1ZIAA 4K9JA 2GI0A 1KBWA 3TU6A 4N8UA 5PAZA 3QJVB 2IH9A 3H4FA 4UF7C 1ASQA 2EIKB 3FU8A 3PAVA 4DP5X 3QJSB 4KO7A 4AKQA 3IEAA 1E67A 1ETJA 3HB3B 2Q9OA 3AG4B 3NSDA 4AZUA 1RKRA 2QDVA 2BW5A 3JT2A 1IBYA 2FT8A 1PZBA 3QJUB 2I7SA 3TBCA 2GHZA 2X87A 3FS9A 1B3IA 3EHBB 4X4KA 1AR1B 2YAEA 3OMAB 4WKXA 1AAJA 2FWLB 1SDDB 2AZUA 1GS7A 1AZCA 5I6PA 4E9VA 3ERXA 2N0MA 4DP4X 2BWIA 2DYSB 4CSPA 3T6WA 1GY1A 2AFNA 3FYIB 4KOCA 1BXUA 1ID2A 1OF0A 2CALA 2EIJB 2BHFA 2Y69B 5I5JA 1SF5A 2YAOA 3GYRA 2W88A 4A2EA 1AOZA 1SF3A 3IN2A 2H47C 4CSZA 2AZAA 2MTAA 2IDTA 4GYBA 1J9SA 1JZFA 3NJMA 2MRYA 5D4JA 1PCSA 1DYZA 1SJMA 3RYMA 4KO9A 1JZJA 2CAKA 3UACA 1XB3A 2IH8A 4UANA 3U25A 7PAZA 2UXTA 4YVNA 2W8CA 4A2DA 1KGYE 4KNUA 5D4IA 2QPEB 1E5ZA 3QJQB 1AG0A 1AZBA 2P80A 1SHWA 1NICA 4E9WA 2IDSA 4MFHA 4YSSA 2GC7C 5I5MA 2R7EA 2BZ7A 4DPCX 1J9QA 3ABLB 2VW6A 5I6MA 3NJHA 3NT0A 4G72B 1M56B 1JVLA 2FQFA 5EHFA 1PLCA 1BXAA 2XV0A 1AANA 3ABMB 3HEIB 4HAKA 3T6VA 1CURA 1J5CA 1VLXA 1IKOP 1AZUA 3OMIB 5AKRA 2Q5BA 1JXFA 2YAQA 1L9SA 1JXDA 2EINB 2ZXWB 2DYRB 1W8EA 1PY0A 1W6LA 2YARA 3GDCA 3PCYA 4HZ1A 1V54B 1BQ5A 1NDTA 1OV8A 1NWOA 2GSMB 1SFHA 2GB2A 4Q89A 2TSAA 1WA0X 2HLEB 5PCYA 3FYEB 1WS7A 2XVBA 2XX1A 2YAHA 2DV6A 3FSWA 2XXFA 3PPSA 3QJTB 1AG6A 1NWPA 4GP4B 4BXVA 1QHQA 2OV0A 1OE1A 1PAZA 3BVDB 1AIZA 3TA4D 7PCYA 4G7RB 2AVFA 1OCOB 2BP0A 3OQRA 4A2FA 3UAEA 4JHVA 3IN0A 4A2HA 4F2EA 1JZIA 4DPBX 1BAWA 1NTDA 4A68A 1MG2C 1TU2A 3MX0B 2B08A 4JKNA 3NSFA 2IDQA 1N70A 3H56A 3WKQA 3NSCA 1WS8A 2PP9A 3WI9A 1GS8A 1QNIA 3NP4A 1RZPA 1AQ8A 1NPJA 2BP8B 5I5IA 1J9TA 3CZUB 2CJ3A 4YL4A 3S3CB 3ZBMA 3NJJA 4YSEA 2CUAA 1JOIA 3IE9A 2WSDA 3PAUA 2XXGA 1M9WA 1QLEB 4KO5A 2UXGA 5I28A 2FQDA 5ANHA 3FU7A 4W9ZA 4KNTA 1URIA 1JZHA 3QPKA 1A3ZA 1T5KA 5I6KA 2PP8A 1AZNA 1ZDSA 4AI7A 3NJIA 1L9PA 1NIAA 2VW7A 3X1FA 1R1CA 3ASOB 4F2FA 6PCYA 1ILSA 1BYPA 2FQEA 2XV3A 3X1GA 3AG2B 1HAUA 2H3XC 2JXMA 3WKPA 2FT6A 1KCBA 3GXUB 2HZHA 3NJFA 5D4HA 2FNWA 1ET8A 2DY2A 3ABKB 3FSZA 2OJ1A 3SBRA 1ZIBA 5AZUA 1EZLA 4YSQA 3DIVA 2VSMB 1ASOA 1ET7A 4YSCA 2X88A 2PCYA 2GIMA 4YSOA 2PLTA 1V55B 3CG8A 2XYBA 4E9TA 1NZRA 2VN3A 4NERA 3NJLA 4A67A 1OCRB 4HALA 4NB7A 2IDUA 1F56A 4DP1X 2PP7A 3EH5B 3FSAA 1AS7A 1X9RA 2CCWA 1L9OA 2VM3A 2BZCA 5I6NA 1OOWA 1MZYA 1J5DA 4EF3A 1BXVA 1CYWA 2PPCA 1MDAA 4HCIA 1YLBB 4HCGA 4PAZA 4BXSV 1ZV2A 4RH4A 4DP2X 2HXAA 1NINA 1KV7A 2FT7A 2LLNA 5B3SB 3EH3B 4QLWA 1IC0A 5F7AA 2E86A 4A66A 4UAHA 1ZPUA 1MZZA 2QDWA 1PNCA 1WAEA 5B7MA 4BDVA 1WA2X 2UXVA 2OCCB 2Y1AA 5B1AB 3CVCA 3X1EA 3D12B 3QQXA 3X1BA 5TK2A 3QJRB 2IWEA 8PAZA 2ZWNA 2H5UA 4G71B 4KO6A 1AZRA 3FT0A 3OMNB 1GYCA 1I53A 3SBQA 3C75A 4F7KA 1RZQA 4HCFA 4BWUA 1HAWA 1JERA 1PNDA 5LDUA 1M57B 1SNRA 4M3HA 3S3BB 1UATA 4GP5B 2JFCA 4G7QB 3CDZA 3T6XA 2NRDA 1A4AA 4YSUA 4QKTA 2RACA 3DTUB 2YAPA 4HIPA 2P80D 2TSBA 1NIFA 4GP8B 1A8ZA 1GR7A 3L45A 1NIDA 4E9YA 2IAAC
chains in the Genus database with same CATH superfamily
4O2FB 4HEME 2V7NB 1BX2B 2CDEA 1BVNP 3C2SA 4NSKB 4HXAH 4DZBA 4OZIB 2LE9A 5I1GL 3UJIL 5ALBL 3LS5H 3NH7H 4P57A 3U4KA 5E8PB 1P5VA 5B1BB 4X50A 3FN0L 1ACCA 4OLYH 5IHUL 5EBMA 5B1CA 5I0WA 1BDYA 2R4SH 3WKML 2IPUG 3INUL 4NJ9H 1L7IH 5IEKA 2BY2A 1MLBA 5D7EA 4U1HA 2UZYA 3V0VB 4Y4KB 4X6CF 4ZMAT 2V9UA 2VDMH 4K94L 1R4XA 4JFED 2J72A 1DJXA 2X4SB 3EFOB 3R06B 3NIGF 3Q1SL 1I1CA 3WGVB 1EVUA 1W6WA 1R5VA 3RPKA 4K7PY 1IBZA 3FQTB 4HV8A 2GEQA 2ZPKL 2FNBA 5J9PA 5DJYA 2YPKB 3VI3E 2XN0A 1BF5A 4J3XA 4RWYL 4YHYB 1J1XL 1CFVL 1XGYH 1CGXA 5IVXA 4CU6A 2D03H 1MW3A 4WENB 4P46B 1T83A 2AJXH 2B1AH 1QNZH 4UQDA 5T1KD 3GMPB 5KTEH 1CG9B 2GITA 4N3TA 4N90D 1Z9SB 2XQYA 2XV2A 2XWBB 2R69A 2FLMA 3V5DB 1F11A 5EA0H 2V4LA 1FNHA 1K5NA 2DQCH 1CFSA 3RTLA 4QGYA 1MI5E 1QRNB 3VXRD 5CFHA 1E27A 2AVGA 4FHKA 5JUEL 2VN5A 4N8VG 4FXGA 4PWGA 1GGBH 4Y19B 5EO0B 3CC5A 3A24A 2L4OA 1ZE3C 1KXTA 2ADJB 4N20A 2KPNA 5SWZA 4XCCL 1QBBA 2XN1A 3ULVF 3GS4A 2MQCA 4YFDB 5I9QC 5DD0L 3QH3B 5DJAA 4CUCA 3NIFE 3CVIL 3ZQ9A 4F7CA 2CJSA 1RIHL 3IRZA 3PV7A 4C57C 4CVWA 3ZIYA 3MCLL 4ZXBA 1JWUB 5C70A 3V9EA 3TYGH 4D0CB 2VDOH 1AYRA 3GMLB 4I3GA 5E5RB 4R7XA 3GKWH 1IL1A 4ODUA 4KK9D 1T3FB 2GFBB 1A7RH 2ZCKL 1ZVYA 1MRDL 1A1NB 3ARDA 3H9HA 3CVDA 4L8BA 4YHKL 5AKSA 3ZE2B 1KENL 2PWHA 3MRDB 1H3GA 2Z8WC 3PL6C 4NLAA 3RTQD 1SDAB 2A6IB 1BJ1J 3RX8A 4BCYA 5TDNB 5TQ0L 2R1YA 1GTFA 1J12A 4J3OD 4AGLA 2UX7A 4I1NB 1TG8A 1RZ8A 1Q0YH 5DEGB 4RSYA 3VD1A 3IXTB 2UWEE 1JHKL 3OB8A 2PF6A 2IXQB 1Q9KA 3ARWA 3O3AA 1OLZA 4ZW5A 4LMQE 4HG4J 1ZA3B 3OKYA 3HZKB 3ZKSD 5DJ8B 3MJ7A 5FK9A 3AGWA 3BUQA 1HXYA 3UZEA 3K5SA 5I1CH 4F91B 2ZAGA 3FUKA 3IKKA 5CWSB 5D1ZD 1XR8B 3HUJE 1DJWA 3AXLB 5C0GA 3VG9C 4GG6F 3LN4A 1IFHL 1RP9A 1C08A 2VDRL 4N1HB 1PU0A 3ZO0A 1NCAL 2A83A 1QASA 3EYSH 3QDJB 3LXUX 1J48A 1AGFB 4WFGE 5T1LA 4QAWA 4FTVA 1SFDA 1KCUH 4JFXA 1IAIL 2EC9T 1W72A 1WZMA 3QO0B 4HKXA 5EEUA 3CJJA 1EEZA 1ZVSB 3TO2B 5EIIB 5AZ2L 5IFAL 4KZDL 2BRRL 3VI4B 1IEAA 3CFUA 4K5OA 2ZJSL 3PLYA 3ZE1F 1XTMA 2IDFA 4PJ9D 1OEZW 1LO5A 3KDMA 1VERA 3V95A 1YEGL 3VFGH 2XZCH 4A6YH 4HPHA 3A0OA 3GSNL 1GGIL 5DYOB 4L9LC 3LZFH 4DO4A 1DBML 3TU6A 3ATDA 2OX5B 4HX1A 4FQ1H 2WTPA 3QS2A 5TDOB 4YHIA 2XFGB 5CXPA 3RKDD 2A1WH 4BA8A 5L88L 2APSA 2JKLA 2QPSA 2PW2A 4Y7OC 3D3VE 1TCRB 3FB5A 4FL4B 5EU5A 2IFGA 2XOTA 2CCVA 1KYFA 4H5SB 3CSGA 2DI7A 3ARED 3S5LB 2XACC 4EI5C 4GW5B 5HSFA 4FLSA 4KX7A 4AUJA 3D05A 1QHOA 3PWUA 2NPLX 2X87A 4MDIA 2UUDH 4Y4FB 2AITA 4O02A 3EHBB 1F3DJ 1B0RA 1DSWA 1I1RA 2OMXA 3OJ2C 4ODHL 5E2UL 4CBPA 1CLOH 5CNHA 5J1AB 2TRHA 4Y2LA 3PWPD 4PHZA 3SGDH 5FYLE 1RJYA 4P5TB 1RUQL 2EYSB 3L4UA 5C0AD 1M1XB 5FHAH 4WU7B 4XMVA 2BP5M 3MJ9A 4K2UH 1UWXK 5DZ9A 4U2ZA 5ELIA 1TFPA 4R7NA 1UD2A 1R5WB 3IDYB 2DW5A 1FL3A 5LJYH 2WQAA 3UZQB 3GXMA 1DBBH 4FCHA 3PQYE 3UAJD 1DQLL 1PZ5A 5DUMH 4OV6F 5D7KD 4BSJA 3BH9A 5CGTA 2I9TB 1RFDH 3DO7A 4HJUA 2Q76B 5FS5A 5C2BL 2A0LC 4IOFC 1SHSA 3CTTA 1CE1L 2EXYD 4QRPD 1F8TL 3V4PL 1XB3A 3GJFB 1DJGA 4NQUA 5E00B 5HHME 3X12B 4GRLA 3TO4B 2BSRB 3IETA 4N68A 4BD4A 4QTHB 1K4DB 4V2CB 4E41A 3MNVB 1W8NA 3TBTA 3MRKA 4C4KO 4K7PH 2O5ZL 2E4FA 1CVRA 1CICC 2L3BA 4OF8A 5KYUB 3TFBA 5MHSD 5HY9B 3V4VL 3V52H 2B16A 5DVMA 5DO2D 4J23A 4KNQA 3DSNA 5F0MB 3QNYA 4LLQA 2H2SC 1SJXA 2VDLH 5C3TA 4ZFQA 3KL0A 1VACA 5CU5A 5EOCJ 2NDGA 4JG0H 4N25A 2VSCA 4WWOA 5DQ9A 5KUKA 1S9XA 3ZZQA 3ZKQD 2ZZUT 5DF0A 4XGZA 3V6BR 2EINB 2WUCH 5D7LE 3TP4A 3MOBL 4X80L 2OW7A 1UM6L 3DC0A 3U9UA 3BO8A 2WLKA 1ES0A 5EPMB 2JNZA 4MAZA 1J10A 4R97C 4DEUA 4NN5C 3RNKA 3GJEA 2TSAA 1WA0X 3MMEB 4W70A 1LE5B 3U36A 3LD8B 2YSSA 4E0RB 2XXCB 2I07A 3P3TA 4N8VB 4HC1H 4OZHE 3SQBA 2MNWA 3WEAA 5TQ2H 3WHE1 4YHZL 1J1OH 4OCYL 3KPSE 2FBJL 1HHJA 4LIQL 4GW4B 5BV7B 1USZA 3TA4D 2R0LL 2J1YA 4JJ5B 3UBFA 4XXWA 2WN3A 1XL6A 2EZ0D 5D71H 5IQLA 3UAEA 4AENB 4WTZA 5HDBF 1FRGH 1JPTH 1SVBA 3DXAA 1A4KB 3OXSA 3P30H 4GMSH 3WE6A 2H2PC 3LEVH 5IOKA 1O5PA 1M6UA 1YMMD 4TVPD 1FP5A 5IQ7L 2G2NA 3M6DA 2MQ3A 4WUKL 1UWYA 1UB5B 4O4YH 3G5YB 1RK1A 1UWFA 3UJIH 5L4MA 1RJLB 3EFDH 2GT9A 2MOQA 4MJIA 5I6XB 1JPGA 2GJJA 5DSCA 4HJSA 1RZPA 2XG4A 3EJSA 4ODVH 3INUH 5GGSB 3TWCL 4NN7B 3P4NA 4ZUTB 4HKBB 4QRFA 4TTDC 3S36H 3ZBMA 2HLAA 4OSUL 3QQ3B 4OKVA 4U4BA 5FHBH 2DM4A 1VEMA 2EACA 4MBOA 5F88A 3MZTA 3IYLW 3T04D 2UY6B 1J5HA 3AC0A 2O6DA 3C8KB 4B9FA 4FS0A 4CKVX 1TYEB 2ZPKH 2WWMD 3OZKA 5TE6L 3CFTA 3QWOB 4QGTA 1A1OA 4JX0A 3P11L 1CQKA 3W2DL 1DUYB 1CFVH 1I8IA 3T3ME 2OQJB 1FO0A 1LK3H 1A9VA 1CD0A 1A6WL 4MD5B 4G8GE 1V5JA 4OJDH 5BOZG 4WFFE 4FHJA 5SWQA 4X8XA 4NIKB 4G7YL 1JS4A 1S9WA 3LH8A 4P9ML 3VD4A 5GSVA 4WW2A 1J8HD 3HLAB 3G5VB 3ORJA 4MAUL 4MNHA 1FG9C 3TF7C 4FQHB 5HGAB 5IWLA 3MRGB 4ELME 1A6VH 2B7DT 1CGTA 3AJ7A 1IEHA 4BSVA 2WQUA 2VXUH 1GYWA 1CTOA 2A6DB 3Q3GB 4F7TB 1KZYA 5C3LD 4YBLC 1TENA 2ZXCA 1MFCL 1HHGA 4EDXA 1T5XB 4QT5B 4F8PA 3SDAB 3D18A 3ARFD 4XCCH 5H94A 4N0CC 4Q6IC 3F5WB 1MZYA 3O3DA 2WLYA 1ZLDA 4PJIB 4FYRA 4EIZC 4ZQTA 4HJGB 2CRMA 1XGPB 2ORBH 1S7WB 3I75B 2H9GB 3ZTJG 3CLFH 2ILLA 3G04B 4JAMB 2ZCKH 3F04A 4POYA 1PNCA 4UINL 5DZNA 3T0AA 4ZMNA 1A7OL 4YHKH 1MSPA 3O81A 1KENH 4YPGA 5DK0A 3MSPA 4ERSL 3UTZA 5AW6B 3NIFF 3U2SB 1N9PA 2DEWX 4IGBB 3VWKC 5C0CD 1H15B 2D9CA 1HKLH 3F7VA 2IAMD 1AZRA 2V5TA 2VGLM 2WZ0A 3KH4A 4UOW0 2X6VA 5JR1L 1WFUA 4KH9A 4GBXB 2XTJE 3EG9A 5IW3A 4KPHL 4NQVB 1PNDA 3KGSA 4PCKA 1S5HA 1U42A 3PFQA 3S3BB 4A7TA 5L2JA 3SPVB 3QDAA 1DZBA 3G6AB 3K71A 3HG1B 3OXRB 4U3SA 3QUMB 3GLAA 5TE4H 3CD4A 3SZKC 3TN0A 3VFTA 3VXQB 2AXJA 2YD0A 3MRCA 1BVZA 4XCYB 1FL5A 4BFRA 4GI9A 5C07E 2JQAA 2XG5A 5LNEA 1DCEA 1OGPA 2IAAC 2Y06L 3QR2A 2D7MA 3GHEL 5D7IF 2JJSC 4F5CA 4WQOA 2AQPA 1YO4A 1I7RA 3ZR6A 1F0LA 4KMLB 1JHTB 3ECUA 4KTEH 2R7EB 4N2LA 5DZJA 3AZUA 3B1TA 1G0XA 4BH8A 5AZ2H 1YNLL 1IGIL 5IFAH 4A7GA 3MLXH 1MRFH 4GY4A 1JMZA 2VISB 4LRNH 3ZE0E 3VD9A 3I3DA 3LZLA 3HUJF 4LEXH 1BIIB 4QHLA 4NBXB 5GS1C 1T66C 2LHAA 1XF4A 2ZYHA 2BFVL 2WBJC 2X4PB 1BOGB 5GZOD 3HFML 2V17H 4KWUA 3I2CL 1OE2A 1MFDL 1ND0B 5GGVL 5CIPA 4W9EC 3X17A 4LNRB 3II2A 3RUGA 3APDA 2WXOA 2AXHA 1Q72L 2NZ1A 1B90A 3UYPB 1T4KB 1O7VA 3N43B 2RQ8A 1B88A 1TFHA 3Q8BA 3FN3A 2P5ED 5F0LB 3WIAA 4BWTA 3P4MB 2ARJB 4JFOA 1B0GA 3E0GA 1RUAH 5BS0D 3VDBA 5LN4A 1M3JA 4MNGA 4ABQA 1BF8A 3JWOH 4PB9L 2XCMC 1FZOB 5I18H 1HHKA 4PRPB 1U6AL 2XQYG 3JVFC 1VFUA 5E2UH 4ODHH 4DZ8B 2E9BA 3RWIB 1L0PA 1JZ6A 3KJ6H 3T2LA 3T4AA 1GY2A 1F5WA 1OSEA 2FQGA 1EGJH 3G5WA 3KBFA 2BOLA 1TEFA 2X70A 1RUQH 2Y25A 4XN2A 5LAPA 5B38B 4BQ8A 2ZUUA 4JK0D 3LKOB 5E24E 1JGDB 4MQ7B 4KTDL 4FNTA 5FYLL 1TU2B 1UA7A 2IH3A 4WHCA 1CD1A 2FGWL 4XHQA 3H2QA 4XMPL 5DI8A 1AE6L 2J12B 3EUDA 1CZ8H 4TLTA 2XA3A 2QGBA 1N6UA 2HKFH 4JY6A 5C8JB 3PWJB 3UZVA 3PJSA 1YC8A 3KW7A 1YEJH 1OAXL 2DZEA 1DQLH 2ODIA 4EBQH 1FORL 3QHFL 5H8DA 6PAZA 4C55A 4ORGA 1IT9H 2Z92A 4JW3A 2JKXA 5C2BH 4P46C 3V4PH 5B1JC 4R0LC 4HDIA 1R3LB 4TNWK 5A7BA 4NDMB 4HS3B 4AK2A 4M4RB 5E2VL 2A99A 1CFNA 1G7IA 1SYSA 2WLIA 3GSOA 1H8OA 5J13C 3ASNB 5HI5C 1U91A 3TVMB 3WJJA 1XH1A 2VH5L 4RBPH 5CAYB 1KB5L 1F41A 2CGRH 1T6VN 3PWNA 4XI5D 1IGTB 1YDPB 4J6RL 3BSZH 1I1YB 4TQPA 2AQNA 2H7WA 4Q52A 1PIFA 2WANA 4JO1H 2V3FA 1KIPB 4FQXD 3O2DH 3VX0A 3D9AL 3QWQB 2CUMA 4N87A 4OFDA 4X80H 1UM6H 1TVDA 2E8ZA 1WYJA 1RK0B 1YECH 5ESAA 1U2YA 1WEJL 1AXSB 2BW4A 1DQDH 2ZXQA 4X99A 2EEXA 5IJCC 4JFEA 3KYOA 1YEHL 1BGXH 2N1KA 3LKRB 4XC1L 5DWUL 4F57L 4X98A 1ET5A 1GYVA 3DO4A 3IDMA 4NT6B 4ZYKB 3Q6FB 4P2RB 5E9AA 3UX9B 3FO2A 1NCBL 4XMKL 3WTXA 4Y2OB 2ZWLT 2YMTA 3H0TA 4MRCA 3KM2A 4ZAKD 1R33A 3KPNB 4KKCC 2ZSWB 1KDJA 4XWOD 2DH3A 1XB8A 1D7DA 2EQDA 3FTGB 1HHIB 1JGVL 4I85A 4GO8A 5T1KA 4AKOA 3Q2WA 1Z32X 3K8MA 3O8XC 3RIKA 4OV5B 2YGPA 1BBJA 1N2RB 1EXGA 1X5ZA 2NOYA 2W81C 4BUGA 4FMKA 5ESQA 3OG6B 4QJ3B 3WAKA 4UM9D 2EE0A 2OW6A 1IGCL 4XTRD 1TUPA 1PAMA 3CZKA 5IGXH 2GI0A 1T0PB 5F9JB 5F6HJ 3VXRA 1N3NA 4P49A 5CGYC 3DX6B 4RMSA 4AMXA 3QEQA 1FLTX 2OR9H 3SN6N 1IKNC 1CFQA 3GBNL 3HCVA 5E6IB 3FU8A 2VLJD 1FPTH 3OHXC 3GFUA 1TNNA 2EIZA 2IV9A 1U8LA 3DNKA 3EYUH 4MA1B 3HB3B 1AZZC 1DL7L 2EVGA 3PU7A 3KAAA 5ICZA 1ZVHA 2J8UA 2APWA 3IRPX 3JT2A 2FT8A 2ESVE 2Q2EB 3MLUH 4GKZA 4M48H 1MAKA 3ECWA 3FS9A 4M61A 4RRPG 5KVFH 3QIBB 1AR1B 4KZ0A 2F54E 5HD8C 4PTTB 1SY6L 1KLGB 1TJIL 2WYIA 1AZCA 2XI9A 5I0DA 1UEYA 4JDZB 5TE6H 3M88A 1J8RA 3QCUL 2F61A 3RZWA 1GY1A 2DWXA 4XN1A 1X6LA 3W2DH 4TUKH 4LAQL 1T6WA 1OWRM 5I5JA 4U1JB 2J5LC 4XNZC 5SWSB 3RTQA 4AGMA 4OCSL 4TYUA 2CDEB 4DZBB 3PHSA 4WGWB 2HCZX 1NFKA 2WTRB 4CSZA 1XXDC 4KQ4H 1AHMA 2IDTA 2MIZA 5L9DL 1TEYA 2DMGA 4FL4C 3NJMA 1NEUA 4OGAC 3IGAA 5DRZA 5JIKA 4ONOA 4KV5E 1H8NA 2DQIL 4XB7A 2NZIA 4YUEL 2R27A 4LBEA 3UBXA 5GGUA 5HYFA 5IEKB 1MLBB 2ZOLA 4M56A 2YOCA 4U1HB 4JDTH 2IH8A 4UANA 1N0XH 4Y4FC 2F7IA 4Z7NB 3ES6A 5ACMA 5KBNC 5DD5H 5LBVA 1MFCH 4AMWA 3BWUC 1M6OA 1AZBA 4JRYA 1XXFC 3RI5K 2Y7LA 3OJDA 5D1ZA 3MUGA 4P5TC 3P0VL 1CXEA 3EO0A 1WD8A 5I6MA 5DJYB 3N41B 4FOMA 4HLJA 1FNEA 3P4LA 3RX5A 3AFLA 3RFRA 3M17A 5GISL 5IVXB 4NCC2 2AEIT 3MV9A 1CURA 2K6YA 1QI4A 4FHBD 3B9KB 4M8VA 4ACTA 5I74C 4HPYH 4UOJA 1BQLH 4IU3B 3O41A 2E8YA 3QAZC 4U1LA 3GSWA 2GITB 2J88L 2YARA 5T5NG 4WUUE 3RGVC 4FQCL 4FFZL 5I1HH 1F11B 1B0IA 1K5NB 3PJNA 1FZKB 1CFSB 4Q89A 5DD6B 1Z1WA 3TO4C 2HLEB 1QKZL 4MJ4A 4S1SH 1E27B 5LBGA 5F0PB 5ITFA 3I9AA 4WK4B 3MRJB 4ZQKA 3WTWA 3CC5B 5JR1H 1TZOA 3DRQA 1FGVH 2A9NL 3AY4C 3JZYA 3PJLA 1Z7JA 1DSFL 2I26N 1KXTB 5EEZA 4KPHH 4X4ZA 2J1WA 5SWZB 5JO5B 2VABA 2CPUA 2KBGA 2AEPL 3AREA 1OK0A 3BDYH 5L7XL 1YPZE 2AK4A 3ESNA 1J87A 1QZNA 2EO1A 2WUBH 5DJAB 4F7CB 2XIDA 4FNQA 4XBMA 4WTZG 2DD8L 5DZLA 3VFWA 4UB0L 4OGYL 3U2JA 2LABA 5DA4A 4XP5H 1FVEA 2KYIA 4I2XE 1XTLA 3BQUC 4ODUB 4FQJL 4GJTB 3HNTL 3NCYP 3PWPA 4A68A 2G4EA 2PYEE 4MNQD 4NUMA 3ARDB 3ISRA 3IJEA 5CGBA 1S8DA 3NSFA 4ZFFA 4L8BB 4P4KC 5C0AA 1WQVT 1LWRA 5DJDB 1VFOA 3C8HA 4LBAA 1VENA 2H32H 4KZCA 4U4IA 1AQ8A 4B41A 2R1YB 3LD8C 2ZKHH 3PABA 5IFHL 4KDWA 5DZPA 4ZUUA 3EJZC 4N2DA 4L4TD 5C0BD 1CDCA 3RA7H 1RZ8B 2G3NA 2NY4C 3AWGA 3B9VA 3ETSA 12E8H 3S3CB 4Y9GA 3UAJA 1PFOA 2BHYA 2OMZA 3EDDA 5BV7C 1X7TA 1FG2A 4N0UE 1MWAL 1EEUA 2YD1A 1Q9KB 1D6EB 1ZS2A 3O3AB 5JQHC 4QRPA 1TLMA 4NUGL 4ADGA 4IIZA 1Q90A 5ERWA 3OKMA 4ZMOA 4PJBF 1WK0A 1TJHL 4X83A 4Y1SA 4PJAE 1Q72H 3MJ7B 5FK9B 2DQGL 3NGBB 4WI6A 1W0VA 2FJUB 1HXYB 1X6NA 5DHXB 4PMFA 5DHVA 4IRJD 5EU6D 5C0JB 4JE0A 1C08B 1NIAA 1CD9B 1BM3H 2A83B 4CC4C 5T33L 2B59A 5L0QB 2VMDA 2JJUA 4PRHA 5I6XC 4QO1A 1FIEA 5T1LB 3T0ED 4JFXB 5CO1A 4KZEH 2KERA 4HKXB 3DA0A 3SBWA 3ZL4L 1KIUA 2JV6A 2EDLA 1EEZB 5IV2A 1WBZA 4NN7C 3F6IA 4XPHL 1IEAB 3D0LB 4NHCL 1YYLL 5AW3B 5JPNA 5EBWA 4DKFH 1XZ0A 3KDMB 1LO5B 1PD0A 1RHHA 4KK5C 2WPGA 3MJGX 1LWHA 4G6FD 3AT8A 3QIWD 3REWB 1ETA1 1AE6H 2IH1B 2DL2A 2WXFA 4N2IA 4Z7OF 2XJKA 1IFGA 4YHIB 1JNLH 1GZHC 4YK4B 2FYVA 2IFFH 1NMBH 2E6PA 2AEOA 4DK5A 3FB5B 1ZV5A 3FCGA 5EU5B 1LO0L 1TZIB 3FO1B 2P3YA 3L08A 3OVUB 1KV7A 1E4KC 4L9DA 4NN6C 4N6QA 1ACYL 2E86A 3NPSC 4LP5A 3PWUB 4JR9L 4UAHA 1D5XA 3ETTA 1RZKC 2O5XH 3P3UA 3NN8A 2KDGA 4O02B 1B0RB 2OMXB 1H3UA 1WA2X 2NY2B 4N86A 4XR8C 3SGKA 4BUHA 3CVCA 1YMMA 2VH5H 3D12B 1QX1A 1DVXA 2X5PA 1RJYB 4LB8A 4JPIA 4HEPA 2V2XA 4DKAA 4CKQA 4ZFOA 1E2WA 1Z5HA 2B1OA 1PEZA 5LUMA 4PLJD 4HMEA 3DX0A 2QMKA 5E99L 1T0NA 2CG9X 3D9AH 1G0YR 2DDQH 1NOLA 1CK0L 4AXWA 2DM2A 3U1SH 3F83A 3CN4A 1WEJH 2G2RB 4HFUH 4HJJL 5AVRB 2PXYC 1HL9A 3BH9B 3DO7B 2DQMA 2MOVA 1EJOL 1FNSH 1MI5D 1A4AA 1LILA 1YEHH 4XC1H 4F57H 2W0KA 2Y2TA 3SOBL 2ZCLH 2ENPA 4XMKH 4GRLB 3MRHA 3GZOA 4KI5E 1N4XL 1NOAA 3S35X 4E41B 1WFTA 2NNFA 1MFMA 2WQRA 3R4RA 5TH2A 4AYFA 2VAAB 5D7JD 1RVFL 1PZCA 1GYAA 2P5PA 4IGBC 2PO6D 5CZKA 1FIGL 3EH4B 3ML8A 3TWYA 3QNYB 1L6XA 2X05A 1FSKC 1WGVA 3CIQA 3KS0H 3QDGE 1VADA 1VACB 4WWNA 5DQ9B 1S9XB 1WPCA 3TJEH 3VU1A 1A65A 1J8HA 4XGZB 1R9FA 3VFVA 7FABH 4JEGB 4A6YA 3KVDD 2FL5A 4E9LA 2AI0L 4FXKC 1E65A 4X6DA 1S7XA 3BO8B 3L13A 4N5UA 1ES0B 4PJ7F 1ANUA 2R2HA 3LV3A 4J5VA 2J20A 3ATFA 3DV4A 3AG1B 3MGOA 4KKQA 3RNKB 3U6XS 4X5XA 4BZ2A 2OI9B 1ECYA 1KCKA 2BPBA 4JHWL 1UA6H 3WJLC 5JXAH 4P4RA 2YSSB 3DIDA 3ARFA 5IT2L 1OW0C 2QMJA 3SY6A 5D2NC 3SQBB 2AJ3A 1DQTA 1QEWA 3EOYG 1V10A 3GGWA 3X1NA 2MPVA 1HHJB 3UYRH 1NBYA 2P4AB 3V9CA 3BEVA 3N85L 1AXTH 1EPFA 4UIKL 4D7BA 5CLZA 1UWXH 1ZWIA 2NY6D 3BGFC 1LL1A 1KXVA 3DXAB 3OXSB 3WE6B 4AWJC 4JPSA 1AC0A 1PLGL 4IKJA 4LAQH 1GGUA 2PCFA 5L6YH 4OCSH 1Z9LA 1GL4B 3ISYA 5C0CA 4WFGD 2IAMA 5DC2A 2OCJA 5G55A 3AB0C 1E9QB 2GT9B 2VB5A 1BZEA 2A77L 5AOKA 1ZTXH 3IDNA 5DSCB 4Y5YA 3WV0A 2E76C 4PD4J 3US0A 4YSTA 1Q9OA 2LOEA 2RGSA 4YUEH 4PP2A 5DVKA 2APTA 3P4NB 4DP9X 1DVYA 3O4OC 4YR6A 2HLAB 3S88L 2H0FA 4OKVB 5E4OA 5F88B 4WAFA 2CRIA 3RVXD 4G2AA 4TNWF 4AX3A 1X5HA 4HHGA 4HWBH 2HX9A 3V7AG 2D4DA 2E5EA 5EUOF 4WSKA 1TJMA 4DO6A 3CQPA 2ADYA 1PYWA 3E3QE 3LPPA 3D3VD 3AMLA 5DS1A 4NZFA 4GXVH 4HPOL 2E6JA 2FD6L 1I8IB 5GISH 1CGSL 5IB3A 2AK1H 1FO0B 3ZHKA 3JT0A 4KKLC 3LTVA 4B27A 5IUSA 5SWQB 3CHRA 1XGZA 5CHNA 4N0YH 1OP3K 2VCOA 3IFNL 5GSVB 4MLIA 4LLAA 4MNHB 3LRLA 4S1QL 4JM0A 3K4AA 2WGXA 4KY2A 4Y7MA 3MBEB 5FYLD 1WWCA 3GMOA 4M7LT 2BSED 3ZRFC 1GMEA 4FZEH 4KC3B 4X7DC 1TZGH 5ADPL 5GZOA 4A2GA 4YJZL 5LB1A 4EE2A 4BSVB 5E1QA 4APQA 1JI1A 2BWQA 4CDHA 1WFOA 3GQFA 2HFTA 1HHGB 1DSFH 5F8RC 1Y7VA 1B9KA 4UNTA 1AO7A 3NZSA 2KQNA 3D18B 3TVMC 3Q06A 2P5EA 3PQYD 3FTVA 4QHMA 5TJWK 2C26A 2AEPH 1SXZA 5BS0A 2EUVA 1KZQA 3KYNA 3O3DB 4L1BA 1TEGA 5ECJE 3WCYA 1RIUL 4UB0H 5L8KB 5T5FL 3B43A 2WY3B 3PUCA 4WO4D 4G9FB 4AKPA 2DEXX 1TXKA 5HHMD 4P9HC 4UTCA 2C9PA 3KWVA 5DS2A 4LSVL 4NQCB 5JW4R 4Q7DA 1AC6A 1C5CH 3FB8A 3HNTH 3Q48A 4HIXL 1CGVA 3H3KA 2D3JA 3DVIA 2CKNA 5D1XE 2N7SA 5DK0B 3UYOD 4JM2F 4NNXA 3UTZB 5BNXD 2IH9A 3H4FA 3C6SA 4KFZC 4QCIA 2D2CC 2J6EH 1ASQA 3F7VB 4J8RA 2Z4QA 2NY7L 2PWGA 3TIDA 1DQKA 1KLFA 3WE1A 1XGQA 3QJSB 4XVSH 4Z78A 2ED9A 4PLKC 1E67A 1IIKA 5D7LD 1UHVA 2H0JA 2R51A 2V8MA 1GPOH 3EG9B 3HVDA 4BBWA 5CEZE 2DAVA 1MWAH 1RUPL 1PZBA 3PP3K 4ABVA 5AOJA 3EYQD 1DJIA 3QORD 4NUGH 2XXMB 5EOTA 4I48A 4NRYA 5L2JB 1IBGL 3WUZA 3WKNA 4KVCL 1GS7A 2RR3A 5D7SL 2Z0UA 3K71B 2HP4A 4U3SB 1KBGL 2N0MA 4OF0A 3FTSA 2EDWA 3O3BA 3A23A 4HZAA 1QBLH 1BXUA 2VKWA 3MRCB 4PGDA 4WFHE 1FL5B 3FU5A 2XG5B 3K5RA 4DSYA 3KPSD 4QJ4B 3IF1A 1IGFL 4J3OG 4P3CL 3SE9H 3HHMA 4UUJA 1I7RB 3OKKA 5FKAA 1MFEL 3OHMB 2BX5A 4BH8B 5D4JA 3UH8A 3GBMH 5J11B 4WSGA 3UBXG 2PMZA 4MA1C 3RYMA 3WEBA 1JZJA 2WGNB 1YYLH 2I5YH 1XR9A 4PY7B 2R4RH 5JXEC 1X7QA 3UACA 4BH7A 1P53A 4QHLB 2WM0A 4ABWA 2QELA 2A6KA 1INEL 2YA0A 3EJJX 1I3GL 1AR1C 3H3BC 4AIOA 2HJFA 1FI8C 4FQQB 1HYSD 3L3GA 5CIPB 1WGOA 3RI5F 3MVSA 2AW2A 4XC3H 3U4EB 4ZAKA 3NJHA 3X13A 5K9JH 3QRFM 1T7YA 3BKCH 5FEBA 5I23A 1HINL 3PYCA 5EHFA 2LQRA 1B0GB 3FAWA 4PJHA 2XZAL 3P9MA 4XCFL 2BJML 4OIIL 5J4MA 5D1QC 1Y1DA 1DLHA 1SJVA 4MNGB 4BK8A 4TSBL 3ZDXB 1HHKB 1JGUL 5DC4B 4B3EA 1RXLA 4PYHA 2HYMA 5FW6A 5KS9F 3UTPE 1YQVL 4XWGH 2QEJA 4UM9A 4FRWA 4PJEE 2X70B 3CUPA 4NM8L 1EX0A 3MRMA 3NQIA 3ILQD 3FYEB 4N2GA 5FGCE 4HK3J 1HCVA 3ZKND 4Z7QB 4DETA 1HCFX 1M3IA 5B4MD 1TQCB 4XCEB 5I66A 2IH3B 2DV6A 1CQYA 4G8GD 3PPSA 4WFFD 4HBCL 2WSPA 3GMRA 5IBLC 3FO9A 4R84A 2WYHA 2APXA 2VLJA 4JY6B 2Y7OA 3PJSB 4RA0C 1PX8A 4Z7VE 3ARGD 1DCLA 4ORGB 3VFOA 2Z92B 3FKUS 1T83C 5K59E 3O6LL 5FYJE 3VGDA 4XOEA 4HDIB 2FUTA 4KKNA 3K72A 4AJWA 4E42B 3GEFA 4U1SA 4A2HA 3WN5B 3RNQA 5IJKA 4KJQD 1JFQL 1DDTA 1G7IB 1SYSB 2WLIB 1DHKA 2LAAA 4ONGH 3GSOB 1BFTA 3FAXA 1N70A 4S0HA 1RVFH 5FUCC 1U91B 1OPOA 5CBAA 3UTTE 5F1SA 4JFPA 3DTDA 3LNDA 5ISZE 1X5AA 3UG5A 3CFEB 4UV4L 4JHAH 4FXGC 2PTVA 2X1WL 2YUXA 1B0WA 4YMPA 1J9TA 3EADA 2M1KA 2XPZA 1H6TA 5HI3C 2ENSA 2ZG3A 3QG7L 4WI2A 5AW0B 4AQAA 1HNYA 1CLYH 5K9QI 4G6KL 1RHFA 1B4TA 1O7SA 3GSNA 4G7VL 1I9JL 3MRLA 4PB0L 5ESAB 4CVXB 4EAEA 2ZUWA 2UV3A 2YQ3A 3ETBF 4X99B 1L9NA 4ZXBC 1WHPA 1G7JA 4JFEB 3KYOB 4XMXA 3ZDYE 1GC1H 4MXQC 1UB6A 3C5XA 5E1AA 1V7NL 2LV4A 3IDMB 1UD3A 1KGWA 2WMPA 3PPEA 1E7UA 1P7KA 1QYGH 2OL3H 1FFOB 2V9QA 3FO2B 3C6LC 3JYCA 4M7ZC 4QKXB 5IT2H 4R8WH 4P07A 3A6CL 3BJ91 3QGVA 3SKNA 2NQDA 3F64A 3H0TB 2GW5A 4K3EL 2VR7A 2FSDA 4MWFA 1MHCA 1JFHA 2OSXA 1LP9E 5JW3H 3X3FL 1BYPA 3G6DL 4MRBA 3SE8H 3MOQA 4UIKH 1MJ7L 4LRIA 2MHAA 3QJXA 3WKPA 2VDKH 1JL8A 5T1KB 3CZFB 1G7PA 3SBRA 4YSQA 1BBJB 4KXAA 5CUSL 4PY8J 5GRJL 4XZUA 5C07D 5ESQB 2BNRE 3L95A 1BVNT 5E51A 3SKMB 2J71A 1OPGH 2XYBA 4QXUL 5F7EH 2QQKH 4L3FA 3E8VA 4KQ3L 3DARA 1F56A 3VXRB 3NIDF 1EO5A 1N3NB 4I89A 1K6QL 2HTLC 4PJGA 3G7TA 3UZEC 3QUXD 4AQEB 5BVPL 1RZIA 1WCQA 2VM3A 4ZS6D 5FFLA 1URLA 3ZKXB 1NFDE 3FDWA 1CFQB 4N3UA 3HCVB 3PHOB 4K5NA 4UNUA 4AC2A 5JIMA 2ICWA 3IAGC 1DLFH 3K91A 2EIZB 1BAFH 1U8LB 1XO8A 3V4PA 1UKSA 3UP1A 4UQEA 5ICZB 2J8UB 3BPNC 5DVLA 4A66A 3D4GA 4PP1D 1LYQA 1U3HD 3EF7A 4M61B 3WO4B 1ZTMA 3GRWL 5I1JL 4CU8A 3CX5K 1KTJA 4OLVH 5A43C 1U8IB 2WXHA 3M1BA 4ALAL 3MN8A 3QPXL 4PGEA 4MNQA 2FHCA 1KIRA 1HQRA 1PS3A 1INDH 1K4CB 4HPOH 8PAZA 1CGSH 1ORSB 2VDNB 4XBEL 2NY1C 1GYCA 2MEJB 4YO0A 3RTQB 3IGUA 3BP6B 5E2WH 4Y16D 5KAQG 2R0WL 3U1PA 3WTUA 5C0BA 4L4TA 4L1TA 4YK4C 2WBKA 3IDJA 2AQ1A 2Z6FA 4UYPA 5DRZB 2ZUVA 3VGHA 4OFYD 3WLBA 5I73B 3UBXB 4LBEB 2A4EA 2YGQA 1OP4A 3MROB 3DX9A 5HPOA 1UURA 2WTOA 1IGJA 4DIXA 3HS8A 4Z7WB 4KRPD 5KYWA 3ES6B 4LEOA 2JCCF 3C60A 3OGOE 4NKOA 1A6TA 3C87A 3KYKH 3LNHA 2NY2C 1M6OB 4D3CL 1SJEA 5HYSA 3OJDB 5D1ZB 5HJ3A 4W1TA 1PX4A 2AQ2A 3MUGB 2L8AA 5DD1H 3REVA 1J86A 1ADWA 3CCHB 3EO0B 3GB7B 3BE1L 1FNEB 5KSBA 5I8CA 1RIUH 1NUDA 3V0IA 1P7QD 3M17B 4JJOA 4WCYL 1NH6A 2F8VA 1MCNA 3NEXA 3T0EA 3CMOL 1VESA 3STZB 1K3ZA 1A4JA 4LSVH 4L4VE 5D70H 3O41B 2KHAA 1ROWA 2ADFL 2XWTA 1MREH 3EOBA 4U1LB 1ZLSL 4HIXH 4AQ8C 1C5BH 2C7UA 4M7LL 4PJ9B 3G6JF 1WCBA 4HEMA 3DOHA 4N0FA 2MKWA 4HHAA 3PP4H 3NESA 4GRLC 4R5TA 4Z0BL 2ATPA 1XCTA 1F90L 2IALA 1EHLL 5AVQB 2XX0A 2N01B 4X5RA 4ZQKB 3LS4L 3DRQB 1X9UA 1LDPL 4FMFA 3SDXE 2BRQA 3HG0A 3N50A 3D2UB 4WTQA 5A3IC 2D31B 4HAFA 3D85D 2VABB 4Q9RL 4PUBH 2JELH 3AREB 5KBPA 1HSBA 3PL6D 5CEZL 1IBGH 4ABUA 3LN5B 2QVMA 1DFBL 3POHA 4HOZA 2AV7A 4L0PB 4AUUA 2FX9H 5DDHA 1TTBA 2XZQL 3NRFA 1AQHA 4HD9A 3PWPB 5D2NE 3VI3A 1CN4A 1PY4A 3IJEB 4L8DA 1S8DB 2N7BA 3IBOA 4ZFFB 1YEEL 5C0AB 3S5YA 2DBLL 3OF6A 2VZOA 2OI9C 1T5WA 2XUWA 5HYIA 4XNUH 4JRFA 2VJ0A 4R5VA 3NK4A 1U9KA 3PABB 1VIWA 4ZUUB 3WMSA 1FVDA 2Z7ZA 4FXLA 3VW3L 1O6VA 2CHNA 5AB1A 4L05A 1NIEA 2WZ6A 3HZYA 5HDWA 4TV3A 2OMZB 3T3PF 4IRSC 3TT1L 1JRHI 2B14A 4JKPL 1FG2B 1INEH 3ZU8A 1I3GH 4K3JH 3QYNA 1MI5A 1T2JA 3F6LA 4QRPB 4YHPA 5E8NA 5G5DA 4XB8A 2WLZA 3Q8EA 5ERWB 3TA3B 3MV8D 3ARUA 4Y2DD 1PZ2A 1MNUH 1LQSR 4ZO7A 3GNMH 3VTAA 1W0VB 4CVZA 2OM5A 5DHVB 1LO2L 5E56A 3LH2H 3RURA 1USQA 1OGAE 5D7JA 4ENZA 4PU2A 1HZKA 4XCFH 3GTNA 2IANB 1JNNH 4B96A 4WY7L 2PO6A 4DVRH 1JJUA 2OJZH 3D0VB 2ESVD 1B6DA 1M7IA 2ZONA 1E42A 5TD4A 1JGUH 4FFWC 1XB6A 2F54D 5E08L 3LVEA 2OCFD 3MBWB 3V6OA 1BQKA 1KIUB 1AIFB 3IJ8A 1MCOH 1NMCB 4PMEA 1UJ3A 4CADB 3HRZB 3C5ZD 2CRZA 1HOEA 2XBDA 2PABA 3A21A 4J6IA 3VFUB 5DQDL 4HU2A 4JGUA 5JPNB 5EBWB 5BVJA 3S8GB 1NCWH 1XZ0B 3WNJA 2YD5A 2Q3XA 5DRXB 1RHHB 4HBCH 4KAQL 1I7TB 1ZVNA 1J5OL 5TPWL 5IB2A 1XWVA 2YRBA 2XWXA 2OK0H 2YGVA 3NZHL 1FFTB 1XEUA 2WV3A 4G80A 2W38A 2V2WA 2D4FA 5KJ4A 5IESH 1DJHA 1U93A 4HHWA 3WFHA 2VN4A 3O6LH 4K3GA 3QYCA 2VDOB 3KPOA 4OU3A 2QL1A 5KEZA 3DPDA 3MJ8B 4UV7H 1SXCA 5F3HA 1D5XB 2HFGL 2JVUA 5FYJL 1T0OA 4WW2C 4LSTH 3NN8B 2P26A 3HUJA 1JD9A 4EVNB 5IWLC 3SB3A 1F4AA 4D0BB 1F6FB 1YMMB 2VLME 4Z7VF 5F3FA 4TLSA 4Z3FA 4WV1C 4JPIB 3LPFA 1CDYA 1QAWA 2V2XB 3KWWA 3KPTA 4WFEE 4A39A 4KDTA 1BPLB 2AQSA 2NQCA 4KO7A 4PN6A 1A7QH 5JORA 3ULUC 4DAGH 3QG7H 1H8LA 1KGUA 4Q58C 4XP9L 1T0NB 5D55A 1OAYL 2CKBH 4WUUD 4JZOB 1P7BA 4IRZL 4ZW3A 2Z8VC 2GHZA 1O0VA 4PWFA 4YDKH 4WKXA 2FWLB 2WQVA 1PG7X 1ZANH 1OKEA 1UKQA 2CZNA 1EMTL 2H2SD 3U6RA 1X5MA 4ODSL 5FW8A 4B0MM 2YEZA 3WUWA 25C8H 3MRHB 4NOBA 1MHPL 1HS6A 5I1AA 2YAOA 1VJSA 5FLUA 3D3VA 1WV7T 5TH2B 3TIEB 4AYFB 2R56H 3G6DH 4ZO9A 5JHBA 1LXMA 1MJ7H 1TETL 2NXZD 3H9YA 1UH3A 3JVGA 3NZ8B 1RZFH 1ZXQA 3VGAB 2GK2A 3DX8A 1DYZA 3L9RA 1YY9C 3D52A 3UEZA 2YPVL 5GRJH 2E46A 3DRTA 5HGBB 5BRZA 3WEOA 1J8HB 3TT3L 1EBAA 3VFVB 3K2MC 7CGTA 2FL5B 2BSEA 3BJLA 4GQRA 5GGTL 1CB4A 4KQ3H 3K2UH 4X6DB 1NGPL 1S7XB 5KOVC 1K6QH 2R2HB 3AQDA 4MFHA 4GQPH 5IHWA 4IBUA 3DV4B 3MGOB 1P1ZB 3TN0C 2P42B 4X5XB 3B2DC 2MNUA 4DPCX 5F7DB 1EDQA 1UXSA 4G72B 3R4DA 5DMYA 2IBZX 4X6FA 5AOLA 3ARFB 3PQYA 1VCAA 2BOBA 4YLQT 2AJ3B 1UACL 1QEWB 2Y6SC 1N19A 4TF4A 5AKRA 3GGWB 5HDLA 5BRPA 1TTAA 3VX1A 1NBYB 1AVAA 3DJ9A 5EFIA 3VFSB 2WXIA 3BEVB 1A9BA 2WD0A 5J11C 1A1MA 1ACZA 2VR3A 4NPJA 2VJ8A 5AB0A 4X4YB 4QMEA 1CR9L 4NWUH 4ALAH 1KB5A 2YC1A 2VQ1A 4L3AA 4PR5A 2ZICA 3L9YA 5IZ7A 2GB2A 2DMBA 3Q5TA 3H55A 5F7YC 2PCFB 1CDBA 1WS7A 2XVBA 4MMYA 4PCSA 1YNKH 5CZRA 2R0WH 5C0CB 4H8VA 4Z76A 5D1QE 5E94A 4X6EB 2IAMB 2M2DA 2E9GA 3MXVL 4Y5VB 2MCG1 3IDNB 4Y5YB 3KM1A 5HHOE 5D7LA 1QFWM 3WL9B 3UEQA 4KVNH 1Q9OB 4FQIH 4PP2B 4GSDH 1QW8A 3CSYA 4C47A 3QORA 5K93A 1P5UA 4YR6B 3ZYOA 4YHML 2WLLB 3BKMH 3POCA 3VQMA 4P5KA 5E8OB 1MG2C 2ADIB 5GIRA 2DTSA 3GTVA 3HMWH 3T4AC 1EFXD 4Y9EA 1RIVH 4OZHA 3CLEL 2WOBA 5EC1A 1PYWB 3RU8H 1G7LA 3KPSA 3MRNA 4XBPA 4XOBA 4K5MA 4RCAA 5TGBA 1KPUB 4WCYH 3UIYA 1K5WA 1H3PL 5IB3B 4PW4A 3ESVF 1BVKB 1INQA 5EEXA 5IJVB 3NBNA 1DQQA 3UAFA 2PR4L 2F5AH 1TT6A 4NEHB 1MQKL 3VE0B 2BSBA 4N0CD 4M7LH 3F12A 1BJ1H 1HESA 4KITB 1FE8H 3RY4A 3FOMB 5JPMA 5IBTL 4W9ZA 2VZ3A 3WXWL 4AL8C 2EH8H 1CTMA 1OOAA 4FJYA 4YDVA 5ILTL 3RWEA 1F2XK 2XTSA 4ZW8A 1AZNA 3LS4H 4QOKD 4G6AC 1ZDSA 4OQTL 1LDPH 4HUNB 2YXFA 5IVZB 2C3XA 3TPUA 1BWWA 1HZHH 4G6JL 4LCCA 1R1CA 3WJJC 2P5EB 4QHMB 1MAMH 3T8XA 4QDGA 5EZOH 4Q9RH 3NACL 4XP4L 5BS0B 1IBDA 3KYNB 4N5EC 4DTGL 4OZGE 4DK3A 3IAPA 3QDHA 1SY6A 1QMUA 1HT6A 1VZGA 3PNWB 3NCYS 2FNWA 2DY2A 3ABKB 4FFYH 1HXMB 1TTRA 2OJ1A 4Z1PA 1G5AA 3CVHL 3MKKA 4IBZA 1E6JL 2WC7A 3OWRA 4KI5D 1N5AA 4Z7AA 1EA9C 3SCMD 3CG8A 5AAMA 4ANXA 3BUPA 4NKIH 4HBQA 1NGWA 2XWDA 2Y7NA 4NQQA 4Y5XA 3U30C 2MCMA 4JRWA 3DX7A 4NNXB 1Y0LA 4G8GA 3C6SB 1HZLA 3E80A 3EJCA 4MAYC 4D8OA 4QCIB 4ELKA 4MBRA 3QDGD 4J8RB 2Z4QB 1EVTC 1CYWA 1KLFB 3VW3H 3BT2H 4BZ1H 4RH4A 1VB9A 2VERN 3FTXA 3TT1H 4JKPH 3ARGA 4QLWA 4ELMA 1II4E 1ZEAH 2XPGA 3KBPA 1ZK9A 4W93A 4K23L 4CA4A 1QTYT 3D34A 1UUSA 1ZJBA 2CJUL 2QDWA 3GSQA 5AW1B 5EOTB 4I48B 5GPRA 4NRYB 5JOFA 4HWZA 4AQ1A 4LLWB 2W60B 1KFAL 3OAYK 2UXVA 2V5YA 1UOVA 5B1AB 3WN6A 2DS4A 2XZZA 3I9GL 5I8EA 1HDMA 3QQXA 4J27A 2OAAA 1LO2H 4YNYA 3HI1A 1SBBA 4LEEA 5LBSL 4YE4L 1OP3H 3NRQA 3OMNB 4RMTA 1T66D 4XO8A 4KJYA 1G9HA 3MZGB 4UUJB 4MA7H 5DFAA 4TQEH 4EPSA 2OYPA 4PJ6A 5D72L 3OKKB 1EAPA 3DVGB 1E5UI 1MDTA 5FKAB 5J6HA 1F3DH 2HAZA 2R23B 2V5MA 1LK2A 1UKTA 4FFZA 3MOAL 4FQXB 4LL1A 1L4IA 1M57B 4B9ZA 3D51A 5B3NA 2JFCA 2SODB 3SODB 3CDYA 4H13C 4W81A 4WHDA 1X7QB 4HIPA 4BH7B 3BVXA 3G9AB 4OM0H 2A6KB 5DVOA 2A74A 4M4PA 3T4YA 2HJFB 5HYSG 2R9HD 1JD7A 5EORL 4KK9C 1NAMB 4AIZA 2GPZA 1CMOA 1JSYA 1Q9WA 2ZWYA 3GXTA 1PMYA 1BZOA 3BAKA 2ZWSA 3UIZA 1CGUA 2DKSA 3F7KA 4GEIA 1DZ0A 4ZAKB 1MW0A 2P28B 5GRYA 3X13B 4GQQA 3RTQC 1FH5L 1E6OL 3TGXA 1LDSA 1SXBA 4PJHB 1C1EL 1YSOA 3P9MB 4GW1A 3K6SA 4UT6L 4MD0A 4J8QA 5IY5B 4J3OC 1OGSA 4PD4K 1QFUH 3HC2A 1DLHB 1ZGLA 4A2LA 2HFGH 3D1MC 4AV0A 1LQBC 5AW4B 4YSPA 3OD3A 4EN3C 3DJZA 5C07A 5I73C 1T89A 1D5MA 4J3VA 2X1XR 5KOMC 4UM9B 2JLLA 3ARXA 1I7ZA 1JF6A 2AEQL 3CUPB 3DV6A 3MRMB 3PP3H 1PZSA 4NZUL 2NT1A 5EOCH 3ZT7A 4KOBA 3QW9A 5I66B 5I6OA 1S7UA 3MAWA 2BHUA 3QUXA 4JG1L 5FYKU 4JDEA 3GMRB 4XP9H 5D1ZC 5DFTA 4ZMTA 3CFQA 2B2XH 4U7SA 1MWAA 5CD5D 3FO9B 5ITBL 3FQNA 1F4YL 2VLJB 8CGTA 2VUYA 4M9PA 4P9HL 3I84A 4NP4H 3GLDA 4Z7UB 2I32A 3VFOB 4A04A 1DE4A 1ZV9A 4IOSA 3T9WA 2QQLL 4LXFA 1P4LA 1OTSD 1U3HA 4U1GB 4ODSH 4R6UA 3PWVA 4U1SB 5E03A 2ATAA 2IBGA 2VDRB 2YD9A 4ZODA 1MIML 5KG9A 4UQAA 2DPKA 4JHUA 4NUPA 1A7BA 4UMGA 3M8OH 3EDKA 1QFWI 3KLKA 4CDGC 5DMKA 3GXFA 4GMTH 2AV1B 4YDMA 3NSYA 5CBAB 2YQBA 2EH7L 4Y16A 4IKNA 3FFCE 2HPOA 3K46A 3QQNA 5IG7A 1CC3A 5JOPE 1NBCA 2HX7A 3CFKA 3MODL 4HISA 4U1MA 1BQHA 3IDIA 3B34A 5HDQH 1JV2A 1F00I 1NGXA 1KYOK 4A7VA 4AQAB 4HKJA 4P2YA 1V05A 4OFYA 1DVUA 3FU6A 2LT9A 3AREC 4Z8FH 3GSNB 2CRYA 5GGTH 1RPKA 3W3BA 5JW4Q 1JRHH 3MRLB 4W6XB 5D1XD 2BVPB 2F08A 2ZXGA 3MX0A 1G9NH 2NT0A 3O11A 4NQXA 4NQEE 5AW2B 3QHTC 4LQ1A 2YXMA 5FAAA 3IJ9A 3WIHH 1GTNA 4GB9A 4LPXA 3AQYA 1UB6B 5E1AB 3KVPA 4E2OA 1FZMA 5F71A 3BIKA 5BMFL 3O8XD 5JHMA 3M46A 2E74C 2WMPB 3FTZA 4PJDB 4QY8B 1QTPA 4WTWA 5CEZD 1RZJC 3SKNB 5BUPA 3STLB 2K7QA 1MXGA 1MHCB 1L9QA 4YZFF 2YMXL 1P7QA 4RISL 2FHBA 1PLAA 4YH6A 4G70B 1AD9B 5CGYD 4PPTA 4AM0A 2MHAB 3P3RA 2QSVA 3CN0A 2G60L 3CHQA 2ROXA 3E8UL 2WQWA 3RDTC 4NJAL 3V9FA 4QNPF 5FM4A 4WI3A 5IEHA 4XZUB 3KLSA 1TVBB 3OL2A 3GSXB 3L95B 3FCUB 1EH9A 4MVBC 5AFAA 4GRWE 4N2FA 3GIZL 3U2IA 2UY7A 4LCIH 1I9IL 3HI5H 4FG0A 3W37A 5DJ2A 1HK6A 5I30H 2XT1B 1XH3B 3D2TA 5D9SA 2H3NA 3L5XH 5IQMA 3QR1A 4PJGB 2G5RA 5BO1L 4KKBC 5HD8D 1RZIB 4H88H 2CM5A 4G5ZH 4FA7B 4XH2A 3N6YA 2WKGA 3R0NA 2LW3A 3ZXAC 2ICWB 3D85A 2J56A 4NRZA 5B7EA 3OKEA 1K8IA 4YHMH 3MACL 2J8OA 3VTTA 1I9EA 2R29L 4DPAX 4RETB 3SBWC 3KZ8A 3S96A 3LRMA 3FK3A 1A47A 3EJTA 3O2WL 5AVSB 1NMCC 3BVNB 1L9RA 4K9JA 1JZ5A 2Q87A 5T1JA 3SOTA 3EGDA 3M1BB 3RFZB 4OGAD 5JPNC 4PGEB 4MNQB 3AXIA 4AIXA 1HQRB 3BAJA 1MY5A 1LEGA 4LCWE 1PTZA 3N0AA 4BHUI 4YO0B 3RVUD 3V6ZA 1DVSA 1QR1A 3W56A 4ZUVB 2GQHA 3O9WC 4L0ZA 3MLPA 3BOVA 5FDYA 5ID1A 5C0BB 4L4TB 2KH2B 3IDJB 3UTPD 5C9KA 5AW9B 3DX3A 1C7SA 4I3SH 3WLBB 1MJJA 2OMTA 5F7FA 1JGLH 3T2PA 2JK5A 5BQ7A 3D87B 3UXFA 3II3A 1IC4H 3VSVA 4WZ9A 2UZXA 4X5LA 3VXNA 1CXLA 3CQFA 2BWIA 3WUWG 3WXWH 3DX9B 4GAGL 4WGKA 3V2AR 1IGJB 3VO0A 1U8CB 5KYWB 1G5GA 4Y2DA 4LEOB 3SYPA 4OQTH 1IILE 1UJTA 1D6VH 3GYRA 1A6TB 4NKOB 3SGKC 4AH2A 1SJEB 3EOTH 3RWDA 2R1XA 1P6AB 3RGVD 3MRIA 4IRJB 2G75B 2AC0A 5EU6B 5FKPA 4XP4H 4ZTOH 2F8XC 4N2KA 2JE8A 2MTAA 3US1A 1QFWL 3LIZL 4IJ3C 5KSBB 1JZFA 3WTTA 5I8CB 2ESVA 5FYJD 4GG8A 4UT7L 4WK0B 1OAKL 3T0EB 1ORQA 4KO9A 4TVSa 2FLRT 3RLSA 4PG2C 3EZJB 3HBZA 4PGBA 4D9RE 5B8CB 3I74A 1E6JH 1A4JB 2XHNA 1I8KA 2ZX6A 4HQQL 4HOWA 3EOBB 2XWTB 2X1QA 2EJ1A 3C5ZA 1U36A 5I8KL 3QJQB 4AC4A 2C7UB 2XRAH 3UTTD 2ZP0T 5ISZD 5SV3A 1WCBB 4N0FB 4WJ5A 4ONFH 4DFIA 4OZGF 3SGJA 2AXFA 4G6FB 3QIWB 5HJDA 3S35H 1NBZA 4F27A 2ATPB 3KPPB 1M56B 1WAPA 1EWHA 2IALB 3M7FB 4MZ2A 4JFZH 5D5ME 1QUNA 1NCCL 1VLXA 1IKOP 5EO9A 2COQA 4F1SA 4NO0D 3A3YB 4LEBA 2CJUH 1OAQL 2DYRB 4GQ9H 4P4KD 1PY0A 3GDCA 5SV4A 1NCJA 3BFQG 2KMWA 4BFEA 1CLZL 2VC2L 1FL6A 1U8KA 2DWDA 4OT1H 4W9KC 5CN2A 3UC2A 2AV7B 1DQVA 1SFHA 1P4IH 2AJZA 2GSMB 5GRVK 4OCRL 3RX9A 3N1GC 5DDHB 2NY4D 4Z9KB 4TUOA 2CIKA 5LGHL 3N44F 3B8YA 1D9KA 1FUNA 5D93B 5GRUL 3VI3B 1LEIB 2F18A 4L8DB 1FNGA 1S78C 2XTLA 1AG6A 3KGRA 4XRCA 5D72H 3P3YA 2P46B 3FT4A 1TPXC 3BXNA 4JS7A 5F0JB 2OV0A 3BVDB 1PAZA 3ME0B 3QC6X 4LL9A 4PG9A 1T5WB 3QBTB 3CSBA 4OVUA 4XN8A 3QIUC 4QYOA 2Y2YA 4YGAB 2VE6A 3ARFC 3NFPB 4PJFF 5DHDA 4FG2A 1FVDB 2YKLL 1DEDA 3HZYB 2BNRD 2C9UA 3OJVC 2CDGA 4Y8DC 3GIVA 4LAJH 1QLFB 4HMCA 2VXTL 1ITBB 4H26B 4JY5L 4FZ8H 1MI5B 1JZIA 3HE6D 4WDIA 1BAWA 2FECI 5T8IA 3SY0A 5EORH 5G5DB 4NOFA 5B3JE 3RUGE 4UZGA 3TJHD 5DO8A 1KXVC 2H4EA 5HHVL 1NEZA 1MCPL 4FLOA 1J18A 3WIIL 4CVZB 5I0VA 4TNVK 4MMZB 5C2UB 3I02A 3D4ZA 5T5FA 1PQZA 5F72S 1HL8A 5D7JB 4Z23A 1C1EH 1YPZA 2LLGA 4MCMA 4NYLA 3FCTB 1OP9A 2PO6B 2IAMC 2X4OA 4H8WH 3ROLA 3PV6B 4BIKA 3LMJH 2IWGA 1M7IB 1HILA 4G8FA 4Y5YC 1RZGB 4I2XA 3ESMA 3KLAA 3CPLA 3KHOA 1RAMA 3QCTL 2BVYA 3DURA 1I8AA 5E2TL 4RX4D 4JQIH 3ISWA 4ODWB 2PYEA 1OT1A 4WNQA 4R5XA 3MFGB 1ECZA 1URIA 5BVJB 1IM9D 2QHRL 5ANME 4UZSA 3NEOA 1O5DT 3GK8L 5I6KA 4JG1H 1C5DA 3VYNA 1MFVA 3VD3A 4ICWA 4IOIA 5ITBH 5IB2B 3HNSL 4RGNE 2NY3B 3OMZA 2XV3A 2UWEB 3PDOA 4N0UA 4WIQA 3M86A 4QXGL 2FT6A 3QZLA 3GXUB 2QQLH 3FQUA 3H42L 3FSZA 3WFHB 2MJWA 3KPOB 1YEIL 3JWDC 3SO3B 3RVTC 4PJAA 3MU3A 1FHNA 4WHYG 1R3HB 4NI3A 2NY0D 2NY6B 5E70A 3L17A 3ZLQC 4XE5B 4E9TA 1MIMH 2FBOJ 3Q2LA 2MPAL 3ZZLA 3NJLA 2PR9A 4Y8AA 4F58L 3IFPA 3N91A 4LQFH 4TOYL 1DBJH 2PXYD 1LTXA 4MHHG 4PV9A 5I6NA 2AQRA 4APQC 3TV8A 1U8HA 1MAJA 5FGRA 3MODH 1BXVA 5KZCD 4KK8C 4PRNB 4D2NA 4L4VD 5JORB 4GOSA 2ZWZA 3B5TA 1S7QB 5CINL 3ECQA 2ZTBA 2XWJA 4JFSA 4IMKC 3RIFK 3IJYA 4JO2L 4KKZA 4GI6A 4NO3A 1KCSH 2OCCB 1XSIA 4QHNA 2KZBA 5BMFH 1OY3B 3GO1L 3L7FA 3U6RB 4NCC1 2ZT9C 1QRNE 5DLMH 1EFXA 4R7LA 3T2OA 4KROD 5J12B 3D3VB 3GMQA 4NXSA 2XQ0A 3SBQA 3U7YH 2R1WA 1FYHB 2A9MH 3C75A 4R2GD 4JKKA 1KJ2H 4PJDA 4TMPA 3BFOA 4YBHA 1J1PH 2Y7MA 4NC2B 2V33A 1N6VA 1OSZA 2N4IA 1B3JA 1H3XA 5ABAA 1H9DA 2UZIL 4J3WA 1NCDH 1KJVA 3VACA 3HRPA 4QKTA 3DRTB 4YDLB 2YAPA 4IDJL 5I2IA 2CIIB 4Q6IA 3ASWA 1CYGA 4LSSL 3KPLA 5AVWB 5MENB 3WMPA 1S9YA 1COBA 4ZPVA 4Q0XH 1KUMA 2ICES 2VDPL 5ESVA 3VJ6A 3QEQE 2EO9A 1DUZB 3KYAA 4XVTL 5I26A 1YYCA 2IPUK 5LG6A 3DYMA 3BWSA 4KTGA 5GS2H 1UXSB 3GJFK 3S98A 2EE6A 2JB5H 3QK0A 1MCLA 3PQYB 1ILUA 1I4FB 3RZCA 3FO0H 3HZ3A 2E7BA 5IFJA 4Q9BA 3W0WE 1VZIA 5F89A 4EIGB 2JLPA 5EFIB 1HWHB 4WO4B 3WNLA 1A9BB 5HHMB 1PJWA 2A4CA 2XSKA 1A1MB 1C12A 3QUGA 5EU7E 3GHPA 2HT4C 5FCUH 3SCMA 1KB5B 2YC1B 4C4UA 1G9ML 4PR5B 4YDIH 2E47A 1OGAD 4MS8C 1E5AA 4AYID 5C9JA 4MMYB 3SJVE 3BGAA 5CCJA 4JCMA 4Z76B 5E94B 4JO8A 1QSFE 3QDGA 2VLKE 2CKBA 2NXYD 5CJ8A 2VT0A 3HOGA 3FF8A 4ZAKC 2ZUQC 2CMRH 2N3JA 3IU4H 3KPRE 5AYUH 4DGUA 5D7LB 1N18A 4OAWA 5J06A 3MXWH 4XWOC 3TASA 3VFPB 3AM8A 1QQDA 3NVQA 5I5RA 3MO1A 3CSYB 1JWMA 4F3FA 3QORB 5DMJB 2JI1A 2VDQL 4F24A 1KTDA 3NDYE 2IF7A 4KKLD 3CH1A 2KC0A 3N40F 2IJ0C 1F58H 4JRYE 4P5KB 1L7TL 2OMNA 3ZSTA 4FNPA 5GIRB 3FH8A 4XTRC 4OZHB 3GINA 5M95B 4J1UA 4XNYL 2FB4L 5EC1B 5LAXA 2WLJA 1KCVL 2FIRT 1G7LB 5E9NA 1LMKA 1QFWH 3KPQA 3KPSB 3MRNB 4A2MA 2O6CA 1KPRB 4XBPB 1SOXA 5TGBB 4Z3IA 1YC7A 2ZNXA 1RL1A 3MV9E 1OAKH 1BQHG 1KFGA 2EIMB 3O2VH 1XL4A 4UTBL 3NEEA 4NO5A 4PVNA 4XO4A 3HNVL 5GZNC 1S3RA 4HQQH 1INQB 1M9SA 3N42F 1DQQB 5CJXC 2HFFA 2QVKA 4BFJA 2VM4A 5GRWA 4AYSA 1T1YA 2VLMD 2GJ6E 3F12B 1PZDA 4J28A 1KCLA 4U1GC 4NGHL 5JPMB 4UILH 3MA9H 1SRDA 4WFED 3GMMB 3LKQA 3R1GL 2WOYA 4BCZA 1SVCP 4ANUA 4YDVB 5IJKC 4E9RA 1MFAL 3BVWA 1YRKA 2BP8A 4QRSA 1NCCH 4LARL 5FO9A 3TPUB 4LCCB 2GTWA 2AK4E 1BBDL 4X8GA 4Z3JA 3GRWA 4KUCF 1PD6A 3MYJA 1F13A 3NA4A 5D7HA 4WHTA 5AOMA 3OR6B 4M6NL 4B5ZA 1E28A 3IDUA 4S11A 3AITA 3Q8FA 5EOQL 4FADA 2EVJA 2K70A 2WWKO 5IQOA 3X3GL 1N5AB 3CSPA 4M5ZL 1VFMA 1NMAH 3GMNA 2WAQA 1QA9A 3NSJA 4PJ5E 2VRKA 3T3MB 3NTCL 3ZOAA 3O3EA 3GT6A 3GSVA 4Y5XB 4XXDA 5DEZA 3CE1A 1IAOB 3DX7B 4R0LA 5B1JA 5TE7L 1Y0LB 5E1GA 4G8GB 2QQNH 1E4XL 1F6AA 4HIHA 4ELKB 4PY8I 3MA7A 3AUVA 1ADQL 5JHLL 2M26A 1BZ9A 5K1NA 4BGDA 6FABL 3KWTA 1TNMA 3A6BH 3JWOC 1OARL 5AZEL 2NNXA 4YQXL 2VR5A 1M7UA 3ARGB 2VXTH 3GI8L 3GKZA 4LESA 3VXUE 2XPGB 4ELMB 4LRIC 3A4FA 3MDJA 3GSQB 5B21A 1XAUA 4HWZB 3ESPA 4AQ1B 2B4CL 2VZSA 4LSQL 3X14A 3IFLL 3WIIH 2I60L 2QADC 4N8UA 5I8EB 1HDMB 3OZ9L 4YNYB 2NW2A 3HI1B 5D2LF 3I3EA 4CILA 2ID5A 1BZ7A 2AMGA 1ZOXA 1S2EA 2ARJQ 3IEAA 4KJYB 3D50A 1OQOA 5AW5B 1M2OA 4GPVA 1RKRA 3EKCA 5HHNB 1EAPB 1WP6A 1ZLVK 5J6HB 1LK2B 2IVFC 4G6ML 3TBCA 4XNXL 3LPWA 3BUIA 5E2TH 1HL5A 1FVCB 1LMIA 1TQBB 2FATH 2IOOA 1FAIL 3CXFA 3KCPB 3L2MA 4ZMYA 3IJHA 3G5ZA 2JCWA 2OYKA 4ES8A 2Z35B 2K4AA 1J11A 2D7PA 3CSFA 4G43A 2GY5A 4LLDA 5D1XA 4YXLH 5C71A 2AFNA 3FYIB 1ID2A 2DICA 1BFVL 2QVIA 2E6QA 2JSFA 2EIJB 5D1QD 5FO2A 1QEXA 3T4YB 3BKYL 2W88A 5GS2D 4HIQA 3O8XA 3DJRA 4AIZB 4PGZA 1Q9WB 1VFBB 3CFJA 3OLIA 3RQ3A 1UYWL 2V8LA 5HHOD 5C0RL 2H47C 3BHBA 1FH2A 4QXTB 2F8IA 4WLCA 3KGUA 2BXYA 4QXGH 4LDOB 4OGQC 5MEOA 3MCKA 3VRIB 4FCAA 3SD5A 1IVLA 3FUMA 3K6SB 2VWEE 1YEIH 2X2JA 3MBXH 2VRQA 4MD0B 4ZRGA 4LSPL 4N1EA 3WTYA 3SPJA 5M7QA 1ZGLB 5J3HC 2J6WA 4QHKI 5CSZA 5A2JH 3IM1A 1AGDA 4WI0A 5F7MC 2DI9A 2NTSP 3QSKB 3ZHDA 5IBLD 2UXTA 2MPAH 4WWKA 2A2QT 2O4EA 5LCVH 1E9OA 1KGYE 4OZIF 2QPEB 1AQKL 1XAKA 5C07B 1IEBA 1D5MB 2P80A 2ZKYA 3SE3A 2ITDB 4YSSA 3UTTA 2GC7C 3W5NA 1V8HA 1J9QA 2C3HA 3C60C 1DVFD 1KPVA 1JVLA 4BZ1A 4HXBL 4X0KA 1S7UB 2VL5B 3QUXB 1LO3H 1BXAA 1CLVA 3HEIB 4HAKA 2Q86A 4JDEB 2VMFA 2ZE0A 2WXJA 3ZE0B 4ETYA 4N6RA 3NABL 1NGQH 1EBPA 1BECA 1XFPA 1VFAA 1V54B 3HS9A 1DE4B 1HTYA 5HYJE 3T0EC 4JB9L 4PWJA 5EU4A 3EJYD 1U3HB 3R18A 3Q9PA 1EV2E 2AQQA 3JV6B 3NG5A 3MLSL 4Z95H 2VLRE 3LHPL 3QS3A 2BVQB 5DYFA 3KL3A 1Q0XH 5I1EL 2VIRA 3Q05A 4HFWA 2IBZY 4LASL 4F9PA 4ZXBD 1AZVA 3BUBA 1VZHA 4Y16B 3V0DA 1KG0A 4MXQD 5IG7B 4L23A 1E5CA 3E7JA 2UZIH 3CFKB 3BSHA 1Q4NX 4ODTL 5DZOA 4UQ3A 5KWYC 3IDIB 4L3EA 1JV2B 3C6LD 2GBVA 2XETA 1NGXB 3MYZA 4OLZL 5BZWA 4PJEA 4HKJB 3NCJL 4PHXA 2RH0A 5C7XL 2UVFA 4LSSH 3BKJH 5CBEA 3SKJH 4TM9A 3MX0B 3O11B 1I3VA 4XOCA 4GRWH 1R47A 2VDPH 2BERA 4JFWA 4NUJB 3Q8CA 2VN6A 3H56A 4X4XA 1FZMB 3BIKB 3HE7C 3DDFA 4GO6B 2GTQA 3TNNA 4BELD 2ETWA 3RGVA 1HH9A 4O51A 4G9DA 4MQXC 1CI3M 4TNVF 2VQTA 4Z7VA 4XAWL 3GD1C 5CN1A 2VERA 1WFIA 1H0DA 2CJ3A 2APBA 2YBRA 5FUOL 4DQOH 4PJXE 4OD3L 4RFEA 1AMXA 1P7QB 3CZNA 3EGXB 4JRXE 4NQDE 4PLJC 5T3ZH 1SEQH 1DN0B 2BCMA 3ZE2F 1IC1A 4HJEA 3BISA 3VYOA 2HMID 4AW4A 1N8ZB 2QBWA 3LX9A 4DVBA 2FQDA 2WXRA 3FU7A 4FD0A 5FXCH 1A7PL 4ZFGL 1IQWH 3PE9A 5AL8A 5IEHB 4XN7A 4XPGH 1JZHA 3NCMA 4PRDB 5T1DL 3QPKA 1BLNA 1GVIA 2ZF9A 2DYPD 3GXNA 2AJSL 4U2YA 3UBGA 3BPOC 2UY7B 3L3OC 2GTZA 1QP1A 1ODAA 3B2VH 3UP6A 4Y4HD 3WFBL 5D9SB 2H3NB 3S8WA 4IRZA 5K9OA 4I5BA 3V7MA 2Y7QA 4NFCA 4FA8A 4XH2B 3GI9H 3TV3L 1VGEL 4JLRA 3SPGA 3B7TA 3B3BA 3FTUA 2PO6C 3ECBB 4KY1L 1HU8A 3D85B 4NO0A 4NRZB 1P2CA 3OKEB 3QZNA 4P3DB 5MERB 1ZIBA 4P4KA 1K8IB 2VDQH 3PL6B 1ET7A 1NM4A 2CHZA 1ZT4B 4TRPL 1NKRA 2L0DA 2PCYA 1XX9C 2R2CA 4YSOA 4B95C 3V6OC 2GHWB 3GUTA 3S96B 1QPPA 4K9EH 5JYMA 3ALPA 3U0PA 3W39A 1XF5A 1UJ3C 3CLWA 2OSLA 4WU5A 2AXGA 1THAA 2PP7A 2BCKB 3EGDB 1R3JA 3WY2A 5EEWA 4OIBA 1KCVH 1AS7A 2V3EA 1KBKA 2AJYL 1N7MH 3BZEA 3FZUD 1LEGB 3FRUB 3VI4F 3NRPA 1EJ8A 4UTBH 2NDFA 5BW7A 5DU7A 1JK8B 2YPVA 3V6ZB 1OWWA 4X8CA 4DP2X 4I4WB 3U0WH 3CU1A 4KJPC 3GS7A 3CZEA 2DIBA 5GGTA 5ID1B 3BVUA 1F02I 3FUDA 2BNRA 5AW8B 3VG9B 4FJZA 4HJTA 3MI6A 1MJJB 2UYLA 2OMTB 3ZDZB 2JK5B 3S48A 3R1GH 3RIFF 1M71A 1TTUA 3HE6A 2UZXB 3U6XA 3VXNB 3FONB 2JF1A 4UM8A 2ZYSA 3MV8B 5F1OB 4NM4H 3PGCA 1MOEA 3QR0A 4Y2DB 3RWCA 1AGCA 5C3IA 4D9QE 1NFDA 2ISDA 4AH2B 4IBTA 3RWDB 2OJEA 3MRIB 1BBDH 4JFQA 4KDTC 3N1MC 2ESVB 3OPZH 1UATA 4M6NH 4Q2ZB 1ORQB 1BLIA 2F54B 1QBAA 1X44A 4PGBB 4HK3N 5EOQH 4RGOL 1E4WL 1I8KB 1XGTA 3X3GH 3IMWA 2LU7A 4RX4A 1NCTA 1GZHA 1PG7H 3C5ZB 3SYQA 4X6CE 2H6PA 5SX5K 3NTCH 4E9YA 4M62H 1IM9A 5T3XH 5AVZB 1E4KA 3NIGE 4WJ5B 5FOJA 2D7NA 3FFCD 4MCYA 1E4XH 4KXCA 2EKJA 1RU9H 5JOPD 1NBZB 3LS5L 3NH7L 4ZOCA 2C3WA 2HFEA 1ADQH 3EO9H 4P05A 4XZ4A 5EV7A 3H3PL 4OLYL 4W4NA 5J12C 1AD0B 2R4SL 2E7HA 2Z31A 4NJ9L 3GRBA 2AKRA 1QUNB 4AW7A 1AS6A 3GXPA 2WKLA 1I9RL 3JVGC 3FUJA 4NQED 2VDML 4JZNA 4NWTH 1FA4A 2B4CH 5A6MA 2EYRA 5E0QA 3IFLH 5DRWB 3GBDA 1FL6B 1U8KB 2DWDB 2I60H 3L16A 4H1LG 1S6NA 4LHUA 4YDLC 3TEWA 2DMHA 2P49B 2AJZB 5CZVH 4OZFH 1DBKL 3SQOL 4P2RE 4TUOB 2CIKB 4FXTA 5AB2A 1O6SA 3UO8B 1YEFH 1N6QL 4IRSD 2PXYA 4JFDA 5EF1A 1BYOA 1XGYL 1FNGB 4D9LH 3KL5A 2XQYK 4OD1H 4XRCB 2D03L 3L4TA 4LDCA 3FT4B 4P5MA 3BXNB 2B1AL 1QNZL 4PG9B 4G6MH 3UDWA 2ZSVA 2ZXEB 5GXBB 2ZXBA 5DFVD 5KTEL 2VE6B 1FAIH 2IQ9H 4NBZB 5E4EB 3ULVE 4WUUB 3PDGA 4XHJC 2XLLA 3WJMA 5EA0L 3KLLA 2IPKA 2CWRA 4RQQA 2FJHA 2CDGB 2YA1A 3DROA 4AEIH 2EVFA 2WKOF 3GIVB 2DQCL 2B9BA 3MV7E 1BFVH 3KD4A 4OQTA 4PTUA 4WDIB 1NCIA 2LFEA 4MJID 3SY0B 2FJGA 1GGBL 3MCYA 1JV5B 2F1AA 2G3MA 2Y5TA 5DHEA 1NOFA 1UYWH 4XMLH 3IS1X 5ICXA 3SDXA 3TBSA 3IVKA 1VKXA 2QR0A 1F45A 4JFVA 2JKWA 3I02B 3NOIA 4KGLA 3ZMRA 4FABH 4WO0A 1YPZB 4NYLB 3DX4A 3Q5OA 2NXZB 3ROLB 2AP2A 4BFIA 2CCLA 2ODHA 4R97B 3TYGL 1HILB 5BZZA 3WY1A 3C09C 2L7QA 3F7RA 3JZ7A 1O7DE 4G8FB 3GKWL 3O0LA 3WJLA 4I2XB 3KLAB 1A7RL 4ENEC 3CPLB 5AAWA 3NMEA 5D2NA 3D6GA 3EYQC 2HRHA 3QORC 1P5UC 1QWNA 4WNQB 4O5LH 3AXHA 3OGCB 4LCWD 1G7QA 5ACLA 1S7VB 1I8UA 2RJMA 4LP4A 4U1NA 1PF3A 2L04A 4HXBH 4FTDA 4QRTA 5IOPA 4ZFOL 1X4XA 3CH8A 1C5DB 2X9ZA 5FO8A 4GG6E 3WEXB 4LVEA 4WK2B 2B0SL 1Q0YL 1QPXA 4IOIB 1EAOA 4F1ZA 1BEYH 2Z7UA 3AU1A 4UQ2A 3O3UN 1GOGA 2BXZA 4J3SA 4TPRL 4K73A 3PDOB 2X4RA 2FO1A 4PS7A 3QULB 4N0UB 1IGYA 3BEWB 1TMCB 4DHLA 1KTCA 2E56A 2HX8A 2DLFH 4FX5A 2K45A 3MQIA 1SDDA 2YXWA 4WSJA 5L8JB 3H7BA 3L1OH 5LBSA 3NP3A 4PJAB 3MLSH 4G8IB 5I1CL 1T2QL 3CIAA 3CBKB 3Q5YA