2FJSA

Crystal structure of anaerobically reduced wild type nitrite reductase from a. faecalis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Effect of the methionine ligand on the reorganization energy of the type-1 copper site of nitrite reductase.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 88
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2006-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fjsA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fjsA02
1OCRB 2DYSB 1MG3C 5LDUA 1J5CA 3ERXA 1IBYA 4DP2X 1CYXA 1T5KA 3GXUB 3S3CB 3NJMA 4AI7A 4F7KA 3EH3B 2PP9A 2I85A 3NYKA 4K9JA 3T6ZA 3DTUB 1L9SA 1GS8A 2MTAA 1TKWA 4A2EA 4E9WA 3L45A 2IH9A 5F7BA 1JZIA 3SBPA 4P5SA 2HX7A 3UADA 4FAAB 3NP3A 4ENZA 2IDFA 2HXAA 3AZUA 2BW5A 5I28A 2FNWA 4X4KA 3FQ1A 1ZIBA 1PZAA 3N55A 4GP4B 4HIPA 3ABKB 5E9NA 2ZWNA 1ADWA 3TA4D 3JT2A 4YSRA 4F2FA 1A4CA 3UABA 2GC4C 1PLCA 5I26A 4BWWA 2CAKA 4Q8BA 3TBBA 2YAMA 1ET7A 3V9CA 1ET8A 1X9UA 2FTAA 1AG0A 3SBQA 4GXFA 3GDCA 2R7EA 1JXFA 5D4IA 1L9OA 1KYAA 4ZK8A 3X2QB 2YAEA 4HCFA 4M3HA 3QJUB 1NIEA 4NERA 2Y69B 2JXMA 1HAWA 1A3ZA 4UANA 1CUOA 1RKRA 3NJGA 2FWLB 1NDTA 2B08A 1ZDSA 2TSAA 3CZUB 2YAFA 5D4JA 2IAAC 4YSTA 5I6KA 3IBOA 1E5ZA 2FQEA 2TSBA 1TEFA 4YVNA 2LLNA 5ANHA 2AFNA 4AKPA 1W6WA 2AZAA 1NICA 4G7RB 3OMNB 4E9RA 3WNJA 4YSSA 1CURA 2XVBA 5IY5B 1NTDA 1AS6A 2DWSA 4AZUA 1AZNA 1JOIA 2DWTA 3FYIB 1ET5A 1WA1X 1WS8A 1L9RA 1BQKA 1JVOA 1OCCB 2Q5BA 2ZOOA 2BP8B 2PP8A 1A65A 2QPEB 2YXVA 3FQ2A 4W9ZA 5PAZA 2IWKA 1J9SA 2XXGA 4DPAX 2PPAA 1MZYA 2FT8A 5EHFA 2FQFA 1AIZA 1FFTB 1UATA 1NIAA 3PAUA 4JKNA 2B3IA 4HZ1A 4HCGA 1BXUA 3GYRA 1NWOA 4G72B 3C75A 4E9VA 4A67A 2H5UA 1OE2A 2EIKB 4A66A 1ASQA 4GY4A 2UX7A 3QPKA 3WG7B 3NJFA 4DP4X 3DIVA 1V55B 1ASPA 1WA0X 2YAQA 5AZUA 1GS6X 1KCWA 2HZHA 1GYCA 2VW6A 1AZBA 2AVFA 3T6VA 1L9QA 2XX0A 3FS9A 2QDWA 4AKQA 1QLEB 2DV6A 3G5WA 4YVUA 4YSOA 3ABMB 1JXDA 3FSVA 3T9WA 1HFUA 2R7EB 3X1EA 1GY1A 5FC9A 1PY0A 1EHKB 1IUZA 2MRYA 3ASNB 5B7EA 2QPDB 3T6XA 3UGEA 2GSMB 1JVLA 1V10A 2DY2A 1FA4A 2YAPA 1SNRA 1TEGA 1QHQA 2XXFA 3QJTB 1BQRA 2CCWA 3NSFA 3NSCA 1AG6A 2YXWA 1PLAA 1GR7A 2OCCB 2BO0A 2IDSA 2I7OA 4N8UA 3H56A 1AS8A 3PLYA 3AG3B 5B7FA 1SF5A 3WIAA 3TASA 4UAHA 3WNIA 1PAZA 2AZUA 1BQ5A 2VSMB 3NJKA 4QKTA 3ZBMA 1N70A 4G7SB 1KBVA 4DPBX 7PAZA 1WA2X 2BZCA 2EIJB 2VM4A 3FU9A 4A2FA 9PCYA 2GC7C 4AKOA 4DP6X 1WS7A 1QNIA 2HX8A 1J9TA 1NPNA 2PPFA 3X1GA 4NB7A 5I6MA 1IC0A 1L9PA 4BWUA 1EZLA 1B3IA 4BWTA 4E9TA 1AR1B 1KGYE 3MX0B 2XV3A 3H4HA 4KO9A 1J9QA 4A2HA 2HX9A 5B3SB 3FPYA 1PZCA 4L0PB 4E9YA 3NP4A 2IH8A 3ASOB 3IE9A 3QJRB 3QQXA 4EF3A 1MZZA 2NRDA 2P80A 3HB3B 1ILSA 2UX6A 3T6WA 2OJ1A 3WKQA 4PAZA 1JERA 2CALA 1NIBA 1ETJA 2CBPA 3ABGA 3OQRA 2PLTA 1NIFA 1NPJA 3AW5A 2BP0B 3AG2B 3CVBA 4YL4A 4DP1X 1XB3A 3OMIB 2WO3B 2GIMA 3X1FA 5AFAA 3FU8A 3PAVA 3FSWA 4E9QA 1X9RA 2RACA 3FYEB 4HHWA 2JFCA 3NSYA 4P5RA 2J5WA 1R1CA 4YSCA 1DZ0A 5I5MA 4YSAA 1JZHA 1W6LA 2IWEA 3FSAA 3RYMA 2VMJA 6PCYA 1DYZA 3EH5B 3CG8A 2XLLA 1PCSA 4HAKA 1SFDA 1W8EA 2UXVA 1CYWA 1PZBA 2PPCA 1F56A 1BYPA 2PCYA 5I6LA 3D12B 3BQVA 4YSPA 2UXFA 2BWIA 3H4FA 3N2JA 4YSDA 4GP8B 1NZRA 1ILUA 2BZ7A 1I53A 3TU6A 1XB8A 1AZRA 3NJNA 2BP0A 4DP5X 2IDQA 2EILB 1BEXA 3HEIB 1JZEA 2J57A 1XMEB 1PNCA 1HAUA 2A3TA 1JXGA 1AQ8A 2HLEB 1M57B 5A7EA 1XB6A 1E65A 3AG1B 4Q89A 3S8GB 3X1NA 3NJIA 2XX1A 2Y1AA 3IN2A 1SDDA 3S3BB 1YLBB 5I6NA 1E30A 1RZQA 4KO5A 1V54B 3KW7A 4N4YB 2H3XC 3OD3A 1SHXA 2GI0A 4A2GA 2VW7A 4GYBA 4KNSA 5AKRA 2OV0A 3DKHA 2VSKB 2FT7A 3FT0A 3MBWB 2VN3A 1M9WA 1NIDA 2YQBA 5I5JA 3X1BA 3QJSB 4GP5B 1PLBA 4HALA 1A4BA 1ID2A 4A2DA 2AANA 5B1KA 1OCZB 4DP0X 2FQGA 3ZX1A 4MFHA 4PCYA 4CSPA 2JKWA 2H47C 4BK5C 2BW4A 1RCYA 3AY2A 3FU7A 5B1AB 2PPDA 4G70B 5B1BB 2I7SA 2YAHA 1AAJA 4TXVB 3CDZA 1AS7A 3AG4B 4RH4A 2WO2B 4KO6A 4QLWA 1IBZA 8PAZA 3U25A 1JZJA 5I6PA 1PMYA 1OV8A 2FT6A 2QT6A 1WAEA 2WSDA 4WTQA 1BXVA 3ABLB 4BXVA 1ZIAA 1SHWA 4YSUA 1KCBA 1OE1A 4BXSV 2UXTA 1AOZA 1OF0A 2FJSA 2HRGA 1JZFA 1AACA 2ZXWB 3IN0A 1BXAA 4UF7C 4A68A 1GW0A 3IEAA 2IDTA 4KOBA 1NINA 3V9EA 7PCYA 4AX3A 4E9XA 3KW8A 2PPEA 4M4RB 4DP8X 3PXLA 3S3DB 1GS7A 2J55A 1SFHA 4KNTA 2XV0A 3S8FB 2J56A 1OOWA 2UXGA 2VM3A 3FQYA 3UAEA 5PCYA 2CUAA 5TK2A 2Q9OA 1M56B 2N0MA 1ZDQA 1AANA 3PCYA 3OMAB 3NJLA 4DPCX 1PNDA 1A4AA 1KDJA 1VLXA 1BAWA 2GHZA 1CC3A 6PAZA 5I6OA 1ZPUA 4F2EA 5D4HA 2VW4A 2XWZA 2GBAA 3CVCA 4JHUA 5B1JC 1KDIA 1A8ZA 2IDUA 1SDDB 3BVDB 3NJJA 3NT0A 2GB2A 3TBCA 3OM3B 4DP9X 1URIA 3FPXA 2EINB 2CJ3A 2X87A 1AZUA 2BHFA 4BDVB 2W8CA 1J9RA 1GSKA 3FSZA 4YSQA 3SQRA 2XUWA 1OE3A 3QJVB 4YSEA 1SJMA 2E86A 3PPSA 4KO7A 4FA7B 1ASOA 2YAOA 1PF3A 2EIMB 5TK4A 3NJHA 1RZPA 3NSDA 4JHVA 2IWFA 3UACA 3EF4A 3ZDWA 2XU9A 1E5YA 2P80D 4HHGA 4E9SA 3EHBB 4NAJA 2ZONA 5I5IA 1L9TA 3SBRA 3FU7B 1BYOA 1N68A 1GY2A 2YARA 3QJQB 1ZV2A 3CDZB 2HRHA 3CVDA 1NWPA 2PP7A 1E67A 3JTBA 1IKOP 3UAAA 1FWXA 2XYBA 3WKPA 1SF3A 2DYRB 2FQDA 4CSZA 4G7QB 1MG2C 5B7MA 2QDVA 3ZIYA 3EH4B 1TU2A 4HCIA 3T71A 2W88A 4KNUA 2BWDA 3PAZA 1KV7A 1OCOB 3WI9A 4KOCA 4W1TA 5B1JA 1AZCA 4G71B 1MDAA 2XV2A 5F7AA 1J5DA 4BDVA 1KBWA 2X88A 2PCFA 4WKXA 1JZGA 4DP7X 2BP8A
chains in the Genus database with same CATH superfamily
3V6OA 1CE6A 2EH7H 1YNTB 4U1NA 2X4UB 2HVKB 2GAZB 1EAPA 1FL3A 1W8OA 4WUUB 5IMMA 3IDJA 3QEQE 2O1AA 4TUKH 5DQ9A 3KPSA 2IXQA 4ZUUB 1XBDA 1RZJH 2Z92A 2FJGA 3H7BB 3L3HA 3KNBA 3RDTA 2MTAA 4TPRL 2ZJSH 2F19L 4NT6B 4OVUA 5F7BA 1QFWL 5D4QA 5IJDC 1XF5B 3KXFA 3HCVB 4OZHA 2R1WA 3NP3A 5L0QB 1MW2A 4U7KA 1H3WM 1Z3GL 1JD9A 1PTZA 3K7UA 1OTSC 2X5PA 3GSQA 3FU3A 2Z1PA 3FUJA 4ZMNA 3MRQB 1WIUA 4XCNA 2Z4TA 4KMQA 1ZGLP 3SCMA 3BIBX 1UADC 3HNTH 3AWFA 5HBBA 3VX1A 1P5UB 1KSRA 3ZPDA 5HJDA 1BZ7B 1QSFB 1YCSA 2QKSA 1RPKA 5CJOH 4XHJD 2WTRB 2CUMA 2GC4C 3RPKA 1MNNA 4HBCH 3HC0A 25C8H 3PGCB 5DJAB 3EYQD 2HRLA 5IHUH 5D1ZD 1D7BA 1KEGL 1EFQA 1B4JL 1ZT1B 4Q8BA 3FTXA 4PJ9A 5DJDA 1OF2A 4NEHB 1A7PL 4XC3H 1M1XB 3HHMA 3ZL2A 4L8BB 1DL7H 1KENH 2X4RB 4GXFA 4XP1H 2J6EH 4QRPD 4RAVB 3EYSH 4K94H 4ZTPL 3GMOA 3B9VA 4UTAL 2P7TB 3W0WE 3P9WB 2YRLA 1YEKH 3DMMC 4GJTB 3CQPA 3KR3L 5CKAA 5KVFL 3AABA 3B3IB 4NO5B 5HHXH 2W59A 1WFJA 3VI3E 3FDWA 3ARFC 4HWEH 1CS6A 2GSIB 4EI5D 4GT0A 5ESQB 5HYQA 2Q8BL 1P6WA 1A6ZB 2QEJA 3FNKA 1OB0A 4ZUSA 1TEFA 1X5HA 4JPKH 4J3XA 4YVNA 4LSPH 4H8UA 4MKTA 1U36A 5GGRA 1W6WA 5F0MB 4ATTA 1O75A 3IPBA 1T80A 1KG0A 5JUEH 3SYAA 4AZUA 3OJDB 4DN4H 3FTGA 4R7DB 2OJZL 1CXKA 4U0RB 1HI6B 3ECQA 1FSKB 2EYRB 1G9HA 4KI5E 2ZOOA 4I88A 2BP8B 2QPEB 4FQLH 5IBTH 2WWKT 3TA3D 4OZ4A 5KBMA 4MCZA 1KN4L 1FYTE 1J9SA 3QR0A 5AKVA 5CWSB 5JHDB 1PKQB 3UPRA 1KIRB 1KOAA 2GEEA 2NY7L 4NRXA 1DFBL 1H6TA 3R0MA 3BAEH 4PW4A 1URLA 4J7RA 1OAZL 1BVLB 4S1RL 1MCQA 4X6DB 5DO2D 3SKOA 1ZANH 2CHZA 4R2GB 3DMMA 4ZS7L 3N06B 4PRDA 3MRLB 2X6CA 2B3IA 2VUOA 3BUYB 3K6FA 3N9GL 2LU5A 4J3OG 5BUPA 4LP8A 4G59C 3T4AC 1FJ1B 3CJJA 1WIPA 2ENJA 1CGTA 1I9EA 1KCLA 3DIVA 4J28A 1TJXA 4QF1B 1H3XA 3STBA 1GS6X 4UZGA 3CFEA 1TXKA 3VWKD 4NQDB 1GZQA 3FRPG 4LSSL 3KJ4C 4E42B 1X5LA 2NY5C 4J4PA 5D55A 2H32A 3IDNB 1VZIA 1KGCD 2DDQH 1XF1A 3BEWB 3W56A 2H1LM 5IQ7H 1NUNB 1WZKA 4IOSD 4KZDL 2EXTA 5EO0B 1B0GB 2MRYA 4NKOA 3ZYJA 1LE5A 1GTFA 1JPGA 4BFIB 1I3GL 2CM5A 4CUCA 2RHEA 6FABH 2JWYA 4K8RD 4BCZA 2XIDA 1AG6A 1ZHLB 2WLJA 2K8MA 2YQ3A 3TS8A 5LO7A 1IC7H 2CLZA 4A7GF 2WZPD 4HUXB 5JHLH 2IQAB 4TSAH 3MCYA 3MRNA 4Q6IA 4HWZB 3MXWH 5D2LF 3HS9A 1IM3D 1A6AB 1UA7A 3UP1A 2WMPB 4XWGH 5D9SA 3N1PC 5FGRA 3WY2A 5I18L 3TJEH 1UZ6F 3PDDA 1QNIA 3H42H 4XBEL 2K9UA 4ISVA 4KUCD 5D2NE 2BSEA 2Q1EA 4HXBH 5K1VA 1ZLSH 1OALA 4GFTB 4WEMB 2KPNA 5FHBH 3X1GA 1ACZA 5I6MA 4UNTA 3BP6B 2XQYK 2P8MB 1WFOA 4M1GH 3LKPA 4E9TA 1QWNA 5DEGB 4PJ5E 4KC3B 3TWCH 3VFUA 4A55A 5I1IH 4AIEA 2NDFA 3CDGB 3Q2CA 2V9QA 4MDIA 2L0DA 1SLUA 5F9OH 2AJVL 2VMEA 3MA7B 3QQXA 1CFVL 3QK0A 4L3FA 4XPAH 3WIHA 2JK5A 3RILA 3ENEA 3U30B 4NN6B 2VABA 3ORJA 2JI3A 1PX3A 3ABGA 5CZRA 1FFOA 4HKBA 3D1MC 1SLXA 5GS1B 1PZ3A 2L7JA 4PS7A 2Z4QB 1KCSH 1TO5A 4JKMA 1RZIB 3LS5L 3V0VA 1XB3A 3GXIA 3D34A 4FQHB 3QNZA 4JDEB 1U8MB 3RPBA 2BDNH 2DKUA 4MA1B 3AFLA 4EZMA 4JG9A 4I13B 1R1CA 1JIBA 2FH6A 3OTTA 2OZ4A 1CGWA 5L8KB 3DGCR 3LRSB 3QHZL 2GPZA 3ZHLA 4D94A 1CFSA 3G5ZA 1NANH 4KTEL 4OLUL 1YEJL 5D7LB 1S9XA 4P4RA 2ADJB 1RZKC 2H1PL 4K23L 4Q74A 4L0YA 4OCSL 1F0LA 3VACA 3EH2A 5LN4A 3DX8B 4TLUA 1CYWA 3SDYH 4NQEB 2JNZA 3REVA 3ZRFC 3DURB 1DLHB 1U8QA 3GSRB 4PRBB 2OMZB 3QIWC 4ZAKA 2NW2B 3LQMA 4JO3H 2D0FA 2VXQL 2ZUQC 4FLSA 4O51A 4Y9GA 3SBWC 3HW7A 4YSDA 4LLUB 1QEWA 2F1AA 4KQ0A 3S8WA 5JXEC 4PJAE 2FUQA 3E0GA 2E8YA 2BP0A 5IB2B 1I85C 1BX2A 3EJCA 1T1ZB 1WITA 4FQCH 1TT6A 1U8JB 1Y18B 1INDL 4X0KA 4HWBL 2ZOUA 4K71C 5MEQB 2VDPH 2CR0A 1J8HD 1A1NB 43C9A 1BWWA 1FBIH 4N0UB 4JQIL 5AG9A 2O5XL 3FQRB 4NI6A 2Y1AA 3OKDB 3KPRD 3AWGA 1B90A 5I1HH 1AQMA 3E2HB 3O3UN 2CIKB 6TAAA 1RUAH 4UIMB 1BSIA 3TEZA 1VACB 2FB4L 2AXGA 3DLQR 1PQZB 1A6WH 5AKRA 1Q38A 4NBYB 1LGVA 4ZW8A 1W91A 1I31A 1IAMA 4G5ZH 5HDBF 2QQNL 2L04A 3O3DA 1CL7H 2AXFA 5FOBB 3QAZC 4AQ8C 2WLHA 3NCMA 4KROB 1TZIA 5AD0B 1S7UB 4TTDD 4XZUA 3OPUA 4N0RA 3ZSSA 1LP9A 3SBWA 1GYAA 2R83A 1DSYA 4GFXA 4GW1A 5JXEA 5EU5A 2ICWI 3SSGA 1R34A 4G3YL 1G6RB 1PSKL 4ZSOE 1KXQE 5CUSL 3D69A 4ODTH 5EO9B 1AAJA 4X98B 3VYOA 3RFZB 1SJEA 3VFTA 3F6IA 3PWJB 5JIDA 1TJHL 1OSZB 3C6EA 2BVYA 2WO2B 4GO6B 4G42A 3QUXD 1YZZA 4W81A 5GJSL 5INCB 3V7AG 5EU4A 5I6PA 2IH1A 2WTOA 3U0WL 3V4LA 3FB8A 1CK0H 1LHZA 2F53E 4ERSH 5KSAC 2KZWA 5CR1A 4QIRA 3BKJH 4CMMB 3OX8A 4NUPA 1A7NH 5KBLA 2OR8A 3TLRA 4KUZH 4GQRA 1JHKH 3D25B 3G5VA 3MCKB 3E38A 4JY6A 4QRRA 1XSKA 2J8UE 4XI5D 3IETB 4PMEA 1YNTA 2HVKA 4A68A 4JE4B 2EDRA 2GAZA 1F8TH 4KY1L 4F33B 4WUUA 5EIVA 3BFQG 3GINA 1KCUL 4RGOL 2IOOA 5AWNL 1WSST 3H7BA 4CBZA 2LAGB 3RHWK 3TTYA 1K85A 4MZIA 3ETSA 3HS0B 4NT6A 4ZOBA 2DMHA 2CUAA 1XF5A 4KH9A 3HCVA 5GRZA 5I9QB 1RP9A 4TYUA 1REIA 1AI1H 1XH0A 4YHLL 4XP5H 5D4HA 5TH2B 1G6RL 1NC2B 4IHOB 3PIQB 4JFFB 1FNEA 5B1JC 3PP4L 4KZEH 4HFUL 5EWIH 4WU5B 4Z0BH 4LAJH 4DGVL 4F8OA 4OLVH 2H32H 2PW1B 5C0NC 3N41F 1MF2H 2XOTA 1BZ7A 2ROXA 3WTUA 2EDMA 2X87A 3VFMB 4HOMA 5KSAA 2WTRA 5GZNC 5DJAA 4ODSH 4XTRC 2XBDA 3FSZA 3KYKL 4ANWA 5A2LH 1ZT1A 5C0BE 1A1OB 3RVUC 3QJVB 1NBYB 1QRNE 4P2QD 5KWYC 1BEYH 4M7JH 1M1XA 1ECYA 5IQ9B 2X4RA 3KVPA 2EIMB 4OBSA 1JAEA 4RAVA 4LVOB 4HU8A 4Y2LA 3EF4A 4MA3B 1VESA 3KEDA 3O41B 2WBJC 1H8LA 1IGCL 2XVGA 3FFCD 3Q48A 3TO4C 1IE4A 3B3IA 4NO5A 2R0LH 1FNSH 3ULVL 5HYFA 1GY2A 1MFAH 3OAUH 4PJIB 2YGVA 3DXAE 3IK2A 3NIFE 2D9QB 4PJXB 5I1CL 4OGXH 1P5VB 2PUQT 5MENE 1QPPA 4HISA 5ESQA 1SF3A 2NXZD 3QQ4B 3ZTDC 1NEUA 3V79C 4BK4A 5TE7H 3LXCA 1P4LB 2LLGA 1NOLA 3MOBL 2O6FA 3C6LD 2D7TH 3MV9D 5CFHA 4HIXH 3K71A 5B1JA 2PO6B 3EH1A 3QNFA 3U6RB 2K1MA 3OJDA 4PB9L 3UBHA 2F08A 4G71B 1U2YA 4R7DA 4DH2A 4ZNEE 4K3GA 4C56D 1E8WA 4BHUA 3ZKMC 2EYRA 3NCFB 4YL9A 1AR2A 4LOVA 2BP8A 5DD6B 4M1DL 5GZNA 2ZOKB 4BA8A 5HI3C 2ZP8A 2VLME 3WFHB 3EOTH 1T5KA 2FD6L 2NY6C 3BGMB 3MDJA 1I7RB 3GXNA 5CWSA 5JHDA 1PKQA 3DWTA 1KIRA 4PGJA 2WYZA 3VDBA 4JRXD 2PP9A 1UWXH 2GIYA 2P5WE 4XXDB 4RISL 1BVLA 3QDHA 4X6DA 4YGVB 4B9JA 1R0AH 3SBPA 4N2BA 5EG6C 4YDVB 1YPZA 3MRLA 5T1MB 2HX7A 3BUYA 4P2YA 1E6OL 4WFHD 4XVSL 5GPRA 1FJ1A 1LO4L 4KKAD 4QHNA 1F41A 5EEYA 5E94B 1OGPA 5E9NA 1OEZW 1KBPA 4PJHF 3RTLA 3U1PA 3UTSE 4BSVA 5GGVL 3RRQA 4NQXB 2L7EA 4QF1A 2NDGA 3NCYS 1SN5A 1A6UL 3RBGA 2OZ4H 4H1LA 3QHTC 3ZQWA 2VZOA 4NQDA 3KGUA 3FUNA 3U36B 1SXSA 4E42A 4IJTA 3T0ED 3GZQA 1UVQB 3IDNA 1AO7D 5FGSA 4DGYL 1TSHA 2YGPA 5KG9B 3BEWA 2K8QA 5FEBA 3BRGC 3TT3H 1FLRL 1B0GA 2R1XB 2FLBT 3CHPA 3P77B 1FE8L 5K9QI 2FRGP 3K4AA 4L9LC 2DWYA 1A3ZA 2XY1A 4QXGH 4BFIA 4TVPH 1GAFH 3NJGA 5JORA 5KZCD 3TL5A 4JZJC 1T7WA 3HI6L 5F9JB 1FORH 4MXQC 2EDNA 3WTXA 1IGTB 4NZUH 1VEPA 1ZHLA 2GKIA 3INUL 4PRPD 4XZ4A 5C7ZA 2WNWA 4H88L 5GS1C 1ACYL 4P5TD 3SJVB 5FDWA 4K7PL 1TU2B 3N42F 4HUXA 3TEUA 1LDSA 2IQAA 3EJTA 2JELH 4YSSA 4HWZA 3BSZH 3R1GL 1KJ3L 1A6AA 3DJ9A 1G5AA 3RL2A 2IBZY 1KGIA 2WMPA 3MODL 4DETA 3P0YH 2WSKA 3ZTEA 4BH7B 4GQPH 1JVOA 1AZZC 1EEQA 3EKCA 1SM3L 3IKCA 4X7EC 5E1HB 5FA4B 4AQZA 4JRFA 4BQ6A 3UYRL 1WAAA 1NGYB 2IWKA 3BP6A 1Z2KA 2P8MA 4OU3A 4ADGA 1M42A 3C08L 1XZ0B 3ISYA 3W9EB 3GTTA 1U8KB 2GCYB 2UV3A 5DEGA 3U46B 4B50A 2P8LB 3LNIA 4FMVA 4RMSA 1MWOA 1OAUL 3CDGA 4XRCA 1NBQA 4TPRH 4HG4J 2F19H 2V8MA 1QFWH 3OSVA 1QFUL 1VGKB 3VXRD 1BHGA 3MA7A 5T3XD 1Z3GH 3HR6A 4A66A 2EIKB 4WFFE 2CO1A 2HG5B 1G7JB 2UX7A 4HWBA 4KFZC 4X5XB 4OD1L 5GS1A 1GGTA 3K71B 3ROLB 1PYWB 3NSJA 1CFTB 1RZIA 5T5NG 4JQIA 4FQHA 2H41A 3WEBA 4JDEA 1I3VA 4UWQB 2Z7YA 1YSOA 2UVEA 4RWYL 1B4JH 4GKOA 1A7PH 2ARJQ 2BNUB 4HAGA 4YBLB 3O8XC 3E2HC 5FC9A 3QPXL 5FWQA 5D7LA 3PG2A 2F7OA 2X4QB 2XN2A 3CBJB 2ADJA 4UTAH 2ZE0A 3KR3H 3T2OA 5KVFH 5IW3A 3U1SL 4NQEA 3NDYE 3DURA 1DLHA 4PRBA 2OMZA 4CVWA 2E46A 4L23A 3K0WA 2NW2A 4LLVB 3D0LB 2IDSA 2I7OA 5ECGA 5B7FA 2Q8BH 3WY3A 3D8MA 2CKNA 4LLUA 4E41D 4UQEA 1X6NA 3JWNH 4PEEA 1JWSB 2GUOB 3BUBA 3ARFD 5IB2A 3LRGA 3OQ3B 1T1ZA 4GBXC 5IZ7A 5BOJA 2WQWA 4NP4L 1Y18A 1AMYA 4XVOA 1F97A 2OJZH 5MEQA 4POZD 2J7LA 4NUMA 4RBPK 4KXAA 4AGQA 3BQUB 3C8KB 1A1NA 4ZW3A 3FO2B 2ZX7A 1HOCB 2CJSA 4N0UA 1G9NL 1YQVL 2UYLB 2YR3A 3MJ8B 1KN4H 4NLHA 1UD8A 4Y9EA 2F68X 5HHOB 3OKDA 3IFNH 3LRKA 3O0RL 3ME0B 3QZBA 3SPIA 4AQOA 1EHLL 2W9LA 2DMGA 2NY7H 3N0PB 1DFBH 4QT5A 4UIMA 3OKOB 1OAZH 1VACA 3S2AA 4S1RH 2XIIA 1DSWA 1PQZA 4F5CE 3D3VD 4ZS7H 2CO3A 3QUYC 3N9GH 3WMQA 3F5WB 4GMSL 1MI5B 4ZZFA 4PG2A 1R3IL 3MNVB 1IGJB 5HGDB 1G1OA 5C9KA 3LIUA 3MMEA 2NRDA 2EDLA 2B1HH 4PBXA 5AVXB 5FOBA 3U9UB 4FKEA 1NLDL 1MCNA 4F7MA 5IJBC 1A9VA 2CALA 1NIBA 2CBPA 5AD0A 2APVA 4WDIA 5J56B 1XGRA 2XV6B 1S5HB 5BRZD 1NC4D 4ACTA 3ARBC 3H2QA 1J5OL 4AYID 1NCUA 4KK6C 4XBGB 4I18B 4XXCA 2EE6A 3DV6B 3RBSA 2ITDB 2ZF9A 5EO9A 3P4OB 1LTXA 4LSSH 2RACA 2IQ9H 4X98A 2B5IC 3RFZA 4Y9CA 2JFCA 3PWJA 3QFJE 3MJ9A 1I8KB 2K78A 1I7ZB 4AEHL 4YSCA 2FSDA 4M00A 5INCA 4X6BB 3BWAB 5CBAA 4QTIL 4KZDH 1BFOB 4ZUVB 2I9TB 1EPFA 1JZHA 1VB9A 1W80A 2F5BL 4QXWA 3ATAA 3C6SB 1J8KA 2X9XA 2DQIL 4FFZL 4JLRA 1N10A 3WV0A 2P8PB 1BJMA 2H0EA 1IGIL 1OP3K 2UXVA 3UIYA 1T66D 4DJMA 1I3GH 4N1CA 3QG6B 4MXWL 3B8SA 2B0SL 3D25A 3MCKA 5BZDB 2Q7NA 4W6WB 2X0WA 4YSPA 2DQEL 3GBNL 1AD0B 3U83A 4LVOC 3QUYA 5IVXF 4GSRA 3ZZ1A 4GP8B 1I53A 1EVTC 5EORL 2ESVA 3A6CL 4ZOEA 3MLYL 2J57A 1ZA3A 3SPJA 1MCEA 1ORQA 4AGPA 5LKNA 2H3KA 3V4UL 4JJHA 1UASA 3VO0A 2X0VA 4XBEH 3AG1B 4Q89A 3UEZA 1XD1A 4WI5A 2GQHA 2NUPB 3DARA 4JFWA 1IAIL 1ZTXE 2R2BB 2YWZA 1NC2A 5E51A 5TH2A 4OGAC 4IHOA 3DI2B 3PIQA 2LTQB 2Z31C 4R84A 3B6SB 4WU5A 4OUOA 5C08D 4JQVC 4UDUB 1YLBB 4Z3IA 2PW1A 2L3BA 2P49B 3QI9C 3CFJA 3H7LA 3VFMA 1BLNB 5JMRA 4G9FE 3EJUA 1EO8L 5CP3H 1JK8B 3K0YA 4HS8L 3ZKQD 5CCKL 4Z5RB 1A1OA 2IO5A 1DVFB 1NBYA 4MNQB 2AJVH 3I9IA 1CFVH 1KY6A 1Q9OB 3U46A 1MHEB 2K7PA 4NIYE 4PWGA 1R6VA 4JUTA 1HXYB 4MA3A 2IG2H 4OV5B 2C1OB 4Z7VB 3ZX1A 3RNQB 4MNGB 2JKWA 1FH5H 3LS5H 2F1EA 1KCRL 5E8NB 1LEGB 1XO8A 1GXEA 1ZV9A 2G3NA 4PJIA 4OCRL 5FCSH 5FYLE 1PG7L 4PJXA 1P5VA 3P3YA 5I19L 1TQSA 5L9DL 1AGCA 3QQ4A 2BZDA 3LMJL 3QHZH 2FBOJ 1P4LA 1MJJB 1X7SA 1MVUB 4OLUH 1YEJH 4FCHA 3F7PC 2DICA 1BXVA 2R69A 5JW5B 2H1PH 1SHWA 4JQVA 3U6RA 2GJPA 4K23H 4XVJL 3ZHFA 1OE1A 4H44C 4PRHB 1OGSA 4JN2B 1INQA 2FJSA 3ZDXE 3LNEA 5FUOH 5DD6A 2ZOKA 2QVKA 3WFHA 3GM8A 1F1GA 3OKEB 2XN9B 2VXQH 1N12A 3K3QA 2XFXA 3RWJB 3RX8A 3BGMA 1I7RA 2FBRA 3DIDA 2YPLE 3GTVA 2A38A 3CC1A 4PVMA 4AH2B 3AVEA 4N87A 3E9TA 2QADD 3QIWD 2XTSA 3VQMA 1T6BX 4XXDA 3MN8A 4YGVA 1BLIA 4YDVA 2PCXA 3CQFA 1INDH 5T1MA 4HWBH 4D9QE 1HSBB 1PNDA 3DX9B 3ZDYF 3W3BA 4JDZB 3VGEA 3FAXA 3LCYA 3AB0B 1VZGA 6PAZA 1X7QB 1WZAA 4GI9A 2WCGA 2J5LB 4K9EC 2O5XH 1MWAB 1ZK9A 5E94A 4FXKB 1KIUB 5CGYC 3WN6A 4MDRA 2OMTA 1FP5A 3BGFB 3GJFK 4NQXA 5L88L 5IQMA 2UUDH 3LEYL 1UKSA 3VWJB 1AZUA 1GMEA 3QEQB 2Y06H 4OZIF 2FB4H 2WXGA 3MOAL 1PFOA 1RD6A 2B2XH 3U36A 3ESMA 3IF1A 4N8VG 2WBWB 3GEFA 1UVQA 3FXIC 5E8DL 4M3JA 5KG9A 2Q2LA 3VGAB 2QQNH 2CD0A 2CRYA 2V9UA 4BCYA 1H3TA 1OSPL 1WISA 3JZ7A 5CO1A 2R1XA 1EAQA 5TTRA 5F7NC 3AGVA 1P7QB 4OQTA 4QGYA 4FG6C 4D9RD 4UIKL 2ALWA 4G3YH 4AL8L 2VLJD 4U6VL 3D2UD 5F9JA 2HRHA 2EADA 1IGTA 4BELD 5DSCB 4L3EE 1D2PA 4H0HB 4Y4HD 1TJHH 4MS6A 1NL0L 4KWUA 2FCBA 2FZ3B 2E6JA 5GJSH 4FMFA 3TJPA 1B2YA 1TU2A 1NCIA 2UZYB 3T71A 3U0WH 1HHIB 4LZKA 4GS7B 4CA4A 1RLBA 2WM0A 3ZN6A 4M62L 2ZX6A 3LSOA 3W0WB 4M7LT 2HKHL 3ARWA 1MAJA 3LKNA 4QHMB 5CKGA 4BH7A 4YBLC 3MNZB 4M1CD 3VG0L 4YFDB 5ABDE 2ZSVB 4DP2X 4K07A 4XCCL 1NGYA 3T2LA 3VI3B 1G5GA 1AYOA 4KY1H 1BQSA 1XZ0A 5ICYB 1EDQA 3W9EA 4C55A 1U8KA 2GCYA 3IXAB 1KCUH 1ULVA 4RGOH 2P8LA 4Y2NA 1ML0A 1GS8A 3GDBA 3ZQ9A 1Z5LB 3WL9B 4KXDA 5GGUB 3QYCA 1NCTA 4LSTH 4AGLA 4Y1AE 1BDYA 2E7MA 3IJEB 5BV7C 4P04A 5E9DD 1FNAA 4JFDD 1VGKA 3MV7E 5CINL 3AZUA 4G8EA 2X7LB 3ZKNC 5L4MA 2HG5A 1G6RH 2J71A 2DMKA 3GHEL 5F7MC 4OIBA 3PP4H 1A6TB 4X5XA 4HFUH 2V5YA 4DGVH 1DSFL 4WQOA 1UURA 1FYTB 1T7ZA 3LKOA 4EXPX 3ROLA 1PYWA 4H5SB 4KHTL 3DIFB 1CFTA 2G5RA 4HUNB 1KULA 4QTHB 1EXGA 3BQUC 2O72A 3NVQA 4J3OH 1B0WA 4KRPC 4J3OF 4CNIB 3WEXB 2V8LA 1W8NA 3KYKH 4Y2DB 3CSFA 5BCAA 3QNYB 1ET8A 4O2FB 3POHA 2HN7B 3BN9D 3QA3B 1G9EA 2BNUA 1X44A 4DPRA 1HT6A 1ROWA 4XTRD 2YAEA 1QLEL 4XPBH 5C3LD 2X4QA 2AQ3A 4F20A 2P44B 1WFMA 4JRYD 3RVUD 3BUTA 3BUQA 3FTUA 1IGCH 4OZGE 1OLLA 1I1FB 4HK3J 4PRAB 1QPKA 3CX5K 1NDTA 4V11A 3ULVH 3N1MC 3FUIA 2UWEE 3ZE2F 2XWXA 4OFDA 3ULVF 4Q9RL 1M3IA 5I1CH 2WBJD 3H53A 4XNBA 4P2OC 3M45A 4LLVA 3M1OA 3D0LA 5C1MB 2QQLH 3SDAC 3SE4C 3TO4D 4KXBA 2VJ0A 3GS0A 4WO4D 1D6VL 2ARJB 3A4FA 4I18C 1JWSA 4BE6A 2GUOA 3MOBH 4G7VL 3IGAB 3TBVB 1KLUB 3A22A 1WFNA 2XWBB 3NN8B 1WS8A 1H19A 2RJMA 4GKZB 2DWDA 4QHLB 2P42B 3BQUA 3C8KA 3FF7A 2WLNA 2M8XA 3FO2A 1HOCA 3CHXA 1EMTL 4FNQA 4M1DH 3P54A 2UYLA 4FQJL 5CLYA 2FD6H 1I4FB 1KN2L 3MJ8A 2PPAA 4P05A 2VLLB 5HHOA 2FQFA 3ME0A 4YWGL 4ZFOL 1AIZA 4ZFGL 3KLHC 5HI3D 1OHQA 1T89A 3OKOA 4RISH 3S88L 1T83C 2QZQA 4M29A 3PAUA 4WWKB 3U4EB 3SYPA 5DMYA 4Z8FL 4I7ZC 2Y23A 3SD5A 4KQ4L 3F5WA 1MI5A 3QEHB 4PJEF 3MNVA 1IGJA 5HGDA 1E6OH 4XVSH 4KDTC 3U9UA 1LO4H 2DBLL 5D2NB 2EC9T 3WEOA 5DWUL 5D7KD 1S5HA 2WLLB 5FYJE 2A6JB 2XICA 4XBGA 3J27A 4I18A 4NOBA 1A6UH 2VW6A 3DV6A 3BSHA 3G6DL 1ODUA 4GLRI 3AUVA 4IM8A 2PWGA 4PJ5B 1IFGA 3EBIA 2ITDA 3I75B 3P4OA 5IFHL 1IBGH 3K5SA 2AJUL 1LD9B 3O3BB 4DGYH 1I7ZA 3Q2VA 1ZHNB 3HHRB 2YPKB 4X6BA 3QDGD 1E8XA 2ZAHA 3BDXA 3CFIC 1BFOA 4R26H 4YDIL 1F3JB 1FLRH 1NMCC 2EDKA 4ZUVA 2I9TA 4Y4FC 4MAYC 3C6SA 2JXMB 2GSMB 1FE8H 5LAXB 2P8PA 3FQNB 1RUPL 4V1DA 2UY7B 1G7IA 3UBXG 1EIBA 3WTVA 2JCCA 3QG6A 5ILTL 5BZDA 2OMVA 1U3ZA 1CLYL 3HI6H 4A7TA 1A5FL 2V17L 2Q2EB 3QEGL 1AD0A 1NEPA 1AS8A 3INUH 2Y7QB 3B9AA 1SF5A 4H88H 4JY5L 5AALA 1NEZA 1ACYH 4Y9BA 4ZD3L 2YA0A 2W92A 2DTML 4K7PH 3NJKA 1TLMA 3ARSA 2XPGB 4MXQD 4NFCA 1H15B 1SOKA 3R1GH 1KJ3H 2JKIS 4WK4B 3RA7L 3ZMNA 3ARDC 3MZGB 3MODH 2G60L 2YLKA 2DQUL 2K3HA 2FGZA 2DL9A 4WV1B 2Y7NA 1SM3H 4I1PA 5E56A 3UYRH 1JGEB 2NUPA 2R2BA 1IC0A 2VUKA 3GSUB 3HE7B 3MOQA 2MCPL 1B3IA 4AUJA 1DO6A 3B6SA 3C08H 4UDUA 5C0AD 2JJTC 2V7NA 2WVVB 4QPEA 4QCIB 2WPGA 3SE6A 4MASA 2NUTB 1BLNA 4MAYA 1OAUH 4PJAB 2B1OA 2DIEA 4LLQB 1JK8A 5I15L 4Z5RA 2EDFA 3LTVA 4MNQA 1QFUH 4F24A 2Z34A 3HB3B 1VKXB 1Q9OA 4Z6AT 3US0A 4JPVL 3N3EA 3OQRA 1HXYA 1TQUA 3EDDA 2HVJB 1MHHB 5CJBA 3CVBA 3AJ7A 4OZFB 3RNQA 4MNGA 4CU7A 1SQMA 4ZX6A 1YYML 5E8NA 3FSWA 2EVHA 1LEGA 3H85A 4YGAB 4M8RA 3L4TA 3ARDA 4ONOA 4MYWB 2HT3C 4RWYH 3VXQA 2TRHA 2E9WA 5HYSG 3HLAA 1KFGA 1PW3A 1LMKA 3QPXH 1MJJA 3MUZ1 5DZ9A 1MVUA 1MQ8A 2VMJA 3N44F 2AAAA 2XVLA 3FCGA 3L3GB 3K1KC 4NO0D 4DHLA 5KVDE 5JW5A 4FQXB 1HH6B 1OP4A 3H0TB 5FGCE 5I74C 5SWZE 1XF2B 2BMKB 3O8XD 4PRHA 4JN2A 5EIQA 3U1SH 3AXHA 2EJ1A 4ZSOB 1E40A 1QOKA 1CBVL 4AC4A 4BUHA 3OKEA 5TF0A 5A6LA 4JZOB 5AAMA 3RWJA 3P3UA 1BV8A 4TS6A 1CTOA 4HMEA 3BVXA 1LL1A 1JS4A 3QUZB 1O6VA 3DGGB 1XGUB 4P06A 2F53B 3N1QC 4HD9A 3A6BL 4NP4H 2ZYIA 1AQ8A 1HSBA 4XN8A 1MCOL 3DX9A 1RQ5A 4JDZA 3ARGB 4DERA 4GBXD 1URZA 1G9NH 2XQ0A 5DQJB 1YQVH 3L95B 4N9OB 3A0OA 2HRPL 4GS7C 3KMDA 4UTBL 1FIGL 2J8UB 2JSFA 1MWAA 4YPJA 4JPSA 4FXKA 3WBDA 3HG1E 3O0RH 4B7LA 1H5BC 4HUVB 1GPOL 3QEQA 2CLRA 3U2SA 4A2GA 1UXMA 2VR6A 4NBXB 2XWTB 4NS0A 1G4RA 2YMOA 4UQ3B 2IANE 4ABVA 2OXGB 5I0VA 2WXRA 4GMSH 4K3DL 2JKRM 1R3IH 1RU9H 3ARTA 4AYMC 5IMLB 1WGVA 1OCWL 2OMNA 4U2ZA 5C2UB 5JDSB 1NLDH 3W2DL 1GGIH 1UXLA 2IGTA 3QE5A 2AANA 3QJFB 4PVLA 4JPWL 3QWNA 3V4VA 3QIBC 1P7QA 2H47C 1NUDA 2IVFC 5B1AB 3FQWB 2Q8AL 4E9LA 4IGBC 2PPDA 3C12A 2XRAL 3FHAA 4Z3EA 1HZKA 1AS7A 3ARBD 3MRPB 3PFQA 3K2MC 3L7FB 2GTWB 4KK6D 3L3KB 4RRPG 4RH4A 5DSCA 4AEHH 3U25A 2CJTA 3DNKA 2FZ3A 4MBOA 5C0BB 5FWRA 5SWSE 4TQPA 1QRNB 2UZYA 4QTIH 1WWCA 4WTQA 2BOBB 2MFNA 3IPFA 4BXVA 2F5BH 1A0QL 1M71B 2DQIH 2DAVA 3MLWL 4FFZH 1LDPL 3GK8L 4W68A 4L1BA 3VXME 4DKEH 1RIVL 5EZIH 2VDOL 1YDPB 1AHWB 1E9QB 1JFQL 1IGIH 1IEBB 4FFWC 5HDRA 3W0WA 1KYUA 4QHMA 3H6AA 5EZPA 4MXWH 2B0SH 3MNZA 5FYKL 4Y16B 2J1ZA 1NAKH 2OR9L 3ARVA 2DQEH 3Q3GA 2BIMA 3GBNH 5MHSD 1PZ2A 3DXAB 3NIFB 4UOW1 3VI3A 3U9PL 1XGPB 4O5LL 5ICYA 5MENB 4TVSa 1XH2A 2HKAA 2O93L 5EORH 4WU7A 3IXAA 5AVYB 1J0KA 1SFHA 4Q4IA 3A6CH 1Z5LA 3WL9A 3MLYH 2JQMA 4H26B 1U8LB 5GGUA 1LXMA 4FTVD 4PJ6A 5FKAB 3V4UH 3IJEA 3RU8L 2NTFB 2APWA 3ECBA 4IGBA 3UH8A 4KKCC 1CI3M 4OCMC 4AQEB 4BZYA 3Q01A 4UINL 2B20A 3V5KB 4W9KC 4TNVF 2X7LA 5IF0A 1IAIH 5CD5C 2IDUA 2VWEE 3DETC 1MRDL 2NYKA 4D7BA 1XT5A 4KVNL 3ZTJG 2X9WA 1FYTA 1QZ1A 4H5SA 3DIFA 1JV5B 2MSPA 3ECUA 1H6UA 4QTHA 4OGAD 5KSBF 1I8MB 2P5WB 1EO8H 4CNIA 1CIUA 4RAHA 4JPIB 4HX1A 4HS8H 5CCKH 4Y2OB 3QNYA 4O2FA 2HN7A 4BQ8A 3QI9D 3QA3A 3IMTA 3GUTB 1BD2B 1WT5A 2AJZB 4ELKB 4GKSB 3UACA 5ERWA 3VXOA 5FO8B 4HHGA 3UX9B 4F92B 1UWXK 3OXRB 2DLGA 1I1FA 3GIZL 4PRAA 3UTSB 3X13A 4J23A 1KCRH 1YEDB 2WWOA 2XWCA 5BPPA 4ZO7A 4NPKA 2CJUL 3ESNA 4OCRH 5E95B 1B0RB 4RZKA 4LDOB 1MG2C 5I19H 3B5GA 1TTUA 3CZJA 5B3JE 5L9DH 1NFAA 4KI1A 3LMJH 3L16A 1F2QA 2QL1A 3THML 2QR0A 3IGAA 4IRJB 4F7TA 1I9RL 3TBVA 2ZCLL 1KLUA 3NN8A 5EZJB 2XWBA 3MAWA 4GKZA 3EJZC 4XVJH 2VMDA 4ZO6A 3T65B 3ULAB 4QHLA 5ALBL 3OVUB 2CNZA 5E5RB 2G9KA 5H35B 1IKNC 1EQWA 3DRQB 3L4ZA 3KJ6L 4PHXA 2DQTL 3F84A 1I4FA 1A7OL 3M7OA 4K0OA 4C8XA 2VLLA 4HJTA 4PGCB 1SQ2N 4OIFA 4RMVA 4GO9A 4QRPE 2CO4A 5CN2A 3RWGB 4YE4L 5D7IF 4WWKA 4QJ3B 3CTTA 4ENZA 4BZ1L 3QEHA 5CJ8A 1QBML 3QISA 4HC1H 1TNNA 4CJ0A 4Z7VF 4OM1L 4WFGD 4HT1L 5D2NA 3N55A 5KOVC 1F86A 2ERJC 4WSGA 2E59A 1HNYA 5AVQB 2J4WL 1TJGL 2WLLA 2A6JA 5IOPB 1WGOA 1PZDA 5L88H 5EF2A 3LEYH 2JIXB 1A3RL 1EEYA 5TQ0L 5HYJA 4PJ5A 1G9ML 1NDGA 1P53A 1WFIA 2NT1A 3I75A 1A1MB 4OFYD 1EVUA 3MOAH 3ZYZA 4YHOL 4KKZA 3O3BA 5E8DH 1ZHNA 2BY2A 2LAAA 1IKNA 2YPKA 3MA9L 1DANT 1L9OA 4JX0A 4W9EC 4ES9A 4MRBA 3UGXA 1OSPH 1F3JA 2GFBB 4L2YA 3OPZL 2JXMA 3L17A 5LAXA 3EYUL 1D7FA 2UY7A 3E80A 5T5NF 2NQ3A 3B2XA 5ETUB 5GIRB 1YEHL 3AS0A 4UIKH 4AL8H 4U6VH 3GZKA 3L1FA 2ZG3A 4LKXB 3QPQC 2QVTA 1UCTA 4FFYA 3QWRA 4K5PA 3L1OL 4TOYL 2UZXB 3D85D 1NL0H 2OPCA 4GUCA 2J73A 2H2PC 1SJVA 3L54A 5JNYB 2XPGA 1BG9A 4G7YL 3EO1B 4GIPD 1AZNA 3VTMA 1JOIA 3NABL 3MRJB 4JS7A 5CF3A 2OCFD 5AUMA 4L3AA 2HKHH 4LOFA 1YY8A 5KVMC 3F65A 4WV1A 2E4TA 2ITEA 4HW6A 3VG0H 4GUOA 4NYLB 1JGEA 1BFTA 3GSUA 1KGCE 3HE7A 4XCCH 5B38A 1DUZB 3AXIA 3WFCL 4XO8A 4BFBD 2HT2C 5EPMB 4LL1A 2XG5B 1ZA6B 2WVVA 4F3FB 1S9KC 2IIJA 2NCMA 4QCIA 2NUTA 1KB5B 3J7HA 4K5OA 3F6LA 4IU2B 4LLQA 4YOKA 3HZMB 4HEME 2B3RA 3C75A 4GIOA 4E9VA 2WGXA 3JVFC 3UYPB 5CINH 1M7XA 4LOUC 2N4IA 1GZHC 1VKXA 1VZHA 2GT9B 4PB0L 3MLSL 4MJHA 3QPKA 5ESAB 2ICES 3I6SA 4K4KA 1CTNA 3GHEH 4NM4L 4QY8B 2HVJA 1MHHA 3TVMB 2EE2A 1DSFH 1XFPA 4OZFA 1RULH 3RKDD 4KHTH 3VU2A 1IM9B 3ARGC 4AKQA 5DJ2B 3CSTA 4FGMA 1S9YB 3P4LA 4GINA 4PN6A 3OR7A 1VJSA 4AEEA 2E6QA 1A66A 3VD5A 1QLEH 3GMLB 2QGBA 3N0AA 4F91B 1HSAB 1JVLA 3L3GA 5DVPA 2KHAA 1EHNA 2F74B 2HB0A 1HH6A 5F44A 3H0TA 2SEBA 4E2OA 1XF2A 2BMKA 5JQ6L 2ATPB 3GTNA 5CN3A 3VI3F 2EXYD 1QHOA 3PHQB 4LHUD 1I82A 3WO4C 4Q9RH 4ZSOA 1KXQA 3MGAA 4JZOA 5ISZD 2ZUYA 3QFJB 4IJ3C 4CGTA 1GMIA 1GZHA 1D6VH 4BH8B 2Y6SD 3OSKA 1N9PA 1T1XA 4P2OD 3IDYC 4G7VH 1CXFA 3QUZA 3ALPA 3DGGA 3SDAD 4X7TB 2F53A 1RVFL 1C5BL 5F9WB 4BSJA 3LNGA 3FUEA 1XXFC 4FFVC 3TURA 2O26U 4ZO9A 3L5JA 4MB3A 3ARGA 1QUPA 3BZDA 1EEZA 3BIKB 4C47A 3CFCH 1EMTH 4D7PA 5DQJA 3QDMD 2ICEC 1I9JL 4FQJH 2J8UA 1KN2H 1AR1B 3KL0A 4PSPA 5DJ6B 2Y5QA 5LBGA 1J9QA 4AQ1B 3MUHL 4FNRA 4YWGH 3T3PF 4HV8B 4M02A 1YJDL 4LDCA 4ZFGH 5JIIA 4HUVA 2WVSA 1PPIA 4Y16C 1LEKB 1PEWA 2XWTA 3O4OB 4UQ3A 1XR9B 2OXGA 3CZEA 5IWLA 1T5XB 4KQ4H 4TNWF 3KLHD 2UX6A 2JJUA 1XSIA 4F58L 5IMLA 1KPRB 1CGSL 1MCWW 1FFQA 2DBLH 1NPJA 4PS3A 5JDSA 1I9IL 1J10A 1IAOB 1BJ8A 5F93C 5E5UB 2X3AA 3QJFA 1UJTA 4MJID 1LQBC 4KMTL 5FGBC 2HTKC 3MLPA 5AFAA 1JRHI 4XNUL 3FQWA 1NDMB 3G6DH 2KLTA 3L4CA 2APXA 4FG0A 5F2FA 4E9QA 3UAFA 3BH8B 4D9LL 2YGNA 3MRPA 5GQBA 1IILE 3S0PA 5CFAA 2XIBA 4G9FB 2AJUH 3KLQA 3L7FA 4TSCL 3L3KA 2DQDL 1J8HE 3PWUB 1F58L 1GOHA 2I5YL 1WP6A 1OPOA 3WMPA 5LQBL 5IREA 3K2IA 3SGEH 2E5EA 5C0BA 4Z77A 3JV0A 4FHBD 1QRNA 3BGAA 1R19A 4YDIH 4ALAL 6PCYA 2BOBA 1CD8A 3CG8A 4ZX4A 3MBEB 1PCSA 2YD8A 3DROB 1M71A 1PFCA 4GSXA 4P8QA 2IALB 3KPRE 1ND0B 1PZBA 2OXHA 1RUPH 2WSPA 1YDPA 4EZJA 1E9QA 3IS0X 4JO1L 2BLFA 1IEBA 3UTPD 5IR1A 4Y4FD 5ILTH 4HPHA 4Y16A 1CLYH 1A5FH 3H4FA 5GRJL 2V17H 1ZGLB 3QEGH 4EI6B 1XQ4A 2FO8A 3DXAA 1E7VA 3AU1B 1XGPA 3HMXH 4JY5H 4P5KB 5B8CC 5BO0D 3BRFA 5MENA 1HH9B 2DTMH 5TF1H 4OI7A 2AEWA 4OT1L 4QTFA 4JHBA 1SN2A 1A02N 4XOCA 5A6MA 3RA7H 1T1YB 4H26A 1U8LA 1UKTA 3DSFH 3LIZA 4HJ0C 5I76A 1JZ5A 4FCAA 2DWXA 3CHRA 5FGBA 2G60H 3QEUB 5FKAA 4BHUI 2DQUH 5HYIA 1ZTXL 2NTFA 2QMKA 1CWVA 4L4VD 4LLWB 3FCUB 4LSVL 4ZNEA 4AQEA 1RJYA 4ZMWA 3IMUA 1MSPA 4I0PD 3ZDXB 3UO8B 4K3JL 2KQMA 3SDXE 1RJCA 5IEHA 5L4FA 1MRCL 2MCPH 2WZ0A 5KVEE 5F9AC 1XGTB 5TFSL 3A4EA 1TTFA 2AMGA 1JV5A 2YPLB 2VZ3A 4KAQL 3WN5C 1N0XL 1K3IA 2P5WA 1I8MA 4UB0L 2H6UA 4JPIA 4C4KO 5I15H 5C7XL 2YQBA 2E7HA 4Y2OA 5E6IC 2K45A 1C16B 5I8OL 2NCEA 3LKQB 4NKIL 1P7KB 4HALA 3U2JA 4XWOC 4ELKA 1MFMA 5FO8A 4JPVH 5AEAA 4UV7L 4EEEA 3HOGA 1K8IA 3RTQB 3AY4A 3OXRA 5C70A 1JTOA 4HD5A 3NCYP 3UTSA 1IFRA 1YYMH 2WXFA 1TTBA 1YEDA 1JF5A 1VCBC 2EUVA 4HP5A 4JRLA 2YEZB 2RB8A 1QTSA 4G8GD 2VZ1A 1OKEA 4OFQA 1QWUA 1JPST 3BAYA 1YECL 3CWGA 2ZWKA 1BXXA 1GH7A 2GUYA 2XHNA 5KJRL 2VAAB 4KBPA 4K7FB 1JUFB 1PX8A 4YNYB 3CK0L 2NY2D 5FM8A 4IRJA 4YSUA 2UUDK 3AITA 3BZFB 3JYBA 5EZJA 3T65A 1FVEA 5I24A 3RAJL 4J39A 4P9ML 3WN5A 5HVHC 2QGEA 1GW0A 1CBVH 4O2CB 5CILL 1N26A 5DRNB 5HSFA 4NNXB 3VXNB 4P2QE 4PJAF 5FO2A 2R29A 4GXUM 4NQTA 4L3EB 5EU7C 4KX7A 4JM2B 1BFVL 4L1LA 4MYPA 3QQ3B 3O3AB 3SE3A 3EOBB 3RWGA 4O2EB 4WTZA 12E8L 3HJ0A 4PV1C 3CLFH 5E1QA 5EEXA 3QRFM 3A6BH 4XCEB 2HPTA 1A4AA 3EDJA 3HPJB 3BOVA 4TMPA 1MCOH 1ORSB 4FTDA 4WEBL 3MREB 1A21A 1BZOA 4BQ9A 1BOGB 3R7RA 2XN0A 3BVDB 2HRPH 1J0ZA 4EIZC 4G2AA 4UTBH 1DQML 1GGCL 1U8HB 2X6UA 1URIA 5D6DC 5IOPA 4OF5A 1U8NB 1UWGL 4OR1A 3MV9E 1GPOH 1GSKA 4IBUA 2OM5A 4YSQA 2CK2A 1A1MA 4PTTB 3AMLA 5KBNC 2Z7UA 5DZVA 1BW8A 4C56E 4FA7B 4EDWL 1EFXD 4MTMA 4Y1AB 4NXKA 5CEYB 2LW3A 1ZGLM 4JZNB 1A7RL 3MV7B 1OCWH 2BFVL 2NXYB 1E5YA 1XIWB 3AXLB 3VJ6B 2GFBA 3W2DH 2ZONA 1QW9A 1NUFA 4XODA 5DJXB 1ZJAA 3IDUA 3Q8CA 4KKLD 2WXOA 4JPWH 5DVLA 5I0DA 4BFJA 4JRXE 4KXZI 5ETUA 5GIRA 2Q8AH 2NQCA 4NCDA 4RGMB 2XRAH 2ICWJ 4AJWA 3UAAA 3BCFA 2XYBA 1IGFL 3QIBD 5B7MA 3US1A 1XCWA 3V0GA 4R90L 1SXZA 2AK4D 2UZXA 4WFHE 1K2DB 2HYMA 3FH5A 4L37B 4QRQB 2W88A 5JXAH 4WI3A 3TBSB 1OCOB 2D7PA 2XYCA 3RUGF 3DX0A 4AIZB 1AZCA 5JNYA 3TNNB 3EO1A 1A0QH 4NJAL 3MLWH 5CSZB 3GK8H 3H8NA 1BF2A 5D6DA 1RIVH 3PRZA 2ZOWA 3QZOA 2VDOH 1JFQH 1N6UA 4LEOA 4OZGB 1J5CA 3AACA 5FYKH 4YO0B 2G75B 1BQHB 3OR6B 2OR9H 5HDLA 4NYLA 3VRLE 3T0EE 2UWEB 1AO7E 2JMRA 5E6ZA 3CHOA 3OB8A 1DUZA 4NRYB 4FFWD 3U9PH 2CMRL 4X8JB 2FYVA 4MD5B 1NGPL 3R0NA 5EPMA 2NNRA 2XG5A 3LEXA 4F3FA 1TPXB 4ABQA 3ZHNA 3A4DA 3V0AC 3QRGL 4ODHL 5I30L 4WF7A 1KB5A 2AEIT 5DXWA 5EIIG 1S5IL 4IU2A 5FLVA 1OSEA 2YD9A 3RU8H 3K2UL 4TTGA 4OJCA 5EC1B 4K3HA 3AM8C 5E4AA 4KITB 4ODUB 2VLRD 2G5BA 2GT9A 4FKHA 5ESAA 4IRSB 2W0LA 3VFNB 1A2YB 1ADWA 1MRDH 3S4SB 3TA4D 4GXVL 4QY8A 5D8JL 4KVNH 4LFHG 3MLTA 1PLCA 1SZNA 1YAZA 5FFOA 3ILQC 4H13C 1SYVB 3DETD 2XI9A 7FABL 3PU7A 1EZVX 4HKJB 3EYFB 4R4BB 4F5CA 1D9KB 2IOMA 2LVCA 4PVBA 3FO9B 1F1DA 4P3CL 4AQ1C 2NY3B 3GMLA 4ICWA 1HSAA 2FX7L 4FHKA 2F74A 2PR4L 3L9EA 1KTKE 2BVPA 3GIZH 2H8PB 4HPYL 5E00A 3C2SA 2IAAC 4J2QA 1P0SE 4LOEA 2CJUH 1FAIL 2DBJA 2YD4A 2LLNA 2N7BA 4AKPA 2EICA 1BJ1J 3VXRE 5J0BA 5T3XE 4LGSB 3IWUA 4E9RA 4PP1C 3ULUL 3QFJA 4WK0B 1UB6B 3ZR5A 5TE4L 4BH8A 5IY5B 1Z66A 3R4RA 1KWGA 3DYOA 4MS8C 1NJ9B 1LWRA 3JWDC 3THMH 4NO3B 1I9RH 2PYED 4X7TA 2ZCLH 3IRPX 1FQ9C 2Y2TA 1BQKA 4EUPA 2YXVA 1A65A 5ALBH 3K4DA 3D4YA 4DW2L 1SVBA 3SEPA 3BIKA 3LS4L 3KJ6H 2A73B 3CAFA 3RGBA 4Z7QE 3O2DL 1E5CA 5IHZB 5IROD 2DQTH 2W0PA 4E5XG 2VN7A 1A7OH 3V2AR 5DJ6A 4V2BA 4AQ1A 5A16B 3G6JE 1HS6A 4HV8A 4K15A 4S1DC 5IB1B 1UATA 4YE4H 1LEKA 2DI9A 4LIQL 3GSVB 4LE8A 5JR1L 1GCYA 4FC3E 4LLYB 1XR9A 3VFSB 3QZWB 3EO0B 4X5RA 5CZXD 3T4YB 3TP4A 3VVWA 4BZ1H 3N1FC 1QBMH 1OHZA 2GG1A 1KPRA 4OM1H 5FYJL 4HT1H 1IAOA 1UD4A 2FJHB 3ESOA 4E41E 1TJGH 1CLOL 3AREB 1U8CB 1AZBA 2P5ED 4WJ5B 2Z8SA 1NDMA 3PL6D 5TQ0H 1S8DB 4F2ME 1G9MH 2WV3A 3TJHC 2XCMC 4ZMTA 4YHYB 4G9FA 3ABMB 3GBLA 1F02I 2ZKWA 5HHME 4Y9FA 3NGBB 3PWUA 4OJEH 4HMDA 1ZLVH 1VAHA 3MA9H 3ASNB 3RGVC 5DA4A 5GZOD 1M7DB 5I8EA 3MBEA 2ODIA 1I3UA 3DROA 1I75A 1Z1WA 2XXFA 4BEIA 1ND0A 2XXMB 3EYUH 3N91A 2R0ZL 4N3TA 1WTLA 1YEHH 3HAEG 3Q06A 3UJIL 1G4MA 2A7BA 2BO0A 3NIGF 1PY4A 5C09B 3D3VE 3GBML 4GRLC 3PLYA 1ZGLA 1XTMA 4PLOB 3TASA 1BF5A 3L1OH 4TOYH 3U6XS 4NWUL 4PJGF 1JZ2A 3AU1A 3V8CA 5KYUB 2ADGB 1M7UA 2O6DA 1HH9A 4DPBX 7PAZA 1WA2X 5FYKU 4G7YH 5HVGB 2OYPA 5BRZE 1T1YA 3IS1X 3NABH 3IRCA 3DX3A 1IFHL 4N0FB 2H2PD 1Y1UA 5FGCB 5B1CA 5SWZB 4Q9QL 5L6YL 4FFTA 1UFUA 2E9JA 4LLWA 4XNZC 3N40F 4PJBE 3K5RA 2OA9A 1D3CA 4AGOA 4NRZA 4WCYL 1B9ZA 3QIUC 3MX0B 3WKML 3WFCH 5F21B 3N1GC 1XGTA 3F85A 4I0CC 1F6FB 4DEPC 1GVIA 4DGWC 3FQUB 1A4JB 2YPLA 3B7YA 4E9YA 4E0RA 2WAHA 1M9SA 4QMEA 4ZS6C 2GITB 2WWNA 5J11C 1WPCA 2COQA 3SKMB 2XTJD 4YXHL 1U91B 5DFTA 3QBTB 5CP7B 4HIEA 1C16A 2Y2WA 3WIIL 3LKQA 1P7KA 3VQLA 1UT2A 2AXJA 1RSYA 4PB0H 3QRLA 4GRLA 4EAEA 1S78C 5T1LD 1E3XA 2D3VA 4NM4H 1NQBA 4YL4A 4IBWA 3SKUD 1E9PB 2WO4A 1CF8L 1T0MA 3MUJA 1GZPB 2BVEA 3FT3B 3SDCC 1X9RA 3ZO0A 4DO5A 4HG4K 5A2KH 3NG5A 1GYVA 2YEZA 3MCG1 3MVSA 4XE0A 1AY1L 4LP5A 4PD4J 3X3FL 3WTYA 1UACL 2J25A 4UQAA 1MFNA 5GGSY 1NCJA 1PZ5B 2IANB 2K0RA 4WNQB 1MW0A 5EF3A 5KVDL 2VAAA 3WUZA 1TZHB 3CE1A 4K7FA 1JUFA 4YNYA 1TDQA 2EABA 2XZCL 2LU4A 1DVUA 5C08E 2CHDA 1KGUA 3LDBB 4KKRA 5D96B 5KYYB 2VR3A 3VG9B 5JQ6H 1OGAA 1NKRA 1FZJB 1NCAL 4TNFA 1PLGL 1GCFA 4IDLA 9CGTA 2OFQA 2NXYC 3KWVA 4O2CA 5DRNA 3TU6A 2ED8A 4YZFF 4EXKA 1N3NB 1MCKA 1V3KA 3RB7A 2F7PA 1IBDA 4QXTB 2DYPB 2W0FB 4L3EA 2BJML 4JM2A 3QQ3A 1C5DB 1JZEA 5KSUA 3O3AA 3ZKXC 5I1JL 4PS4L 4RGMC 3HKFA 3EOBA 3NQIA 5EC2A 4O2EA 4XMKL 4ELMF 1RVFH 1QSFD 1C5BH 4XCEA 1FCCA 2AJXL 4YFLI 2DLTA 3HPJA 3X1NA 3VXMB 1A64A 3UROR 1X4YA 3GSWA 1ORSA 1IAKB 3NJIA 3C60C 3VM7A 4P46C 4QLRA 2DQFB 3MREA 3O81A 3IN2A 3LQAC 2PXYB 1I9JH 2ZKMX 1U8HA 3CHQA 3ESUF 3M88A 2EDHA 5HGAA 2FSEA 5AG8A 2ZCZA 1U8NA 4WEUD 2ATAA 1K72A 2VW7A 5E8PA 2PYFB 4LSRL 3EYVB 4MSWA 5JHBA 4PTTA 4CSTA 4PBDA 1M9WA 1IC5L 3EJRA 5BO1L 2WBKA 4GP5B 1G0XA 1JTTA 4Y1AA 3BMWA 3MHZA 4F58H 2F8OA 5CEYA 1BBDL 1CFQA 4JZNA 1CGSH 3MV7A 3VFOB 4AE0A 3VJ6A 1HINL 3AXLA 3ZTJH 2AP2A 1IV8A 1I9IH 2EXWD 1SOQA 5DJXA 4BK5C 3L4UA 3N43B 1IKFL 4KMTH 1UD5A 2K6WA 3GS7A 4E5XB 1RUML 4G70B 4XNUH 3BKYL 3GT6A 3M6DA 3QWOB 4Z3TA 4D9LH 4IRSC 3WS3B 4TSCH 4YC2B 2DQDH 4C58B 4IDJL 1F58H 3IM1A 1K2DA 2I5YH 4QRQA 4C57C 1SXBA 5CGMA 5LQBH 2CGYA 3TBSA 4M7ZB 1KXVC 3TNNA 4ALAH 4AQAB 4NZRH 1JF1B 3BAKA 1DJWA 5CSZA 4QNPE 4JO1H 1QATA 4OZGA 3FSOA 2AERT 3WJJC 4YO0A 2G75A 1BQHA 3F7VB 3OR6A 2IDTA 5ADPL 4ABUA 5GRJH 1NINA 2FWUA 2DD8L 5E8OB 5JO5B 2NY4C 4JREC 3R19A 1SGKA 2CBQA 4X8JA 2QBWA 4MD5A 3L9RA 3CZFB 2QKIC 5LGYA 2XV0A 3EJJX 2J56A 3BP5B 3HNVL 3LQZB 3NUKA 2D7MA 4FQQB 3ZGIA 4X6CF 3A6OA 1A6VL 5J12B 3OMAB 4LL9A 4BK5A 1KDJA 1BAWA 1P4IL 2PWEA 1ZTXH 4D9RE 5I6OA 1ZPUA 4N2AA 2VLJE 4LKCB 5EC1A 1ZAGA 4LSVH 2MMXA 4M6OL 4ODUA 1AVAA 4HJ0D 5F8QC 3RWDB 4IRSA 4K3JH 2E7LA 3G6AB 4JG0L 3VFNA 5D1ZB 2ZKHL 1YUKB 1MRCH 1RIUL 3QB7C 3S4SA 4KNQA 5I73B 1YG9A 2NYZA 3FFDB 2A74B 3GLDA 4Q2ZB 1UT1A 3GF8A 4F9LA 3QXAB 2WXHA 1KXVA 5DHVB 5TFSH 2XN1A 2ZP9A 4LVNC 4PJ8B 1J9RA 1CDIA 3MNWB 1SYVA 4OGQC 1KYDA 1BIHA 1JF6A 1QASA 3O2DA 4GMTL 1N0XH 4QRPB 4HKJA 3EYFA 4MCMA 4UB0H 4R4BA 4KO7A 4Y5YC 3MU3A 4R7VA 5TDOB 1SEBB 5C7XH 1D9KA 5BVPL 1PF3A 2BY1A 3FO9A 5I8OH 2BSDA 2EYTB 2IWFA 3LZQA 4NKIH 3WJJA 4EKJA 3NK3A 2OMXB 4WTXA 2OTWB 2D31B 1F2XK 4XNYL 4UV7H 4YJZL 5E6ID 4OY9A 1FZOB 4S11A 4EI5B 1BYOA 2WJ7A 2RD0A 4ODXB 4XWOD 2QKIA 3VD7A 2V2WB 2H8PA 1Y7VA 1UH3A 1NWPA 2PP7A 3HI5L 4N5UA 4M9OA 5MERB 4WUKL 4ZW7A 1KC5L 2DYRB 2FLRT 1MXGA 5E9DE 3ZIYA 4JFDE 3B3BA 1R17A 1YUHB 3FOLB 1YECH 5D7HA 5J4MA 2P48B 4HF5L 5IVZB 1J1OL 3NFPB 4GG6F 5KJRH 1FUNA 4G6KL 4JO8A 2DOCA 4W4OC 3SB3A 3CK0H 5DVKA 3KPTA 1B4LA 1CQKA 5F7AA 5KS9E 1JP5A 4NO3A 4BDVA 4ANXA 1WEJL 3T3MF 2GK0A 3OKLB 3QULB 3DC0A 1WFUA 4YHYC 5C0JB 1ZT4B 2X4SA 3NGBC 4Y4KC 5HGHB 3ERXA 5DFVC 3RAJH 2R59A 2EEFA 2VJ8A 1AKJD 2WYHA 2JKNA 2VR9A 4PY8I 3F2LA 1CXIA 3FT1A 4ORZC 2A73A 4U1KB 4NUJB 3ALXA 4PJDF 4F8NA 5F7DB 3UOAB 5CILH 5IHZA 3K8LA 4NFDA 4U6HB 4U1HB 3O6FC 1KACB 5FR3A 1DBAL 1BFVH 3DBXB 5T5FL 4J3BA 4JRYE 3MRRB 4UBDC 4GT7A 4TLSA 3AQDA 1GIGL 1J0YA 12E8H 5I0ZA 3GSVA 2LLLA 4LLYA 1JNLL 5DUML 5CS7A 5AB2A 5DO8A 3ET9F 3FH7A 3VFSA 1LM8V 2BW5A 3BUPA 3EO0A 3QZWA 1BOYA 4XBMA 3T4YA 5E08L 2IC2A 1JXJA 2B1AL 2J21A 2QV2A 3FQ1A 4WEBH 2AQTA 4PJCF 3RIFF 3G5XB 3VWKB 4XPHL 1YPZE 4Y0GA 3BFWA 2FJHA 5ALCL 2L7UA 5LGJB 1A47A 1OARL 1DQMH 1GGCH 1SHMA 4ECNA 5D93C 1N2RB 2RCSL 3TEWA 3AREA 5FAAA 4PRNB 1UWGH 2ADFH 2QPFA 2WBXA 4W4OA 4UZUA 3EJPA 1X5KA 1LWJA 1S8DA 5DUPL 5AOJA 4FNLL 5K5YA 4YDKL 1S7WB 3M1BB 1R3LB 2A9AA 1KV3A 4EDWH 3HUJE 1AGBB 1DR9A 1A7RH 1TTAA 2BFVH 2FVNA 2P26A 4Y88A 4YDLB 2HKFL 1M7DA 5DURD 4UM9A 2C9AA 2WXQA 4HVBA 4OSUL 3VMNA 3CH8A 2HMID 2H2SC 3RZCB 1U0QA 3IAGC 1AKPA 3BX7C 3W11C 4JL2A 2Q7YB 1BQUA 3S3JA 1IM3B 1IGFH 4ENED 4OGYL 5E9AA 2E9IA 1I8IA 4R90H 3D48R 5KYUA 5E2UL 2NY1D 3MRHB 2ADGA 4L05A 1UXWB 4AG4H 2Z0BA 4JGJA 3HE6B 4NQCD 1NCHA 5D7KE 4OCWH 4NJAH 2G0LA 4XMLL 1EO7A 2QQKL 1RXLA 2PP8A 4N0FA 5SWZA 1QPXA 1GJUA 4JFPB 3CC5B 1OQOA 5F7YC 3JYCA 2ZX8A 4LSUL 2VC2B 2H4EA 4LAQL 3IMBA 2FJFA 3V5DB 3MX0A 4D0CA 2CMRH 3BH4A 3LDBC 2SODB 3QDGE 4KROD 4PMFA 5D70L 4EDXB 1NGPH 3FQUA 1A4JA 2FDBP 1WAAE 2FJUB 2ZYHA 1FZKB 2XJLA 3QRGH 4ODHH 4HJGB 4M6ML 1B2WL 2GITA 4K8RL 1NWOA 1S5IH 1K9TA 4G72B 4X9GA 3SKMA 3ZK0A 4A67A 5C71A 4LGRB 1U91A 2Q10A 3K2UH 5CP7A 3FB5B 3BRDA 4I4WB 2AQQA 4G6ML 4TQEL 3SPVB 1E4XI 2HH0L 4RRPA 3STZB 1F4XL 4RNRB 5EBGA 1CGVA 3IBEA 4J3OD 1ZLWH 4GXVH 4KU1A 4XN4A 5D8JH 1E9PA 5DUBB 2NR6D 2BS8A 4AXWB 1U58B 2XX0A 1GZPA 3FT3A 4HSQA 3HG1A 2CH8A 5EEUA 3LB6C 2ZAGA 7FABH 3GLZA 5BXFB 2X4PB 3X1EA 2PXYC 3S98A 3GB7A 5AW3B 1PY0A 5F8RC 5EEWA 1PZ5A 2IANA 4WNQA 3JUYA 3TTSA 1FIEA 2QPDB 1K3ZA 4P3CH 1TZHA 3MPCA 1NBZB 2A99A 5CSBA 4DQOL 5KTEL 2EVJA 3IJ9A 3ULVD 4A6YA 3R8BB 1SNRA 2VC2L 5C0AE 3I3DA 5KYYA 4U7SA 5EUOF 2UWEF 1Q0EA 4GOSA 4PWIA 2G4GA 4XPGL 3QCVL 1Z9OA 3KYNB 1FZJA 2A9CA 4HPYH 1GR7A 4TNWK 1Q1JL 4MCNA 4ZDHB 4AEIL 3WAKA 3PQYD 1FAIH 1PAZA 1F6LL 1N3NA 4H0LC 2C9PA 2F58L 4F57L 5FOJA 4QXTA 3JV4B 2X9YA 2W0FA 4I2XE 3ULUH 1J8HB 5C0DB 4JFFD 5DJYB 5CD3B 2EIJB 2VM4A 4PGEB 1C5DA 3RVXC 2IOIA 5SWSA 3ULUF 3SIKA 3IJ8A 3I50L 4XMUA 2Q20A 3KH4A 1J9TA 5F7UA 2QMJA 4N5EC 3B9EA 2B4CL 3KPRB 3VXMA 1QRKA 2CWRA 1IAKA 3B56A 4MS8D 4BKLB 1ZWIB 2HFTA 2HLAB 3UDWA 4DW2H 3LS4H 4OAWB 4BWUA 1IIIA 1EHAA 3O2DH 1KGYE 2PXYA 5ITFB 3WLWC 1G1CA 4QHUB 4CDGC 2HX9A 1OL0A 3CZSA 3TYGL 1PJWA 2QLVB 1CDBA 4FNUA 2EDDA 4MAUL 1E4KC 3CFNA 2PYFA 3L13A 3UG4A 4UU9B 3WIFA 4LIQH 4ZPTB 5JR1H 2V0AA 2DMCA 4DSYA 2P80A 3KPQB 3G08B 2LU7A 3V52L 3FH8A 4S1DD 3VD4A 4CN6A 3VAEA 1MAKA 5ABZA 2E74C 4BE5A 4LB8A 1U9KA 3VFOA 3BVUA 5FYJH 3EFFB 1QYGL 2OLDA 2PW2B 2ENYA 2H3NB 5J12C 3SDXB 3MFGB 3PAVA 1CLOH 3QUXB 3QWQB 4E5XA 2PO6D 4XMPL 3FYEB 3PDGA 3D87B 2ITFA 3NSYA 3B37A 3WHE0 3QWOA 5EZLB 3WXVL 4XHJC 4WSJA 3UJTL 1VSCA 3WS3A 2XPYA 3EYQC 3E1F1 2YN3A 4YSAA 2J1XA 4UAOC 2BRQA 4G1MA 1BJ1H 3TZVC 5I75B 2IWEA 4KPHL 3TJHD 4JCMA 1WF5A 1KF9B 4AQAA 1PD6A 5IV2A 1SRDA 1JF1A 4NZ8A 5JYMA 3LD8C 3VXTB 3RGVD 3QH3B 2R0ZH 4IIQC 5LDSA 5AYUL 1F4YL 3CN3A 3CVHL 1DJZA 3UJIH 1E5AA 1Y6MR 4HCRL 4UT6L 3F7VA 4FLQA 3GBMH 1LK3L 5E8OA 2NSXA 3IMVA 3NAAL 3JV6B 3NJNA 4NWUH 3P4NB 4EI5C 3BPOB 4S0SD 3HEIB 4LCWD 1N6VA 1W0WA 3CZFA 1OVZA 2X2JA 1YEGL 1MN4A 2QFPA 3BP5A 2J43A 2QZ5A 3LQZA 4FQQA 4PJ7E 4OD2B 4YE0A 4Z7NF 1K5WA 4PJFF 4N0CC 5I71C 3V0IA 4MHHI 3Q2NA 4JFED 4OKVB 4PWKA 2Z93B 2ESVE 5C6PB 1WC7B 4HULB 3O0LA 4LKCA 1LYQA 5L6YH 2X2YA 3E3QC 4MZ3A 3DRTB 5E2VL 4RFNC 3RWDA 1ZPLA 4AK2A 15C8L 5D1ZA 8FABA 5I6NA 3TA3C 5AZ2L 2EIZB 3WKMH 3FFDA 3VD9A 2A74A 4WW2B 1PL3A 3QXAA 1NGXB 4P2QB 2JI2A 2G0KA 4GYBA 4NQQA 1PBYA 1SYSB 5D5MF 4MJ4A 3MNWA 2VSKB 2VDKB 3QIUD 2K6YA 4QRPA 1OPGL 2VN3A 5AW5B 5I5JA 4G6FD 3DDFA 4H8VA 1NMAL 2DW5A 5DO2C 4YXHH 1SEBA 3REWA 2RBLA 5T5FA 2N56A 3GUFA 4M5ZL 3FK3A 5BMFL 5JHAA 2EYTA 4X9YA 1O7VA 5TQ2L 2QV4A 4ZS6D 2VDNB 4ZNCD 5MHSE 2Y5EA 2D31A 3T8XB 3MACL 3SJVD 4A04A 2Z91B 2G4EA 4EI5A 4P9HC 1N0LB 1QFPA 4OKDA 2CRIA 4FULA 2V2WA 1S78D 1D7CA 4JNXA 3C6LB 3MV9B 1Q9KB 2EIEA 5MERA 2IADB 1AY1H 4JGNA 1OP9A 4FTVE 5F1KC 2AC0A 1VFMA 1DEEB 2J8OA 3X3FH 2AKRB 1YUHA 2KDGA 1UACH 3FOLA 3MRCA 2MNJB 4NO2B 7CGTA 1PG7W 3SDCD 5IVZA 4C56B 3NFPA 4W9GC 4KJPD 3COOA 5KVDH 2ATKB 1L0QA 1UB5B 2GEQA 2WVTA 4P3WA 1QSZA 2XZCH 1JI1A 4BXSV 5JTWA 3TA3A 1AOZA 4PTUA 3OKLA 4JFHD 4U49A 3QULA 5C0JA 1KJ2L 1ZT4A 4ONHB 5HGHA 1NCAH 1UCBL 4JRXB 1PLGH 1K4CB 4PW3A 1E43A 3A5VA 3L5HA 3DHJA 4U1KA 4OLZL 3LN9A 4NUJA 2VDKL 3LV3B 3V0WL 5F7DA 5F71A 3ZE0E 4U6HA 3BP4B 4U1HA 1CVSC 1GS7A 5LBSA 4U3XA 2BJMH 1FFRA 4PREB 1OOWA 5I1JH 5IJCC 1XGZA 4PS4H 3MRRA 3OKMB 3A47A 4XMKH 1KJVB 1PVHA 2AJXH 4GRWE 3OC8A 5DMKB 4OH2A 4URKA 2O5YL 1WZLA 3PJSA 5TD4A 3VWKA 4R97C 2VDLB 4Q0XL 1XF3B 3BVTA 4LEXL 2OL3B 3WNLA 3T0EB 5A3ID 4UZSA 5LGJA 1AO7B 4HH9B 3C60D 1N2RA 2CNYA 1TJMA 4P46D 2W8CA 4LQ1A 4M93B 4PRNA 3FQ4A 3V6BR 3ZTNL 2D9CA 2JH2A 2MEJB 4IOSA 4U1GB 3VSQA 4EKXA 5IFAL 3RZWA 1OE3A 5C0CD 5FYJU 2NPLX 4LSRH 2KZKA 3Q9PA 5GGSB 5CEZL 1IC5H 4PY7B 3SPGA 4FABL 5AW9B 5BO1H 1S7WA 1SMOA 3H2WA 3M1BA 1R3LA 3IDJB 3NJHA 4HEMA 4KRNA 5DQ9B 3QAQA 1AGBA 1BBDH 2FJGB 2MNUA 5KZCB 1QBLL 2ZKYA 1HINH 4ZXBC 3SBRA 4M6AA 4HLJA 1N68A 1ZEAL 5AOZA 1IKFH 3J8F7 5LXVA 2A9ML 4P5TB 2DJSA 1AP2B 1RUMH 3Q2LA 3HRPA 2WZPA 3SODB 3BKYH 4HJIA 4JO4L 2VXTL 4CILA 2WQ8A 1IM3A 1BFSA 3BUDA 2Y36L 1EDHA 1C1EL 2BVTA 1OK0A 4LP4A 2JLLA 1NM4A 1L3NA 3MRHA 2O30A 4WFGE 2V3DA 1UXWA 5I16B 3O6KL 1M6OA 4FXGC 3D08A 4FKKA 2BY3A 1MCJA 3C8HA 1CFNB 2VDLL 5BUGA 1R3HB 4X8GA 3SGDI 1CGXA 5AL8A 4GPVA 4KQ3L 4JFPA 3CC5A 2YSSB 4FI7A 4DF9A 1KYOJ 2GIXA 5ADPH 2W80C 3UAJC 4Z7UE 2DD8H 3V5DA 4A38A 3JZYA 3VXRB 4AMKL 4U1SB 4C4BA 1LJMA 3HNVH 2NY4D 1FZKA 4HJGA 5AVVB 1A6VH 2DKSA 4RMQA 5I0YA 1T5WB 5DTFB 1P4IH 2Y4SA 5B21A 3D7PA 4AYGA 3D18B 4I4WA 4GP4B 4HIPA 3N43F 3SPCA 4M6OH 4DFIA 3SPVA 1F3DJ 2MH4A 4RNRA 3E9UA 4ZT1A 3STZA 2ADYA 4JG0H 3CDYA 2ZKHH 3UABA 1RIUH 4Z7QB 3SYCA 1MVFA 5EBWA 5DUBA 1TJIL 5L8LB 4AXWA 1J8RA 1U58A 1FF5A 1OAQL 2YAMA 3KBHE 2YUZA 1ET7A 5EU6D 4FXGA 3G6JB 4GMTH 3DV4B 4YHIA 3ARXA 4MCZB 4HUCA 3S3PA 5BXFA 3K6DA 1E5UI 3WUWB 3UPRB 5BVPH 2G2PA 2GK2A 3MRGA 1NBZA 1NIEA 4WHCA 1OM9A 7TAAA 3MJ6A 4XNYH 3QHFL 3DMMB 1RKRA 4TTDC 4AVJA 3UTZB 5FA3B 4E41B 3D5OF 3H3BC 4AT6B 3KYNA 4HBQA 4Z9KB 3ARFB 5T3XL 3O11B 1QVOA 4B3EA 3K6NA 1KC5H 4ZDHA 5HP5A 4XMZA 4NIKB 4F2MB 1P9MC 5HPMB 4DUXA 3VQ2C 5I1DB 5DJ0B 3OMNB 4QRFA 5HHMB 2FHCA 4HF5H 1J1OH 1J8HA 2ZX5A 5C0DA 3QUXC 2DWTA 2VDRB 2WQVA 2YS4A 3CFEB 4G6KH 4JM0A 5DJYA 4PGEA 1ET5A 1GZQB 2W9EL 5ECJE 3TYFB 3U4BL 2C7UB 3KPRA 3EDKA 4TULL 5JZ7D 2G9HB 4BKLA 1ZWIA 2WW8A 3P2BA 3Q6FB 3RIAK 5DHVH 1QWHA 1R46A 3ZZQA 1DVFD 4OAWA 1ZLVK 3JWNG 3D3VB 5AKSA 2QTEA 4Y4KD 2PWHA 1IX2A 4TSBL 1TKWB 5DFVD 4QHUA 4F7EB 5ITFA 5IOKA 4HCRA 1DBAH 1NIAA 2BXYA 3KPOB 5HVWA 1JPSL 3DO3A 1X5IA 5T3ZL 3OG4B 3RPIB 4XO9A 5MI0B 4UU9A 3VH8B 5A2BA 3O6FD 4ZPTA 2EQDA 3TFKC 1JNLH 5DUMH 5BRZB 2V3EA 1AGDA 3G08A 1D5XB 2W95A 3QSKB 3WS6C 4FA6A 5E08H 3T4AB 3D51A 2B1AH 4RQQA 3HFFA 4UBDD 1QMUA 2YD5A 4J5VA 1P9MA 4XPHH 3EFFA 4PJBB 5ISZE 2PW2A 1P69B 1OARH 2H3NA 2HZHA 3MXVL 3SZKC 1HEJC 3UXFA 2RCSH 3B2PA 3QUXA 2K6ZA 2QDWA 1PZSA 5GGTA 1GRWA 3KJ4B 3OBAA 5JPMB 1G0DA 5DUPH 3RX5A 4V33A 2VDRL 4YVUA 2E0PA 4FNLH 1QFHA 1R5VB 2VRAA 1VA9A 3T9WA 4YDKH 1ANUA 3VI4E 1X5GA 2EDQA 1T3FB 4RAUB 3BFOA 2ISDA 2XN9D 3D33A 4X6FB 4ODBD 3UGEA 3VFUB 3QDME 3LN4B 2CGZA 3CVIL 2HKFH 1N8ZB 3FF8A 1YC8A 5KBDA 2R2CA 1TTGA 3OAYH 1NFDF 1G7MA 1F1AA 4OSUH 3UIZA 3QH3A 4YDJB 5T1DL 1MCRA 3AG3B 4J6IA 2N7SA 2VABB 1HDMB 3F7RA 3O6LL 4J3UA 3S6CA 5DR5H 3WNIA 4HKBB 4V1DE 4DEWA 4XAKD 4R4FH 2VSMB 3FO1B 4OGYH 2JCCE 2FE0A 3JV6A 1PG7X 1L0PA 3WS6A 2EC9U 3P4NA 3V0VB 5E2UH 8CGTA 2NXZC 2VERN 3W11D 5LHDA 2Y5TB 4IRZA 3QG7H 3I02A 4AKOA 3EDEA 4DCQB 1P2CB 2ENQA 4OD2A 3O2WL 4MJIE 3RJDA 3VWJD 4XMLH 2QQKH 5C08B 2CHWA 1JNHB