2FK1A

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'small unit cell' form, cu(ii)-bound
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein precursor
publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fk1A00
2FKLA 1OWTA 2M05A 2FK3A 2FK1A 2FMAA 2FK2A 3KTMA 4PWQA 2FJZA
chains in the Genus database with same CATH superfamily
3PO3G 2UXDH 4DR4H 2FMAA 4ZQIA 2W70A 3IG0A 4ZOLF 5KFMA 5DG8A 4O3OA 4XYMB 5KFPA 1ULZA 4FS1A 5L1IA 1WSCA 4LF5H 1M0WA 4XZ3B 2DPIA 1S68A 3BQ1A 4IRDA 4AYBA 2W9CB 4YR3A 4QW9A 2O03A 4UCTA 2BQUA 3T5JA 3RB6A 4DV2H 2R7ZG 1E4FT 2R82A 5KG6A 2BQ3A 2Q2UA 2R8GA 2PBZA 1I6UA 2V9WA 3H0GA 2FPGB 1CS0A 5KFOA 2C2DA 3J80W 5J2UF 1N33H 4YY3H 2VQFH 4ED3A 1K1SA 4QWBA 2ZJTA 1OWTA 2VPSA 5F9NA 5BPFA 3EPIA 2XCPA 3BA9A 3BJYA 4ECWA 2HJWA 2RDJA 1IBMH 4MTEA 4ED1A 3G8CA 2JEGA 3R23A 4UCUA 5DQGA 2OLSA 2W8LA 1A0IA 2F4VH 4I4TF 5EWGA 4DV5H 2J6SA 3R5FA 4K0KH 3PR4A 1ZHSA 5C3EG 3FKIA 1ZHQA 1L2ZA 1ZETA 4JI3H 3T1YH 5KFKA 3OUZA 3FDSA 1S03G 4JYAH 3GTPA 3NGDA 3GTMA 3N41B 1E4GT 2W6ZA 4Q45A 2NVYA 1Y1VA 5C4XG 4DL7A 1S0OA 4O3SA 2YS7A 5LA6F 3LMLA 1V9PA 4ED0A 2CZGA 4X65H 1E4EA 4DUYH 4F4WA 4QIWA 2XD4A 2VPQA 5DLGA 4ECRA 5KFEA 3BQ2A 2FLNA 3V4ZA 3RV4A 4J0MA 2DLNA 3RV3A 4ED2A 3SI8A 4Q8EA 5EWFA 3RJ0A 5DG9A 3U9SA 2WDTA 2W6OA 3PW2A 1Z2OX 1TA8A 1DIKA 4M7EA 2W9CA 1GSAA 3KHHA 2W6QA 4YP3A 5DLFA 3WO1A 1VKZA 5LP6F 5KT2A 4DV0H 3RFCA 5KFIA 2JA8G 4O4IF 2R7ZA 2HHHH 3PZPA 3GIKA 3QZ7A 1GO3E 2R87A 4ZHQF 3H4BA 4ED6A 3Q8RB 3MR5A 3JRXA 5KKNB 3UFXB 2NU8B 2YYAA 3GIDA 3RF2A 5KT4A 3IN5A 5KFNA 2C28A 5JQWA 4QWDA 1KJJA 4ETSA 5IYDG 2ZDQA 4YR2A 4YJ2F 4DR2H 3MJFA 1DV1A 1W93A 2RGRA 2VR1A 1KJ8A 3TIIA 5KFWA 3EYYA 3GTLA 1V51A 2CW7A 1PK8A 2XIGA 4L1KA 4A3GG 3BAAA 2R7MA 3TINA 1Y14B 4LF7H 2B63A 3M4IA 4J9RA 5FPOA 2JEIA 4HNVA 4MV7A 4CC6A 5FD5A 2CW8A 4TV8F 1CQIB 2Y0SE 3R5XA 4LMYA 3JRWA 4GKJH 2CKZB 4F4ZA 3GIPA 3ORQA 1GSOA 4B3MH 2FK3A 4X62H 3FKIG 4RB2C 3DF7A 5KFQA 4FS2A 4KHPH 4J9NA 5FJ8G 1FVIA 2YZMA 2UUCH 4QW8A 4ECVA 5FLXW 4RZQA 3GILA 1KJ9A 1RJRA 1M7JA 5EOYA 5KG3A 5KG2A 4A3DG 3VPCA 3RTXA 4X64H 2QYZA 3Q8QB 5HBRB 4GLXA 3PR5B 4BBRG 4RAYA 1RJQA 2NU9B 4I50F 2IP4A 4U7CA 2IA6A 4JI6H 2R92A 5KFGA 5LL6b 2I80A 5FLMG 2FLLA 4GC7A 4ED8A 4TUYF 5EDWA 5T14A 4RB1A 4UCRA 3V4SA 4DL3A 4DL5A 5CB4F 4APMA 5DG7A 1KJIA 1BJTA 1B6SA 2NU6B 4RU9A 3OUUA 2WE6A 5A2QW 3MWEA 1IBKH 5KT5A 2JEFA 3N44B 5JH7F 5JVLA 3RBDA 2R7KA 2BR0A 3KHLA 1RJPA 4O4HF 2C00A 4MV8A 4EGQA 2GPSA 2KSWA 3MR3A 2UVVA 4DV6H 4DLKA 1RK5A 5I47A 5LYJF 5L1KA 5IT9W 2W8KA 2UVRA 3GQCA 4DUZH 5C44G 4FM9A 1O75A 5KG4A 1XDNA 4MA0A 4YJ3F 2YL2A 3MR2A 5H80A 5C5JA 4DL6A 2Q2TA 1ZQ7A 2GPWA 5BPHA 5KFSA 4JV1A 4I55F 5IYBG 5KX5F 4QWAA 3PW0A 1HR0H 2CQYA 1I7LA 4F4YA 3HBLA 1BNCA 4LF8H 4WBNF 1DGSA 2UU9H 4F50A 2FPIB 5EWEA 2J6TA 2B63G 1JDEA 1RK6A 2YCHA 3HOWG 1CE8A 4BWSC 1KBLA 1WH2A 2VOBA 3RUPA 4IR9A 4DR3H 2FK1A 2C2RA 2WYOA 4IWXA 3PN1A 4TQSA 3RAXA 5KT6A 4O2AF 2XCAA 1S10A 2VA3A 5KG7A 4Q43A 4U6PA 3H3VH 3GIQA 1XNRH 3G6XA 5IYCG 4RZRA 2NUAB 5KFLA 4DV4H 2UXCH 5L1LA 4ECTA 4JI0H 2XGPA 4WD3A 2RF4A 3I4MG 2NVXA 2Y0SA 3ETJA 3GV5B 1N36H 2R8KA 4PWQA 3N43B 4R7RA 4EFBA 5J2TF 2DIKA 2W6NA 2QK4A 2R92G 4RB0A 1B04A 1SCUB 3KTMA 4DV1H 4JI4H 1VS0A 1SEIA 4RNMA 4ECSA 4HR7A 2YRWA 4UCSA 4IRCA 3OSNA 4IAJA 4J9QA 3M9NB 4J9MA 3ORRA 4M9UA 2FK2A 2R7NA 3JSNA 1WCMA 5JVDF 3RB0A 4NLGA 1C30A 4BY1G 2V58A 5FD6A 2R7LA 3EPGA 1TWAA 4GC6A 4ECUA 2DPJA 4RUCA 2FPPB 2IBKA 1T36A 2FP4B 4LFAH 1UC8A 3BA8A 2RDIA 3N8DA 3J7AK 5KT7A 4J9LA 2I8CA 3GTJA 3BG5A 3LP8A 3RIZA 3OSPA 4EBEA 3VPDA 4JV0A 3I4NG 1N34H 5KFXA 3KXYT 4TV9F 3U9TA 1S97A 1HNZH 2V59A 3MWDA 1C3OA 2W9BB 2UVUA 3HOZG 3SE7A 1S0MA 3N40P 4ME6A 3TQ1A 4OX9H 1TWFA 1IOWA 3M9MB 1B6RA 4R8UB 1EUDB 4HYKA 2VA2A 4BXXG 3GV7B 4HNTA 2DWCA 1EHIA 3CQZA 2V4RA 1SFOA 4B3RH 1EZ1A 5KFDA 4O3RA 4MV3A 3L4KA 3HOYG 5D1PA 2VUMG 2UUBH 2R93G 1RYSA 2ASDA 2HVSA 2OH2A 4YQWA 2HVQA 1P8LA 3T5HA 1M0TA 2W6PA 2MCTA 3KAKA 4HNUA 1N48A 4B3SH 1Z2PX 1KC7A 1JIHA 4MTDA 4AQYH 4LFBH 3BQ0A 2AGQA 4YBZB 4QWCA 1MZBA 1T94A 5KFRA 3Q2OA 5CA0F 3PW4A 4TQRA 4EFEA 4PDBA 1CQJB 1I94H 4IHJF 5KFFA 2J6UA 2X0SA 2YZGA 3HB9A 3RB4A 5KFTA 1BGWA 3J81W 4C5AA 2V4QA 4DV3H 2W7PA 4C5CA 4LSXA 1VBHA 4UCOA 2R6FA 5KG0A 5KFCA 3BABA 4C5BA 3KHGA 3V6HA 5KFZA 3N6XA 3RBEA 4YAKB 1WR2A 5KG1A 1K83A 5IP7G 3RGZA 2ZDHA 2ASLA 1N32H 1AUVA 1WCMG 2WB1E 2YRXA 3FMAA 4JI2H 2VUGA 3Q8SB 4G3IA 1BXRA 4YHHH 4UCVA 3T1HH 1JX4A 4QJFA 4JI8H 3G6VA 2FKLA 4JI5H 4A3CG 5KFHA 1TWGA 4O2BF 3KHRA 3KALA 4GKKH 2W71A 1S9FA 2JA5G 5KFJA 4YB8B 2W9BA 2JEJA 2R85A 2VQEH 2YW2A 4IRKA 2R84A 4MAMA 2FJZA 3PVXA 2WAQE 4RNNA 1W96A 3OTOH 4E4TA 2JA6G 3HKZE 3GV8B 2PMZE 4ECYA 5LXTF 3RGXA 4LSAA 4R8UA 1TWCA 4C2MA 5C1OA 4FBUA 3JSLA 4Q44A 2SCUB 3MWMA 1XNQH 4BY7G 4A93G 3UQ8A 4O4LF 4LFCH 4A3FG 3HOVG 2R93A 2VUMA 4DR7H 4QWEA 5BMVF 1UNNC 3GIJA 1VBGA 3L2PA 3M9OB 2ZM6H 4LH7A 4XYLB 1JXLA 2JA7G 4EG0A 2R86A 3G6YA 4ZI7F 3GTKA 3CVZA 4A3LG 1V4YA 1JKJB 3GIMA 3PO2G 3JAMW 1GLVA 4J9PA 3OHAA 5L1JA 2ASJA 2UVWA 5D1OB 2YU9A 1GSHA 3JZIA 4ED7A 4MV1A 3V6JA 1XMQH 3L4JA 4EBDA 2IMWP 4MV4A 4IZOA 4F4XA 5CA1F 1GYFA 2J9GA 4MV6A 1EYZA 2UUAH 5KG5A 3PW7A 3OHBA 3GTQA 2ALZA 1IOVA 3H20A 2E2HA 1Y1WG 2W6MA 4A3MG 4B3TH 4EBCA 3HXLA 3GTGA 4ECXA 1TAEA 4IWYA 1I7NA 5KT3A 4LF6H 2GLTA 4Y8VB 3TQTA 1JLLB 4YAJB 5HV6A 4ECQA 5DGAA 4JI1H 3MFIA 4NXMH 3RB3A 1I50A 5JUMA 3V6KA 2ATLA 4EEYA 2C22A 2DZDA 4JUZA 2E2IA 4I7HA 4AYBE 2HGSA 4A3JG 4A2BA 4FBTA 5IYZF 1DV2A 5EZYF 3WO0A 4MA5A 4XX0B 4A3EG 2C2EA 1AN7A 1A9XA 1JDBB 5GONF 5DGBA 2JA5A 3KAJA 3T5LA 4A3KG 5FPRA 3VMMA 1FKAH 1I3QA 3F8NA 3RAQA 2W9AA 4DL2A 4LF4H 2PVPA 5LMNH 1K1QA 3LWBA 5KFAA 4DR5H 2FLPA 1VAJA 2RGVA 3HOUG 2UXBH 2HVRA 3H4DA 4IR1A 4DV7H 3AYHB 2JA6A 1KJQA 2V5AA 2WB1A 4EYIB 4JV2A 3K5IA 1R9TA 1EUCB 5KFBA 1Y1WA 5KFUA 4Q8FA 2AU0A 3GLKA 5BR8H 3HOXG 5C1PA 3QZ8A 5D8DA 1X9NA 1TWHA 4DR6H 1S0NA 4X66H 3WNZA 4CC5A 3C0FB 4O3NA 1Z2NX 4O3QA 5KFVA 5KFYA 3ETHA 3TIGA 2R8HA 4J9KA 2JA7A 2WAQA 1FJGH 3H0GG 3I12A 3HKZA 1B33N 2XC9A 3GIIA 1J5EH 2PMZA 3E5NA 2P0AA 1HNXH 4LH6A 4DL4A 2PN1A 5IP9G 2C35B 3Q1KA 1SYXB 2OWOA 4ECZA 5D1OA 4Q0YA 2XCLA 5LOVF 4RB3C 3QFFA 2W7OA 5C8YF 2YS6A 4A2AA 2NU7B 3Q8PB 4EYHB 3VPBA 3R5HA 4DR1H 4LF9H 3GTOA 2M05A 2WTFA 5LMUH 4J9SA 4QIWE 5DQIA 2W57A 3K3VA 2R8JA 1KEEA 2FB9A 2I87A 5CAEB 2BQRA 5K2MA 5DQHA 4JV5H 1AUXA 2YZNA 1PX2A 2XGQA 3MFHA 2AGPA 1RYRA 2E5LH 5L9XA 4NXNH 3PW5A 3H40A 2R8IA 2ZDGA 4O3PA 4A3BG 3N42B 5IWAH 4EGJA 1UC9A 1GGOA 4A3IG 1M6VA 2AGOA 1XMOH 4RAZA 1IBLH 4JI7H 4MV9A 4UFZA 5F9LA 4HQ6A 1T3NA 1Y1VG 4FU0A 4J9OA 3K3PA 1N56A 4YR0A 2VQDA 4RNOA 4EEQA 1E4EB 2AQ4A 1HNWH 3K5HA 4BBSG 4RUAA 2FE3A 3T5KA 3MR6A
chains in the Genus database with same CATH topology
2FKLA 1OWTA 2M05A 2FK3A 2FK1A 2FMAA 2FK2A 3KTMA 4PWQA 2FJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKL A;  1OWT A;  2M05 A;  2FK3 A;  2FK1 A;  2FMA A;  2FK2 A;  3KTM A;  4PWQ A;  2FJZ A; 
#chains in the Genus database with same CATH topology
 3PO3 G;  2UXD H;  4DR4 H;  2FMA A;  4ZQI A;  2W70 A;  3IG0 A;  4ZOL F;  5KFM A;  5DG8 A;  4O3O A;  4XYM B;  5KFP A;  1ULZ A;  4FS1 A;  5L1I A;  1WSC A;  4LF5 H;  1M0W A;  4XZ3 B;  2DPI A;  1S68 A;  3BQ1 A;  4IRD A;  4AYB A;  2W9C B;  4YR3 A;  4QW9 A;  2O03 A;  4UCT A;  2BQU A;  3T5J A;  3RB6 A;  4DV2 H;  2R7Z G;  1E4F T;  2R82 A;  5KG6 A;  2BQ3 A;  2Q2U A;  2R8G A;  2PBZ A;  1I6U A;  2V9W A;  3H0G A;  2FPG B;  1CS0 A;  5KFO A;  2C2D A;  3J80 W;  5J2U F;  1N33 H;  4YY3 H;  2VQF H;  4ED3 A;  1K1S A;  4QWB A;  2ZJT A;  1OWT A;  2VPS A;  5F9N A;  5BPF A;  3EPI A;  2XCP A;  3BA9 A;  3BJY A;  4ECW A;  2HJW A;  2RDJ A;  1IBM H;  4MTE A;  4ED1 A;  3G8C A;  2JEG A;  3R23 A;  4UCU A;  5DQG A;  2OLS A;  2W8L A;  1A0I A;  2F4V H;  4I4T F;  5EWG A;  4DV5 H;  2J6S A;  3R5F A;  4K0K H;  3PR4 A;  1ZHS A;  5C3E G;  3FKI A;  1ZHQ A;  1L2Z A;  1ZET A;  4JI3 H;  3T1Y H;  5KFK A;  3OUZ A;  3FDS A;  1S03 G;  4JYA H;  3GTP A;  3NGD A;  3GTM A;  3N41 B;  1E4G T;  2W6Z A;  4Q45 A;  2NVY A;  1Y1V A;  5C4X G;  4DL7 A;  1S0O A;  4O3S A;  2YS7 A;  5LA6 F;  3LML A;  1V9P A;  4ED0 A;  2CZG A;  4X65 H;  1E4E A;  4DUY H;  4F4W A;  4QIW A;  2XD4 A;  2VPQ A;  5DLG A;  4ECR A;  5KFE A;  3BQ2 A;  2FLN A;  3V4Z A;  3RV4 A;  4J0M A;  2DLN A;  3RV3 A;  4ED2 A;  3SI8 A;  4Q8E A;  5EWF A;  3RJ0 A;  5DG9 A;  3U9S A;  2WDT A;  2W6O A;  3PW2 A;  1Z2O X;  1TA8 A;  1DIK A;  4M7E A;  2W9C A;  1GSA A;  3KHH A;  2W6Q A;  4YP3 A;  5DLF A;  3WO1 A;  1VKZ A;  5LP6 F;  5KT2 A;  4DV0 H;  3RFC A;  5KFI A;  2JA8 G;  4O4I F;  2R7Z A;  2HHH H;  3PZP A;  3GIK A;  3QZ7 A;  1GO3 E;  2R87 A;  4ZHQ F;  3H4B A;  4ED6 A;  3Q8R B;  3MR5 A;  3JRX A;  5KKN B;  3UFX B;  2NU8 B;  2YYA A;  3GID A;  3RF2 A;  5KT4 A;  3IN5 A;  5KFN A;  2C28 A;  5JQW A;  4QWD A;  1KJJ A;  4ETS A;  5IYD G;  2ZDQ A;  4YR2 A;  4YJ2 F;  4DR2 H;  3MJF A;  1DV1 A;  1W93 A;  2RGR A;  2VR1 A;  1KJ8 A;  3TII A;  5KFW A;  3EYY A;  3GTL A;  1V51 A;  2CW7 A;  1PK8 A;  2XIG A;  4L1K A;  4A3G G;  3BAA A;  2R7M A;  3TIN A;  1Y14 B;  4LF7 H;  2B63 A;  3M4I A;  4J9R A;  5FPO A;  2JEI A;  4HNV A;  4MV7 A;  4CC6 A;  5FD5 A;  2CW8 A;  4TV8 F;  1CQI B;  2Y0S E;  3R5X A;  4LMY A;  3JRW A;  4GKJ H;  2CKZ B;  4F4Z A;  3GIP A;  3ORQ A;  1GSO A;  4B3M H;  2FK3 A;  4X62 H;  3FKI G;  4RB2 C;  3DF7 A;  5KFQ A;  4FS2 A;  4KHP H;  4J9N A;  5FJ8 G;  1FVI A;  2YZM A;  2UUC H;  4QW8 A;  4ECV A;  5FLX W;  4RZQ A;  3GIL A;  1KJ9 A;  1RJR A;  1M7J A;  5EOY A;  5KG3 A;  5KG2 A;  4A3D G;  3VPC A;  3RTX A;  4X64 H;  2QYZ A;  3Q8Q B;  5HBR B;  4GLX A;  3PR5 B;  4BBR G;  4RAY A;  1RJQ A;  2NU9 B;  4I50 F;  2IP4 A;  4U7C A;  2IA6 A;  4JI6 H;  2R92 A;  5KFG A;  5LL6 b;  2I80 A;  5FLM G;  2FLL A;  4GC7 A;  4ED8 A;  4TUY F;  5EDW A;  5T14 A;  4RB1 A;  4UCR A;  3V4S A;  4DL3 A;  4DL5 A;  5CB4 F;  4APM A;  5DG7 A;  1KJI A;  1BJT A;  1B6S A;  2NU6 B;  4RU9 A;  3OUU A;  2WE6 A;  5A2Q W;  3MWE A;  1IBK H;  5KT5 A;  2JEF A;  3N44 B;  5JH7 F;  5JVL A;  3RBD A;  2R7K A;  2BR0 A;  3KHL A;  1RJP A;  4O4H F;  2C00 A;  4MV8 A;  4EGQ A;  2GPS A;  2KSW A;  3MR3 A;  2UVV A;  4DV6 H;  4DLK A;  1RK5 A;  5I47 A;  5LYJ F;  5L1K A;  5IT9 W;  2W8K A;  2UVR A;  3GQC A;  4DUZ H;  5C44 G;  4FM9 A;  1O75 A;  5KG4 A;  1XDN A;  4MA0 A;  4YJ3 F;  2YL2 A;  3MR2 A;  5H80 A;  5C5J A;  4DL6 A;  2Q2T A;  1ZQ7 A;  2GPW A;  5BPH A;  5KFS A;  4JV1 A;  4I55 F;  5IYB G;  5KX5 F;  4QWA A;  3PW0 A;  1HR0 H;  2CQY A;  1I7L A;  4F4Y A;  3HBL A;  1BNC A;  4LF8 H;  4WBN F;  1DGS A;  2UU9 H;  4F50 A;  2FPI B;  5EWE A;  2J6T A;  2B63 G;  1JDE A;  1RK6 A;  2YCH A;  3HOW G;  1CE8 A;  4BWS C;  1KBL A;  1WH2 A;  2VOB A;  3RUP A;  4IR9 A;  4DR3 H;  2FK1 A;  2C2R A;  2WYO A;  4IWX A;  3PN1 A;  4TQS A;  3RAX A;  5KT6 A;  4O2A F;  2XCA A;  1S10 A;  2VA3 A;  5KG7 A;  4Q43 A;  4U6P A;  3H3V H;  3GIQ A;  1XNR H;  3G6X A;  5IYC G;  4RZR A;  2NUA B;  5KFL A;  4DV4 H;  2UXC H;  5L1L A;  4ECT A;  4JI0 H;  2XGP A;  4WD3 A;  2RF4 A;  3I4M G;  2NVX A;  2Y0S A;  3ETJ A;  3GV5 B;  1N36 H;  2R8K A;  4PWQ A;  3N43 B;  4R7R A;  4EFB A;  5J2T F;  2DIK A;  2W6N A;  2QK4 A;  2R92 G;  4RB0 A;  1B04 A;  1SCU B;  3KTM A;  4DV1 H;  4JI4 H;  1VS0 A;  1SEI A;  4RNM A;  4ECS A;  4HR7 A;  2YRW A;  4UCS A;  4IRC A;  3OSN A;  4IAJ A;  4J9Q A;  3M9N B;  4J9M A;  3ORR A;  4M9U A;  2FK2 A;  2R7N A;  3JSN A;  1WCM A;  5JVD F;  3RB0 A;  4NLG A;  1C30 A;  4BY1 G;  2V58 A;  5FD6 A;  2R7L A;  3EPG A;  1TWA A;  4GC6 A;  4ECU A;  2DPJ A;  4RUC A;  2FPP B;  2IBK A;  1T36 A;  2FP4 B;  4LFA H;  1UC8 A;  3BA8 A;  2RDI A;  3N8D A;  3J7A K;  5KT7 A;  4J9L A;  2I8C A;  3GTJ A;  3BG5 A;  3LP8 A;  3RIZ A;  3OSP A;  4EBE A;  3VPD A;  4JV0 A;  3I4N G;  1N34 H;  5KFX A;  3KXY T;  4TV9 F;  3U9T A;  1S97 A;  1HNZ H;  2V59 A;  3MWD A;  1C3O A;  2W9B B;  2UVU A;  3HOZ G;  3SE7 A;  1S0M A;  3N40 P;  4ME6 A;  3TQ1 A;  4OX9 H;  1TWF A;  1IOW A;  3M9M B;  1B6R A;  4R8U B;  1EUD B;  4HYK A;  2VA2 A;  4BXX G;  3GV7 B;  4HNT A;  2DWC A;  1EHI A;  3CQZ A;  2V4R A;  1SFO A;  4B3R H;  1EZ1 A;  5KFD A;  4O3R A;  4MV3 A;  3L4K A;  3HOY G;  5D1P A;  2VUM G;  2UUB H;  2R93 G;  1RYS A;  2ASD A;  2HVS A;  2OH2 A;  4YQW A;  2HVQ A;  1P8L A;  3T5H A;  1M0T A;  2W6P A;  2MCT A;  3KAK A;  4HNU A;  1N48 A;  4B3S H;  1Z2P X;  1KC7 A;  1JIH A;  4MTD A;  4AQY H;  4LFB H;  3BQ0 A;  2AGQ A;  4YBZ B;  4QWC A;  1MZB A;  1T94 A;  5KFR A;  3Q2O A;  5CA0 F;  3PW4 A;  4TQR A;  4EFE A;  4PDB A;  1CQJ B;  1I94 H;  4IHJ F;  5KFF A;  2J6U A;  2X0S A;  2YZG A;  3HB9 A;  3RB4 A;  5KFT A;  1BGW A;  3J81 W;  4C5A A;  2V4Q A;  4DV3 H;  2W7P A;  4C5C A;  4LSX A;  1VBH A;  4UCO A;  2R6F A;  5KG0 A;  5KFC A;  3BAB A;  4C5B A;  3KHG A;  3V6H A;  5KFZ A;  3N6X A;  3RBE A;  4YAK B;  1WR2 A;  5KG1 A;  1K83 A;  5IP7 G;  3RGZ A;  2ZDH A;  2ASL A;  1N32 H;  1AUV A;  1WCM G;  2WB1 E;  2YRX A;  3FMA A;  4JI2 H;  2VUG A;  3Q8S B;  4G3I A;  1BXR A;  4YHH H;  4UCV A;  3T1H H;  1JX4 A;  4QJF A;  4JI8 H;  3G6V A;  2FKL A;  4JI5 H;  4A3C G;  5KFH A;  1TWG A;  4O2B F;  3KHR A;  3KAL A;  4GKK H;  2W71 A;  1S9F A;  2JA5 G;  5KFJ A;  4YB8 B;  2W9B A;  2JEJ A;  2R85 A;  2VQE H;  2YW2 A;  4IRK A;  2R84 A;  4MAM A;  2FJZ A;  3PVX A;  2WAQ E;  4RNN A;  1W96 A;  3OTO H;  4E4T A;  2JA6 G;  3HKZ E;  3GV8 B;  2PMZ E;  4ECY A;  5LXT F;  3RGX A;  4LSA A;  4R8U A;  1TWC A;  4C2M A;  5C1O A;  4FBU A;  3JSL A;  4Q44 A;  2SCU B;  3MWM A;  1XNQ H;  4BY7 G;  4A93 G;  3UQ8 A;  4O4L F;  4LFC H;  4A3F G;  3HOV G;  2R93 A;  2VUM A;  4DR7 H;  4QWE A;  5BMV F;  1UNN C;  3GIJ A;  1VBG A;  3L2P A;  3M9O B;  2ZM6 H;  4LH7 A;  4XYL B;  1JXL A;  2JA7 G;  4EG0 A;  2R86 A;  3G6Y A;  4ZI7 F;  3GTK A;  3CVZ A;  4A3L G;  1V4Y A;  1JKJ B;  3GIM A;  3PO2 G;  3JAM W;  1GLV A;  4J9P A;  3OHA A;  5L1J A;  2ASJ A;  2UVW A;  5D1O B;  2YU9 A;  1GSH A;  3JZI A;  4ED7 A;  4MV1 A;  3V6J A;  1XMQ H;  3L4J A;  4EBD A;  2IMW P;  4MV4 A;  4IZO A;  4F4X A;  5CA1 F;  1GYF A;  2J9G A;  4MV6 A;  1EYZ A;  2UUA H;  5KG5 A;  3PW7 A;  3OHB A;  3GTQ A;  2ALZ A;  1IOV A;  3H20 A;  2E2H A;  1Y1W G;  2W6M A;  4A3M G;  4B3T H;  4EBC A;  3HXL A;  3GTG A;  4ECX A;  1TAE A;  4IWY A;  1I7N A;  5KT3 A;  4LF6 H;  2GLT A;  4Y8V B;  3TQT A;  1JLL B;  4YAJ B;  5HV6 A;  4ECQ A;  5DGA A;  4JI1 H;  3MFI A;  4NXM H;  3RB3 A;  1I50 A;  5JUM A;  3V6K A;  2ATL A;  4EEY A;  2C22 A;  2DZD A;  4JUZ A;  2E2I A;  4I7H A;  4AYB E;  2HGS A;  4A3J G;  4A2B A;  4FBT A;  5IYZ F;  1DV2 A;  5EZY F;  3WO0 A;  4MA5 A;  4XX0 B;  4A3E G;  2C2E A;  1AN7 A;  1A9X A;  1JDB B;  5GON F;  5DGB A;  2JA5 A;  3KAJ A;  3T5L A;  4A3K G;  5FPR A;  3VMM A;  1FKA H;  1I3Q A;  3F8N A;  3RAQ A;  2W9A A;  4DL2 A;  4LF4 H;  2PVP A;  5LMN H;  1K1Q A;  3LWB A;  5KFA A;  4DR5 H;  2FLP A;  1VAJ A;  2RGV A;  3HOU G;  2UXB H;  2HVR A;  3H4D A;  4IR1 A;  4DV7 H;  3AYH B;  2JA6 A;  1KJQ A;  2V5A A;  2WB1 A;  4EYI B;  4JV2 A;  3K5I A;  1R9T A;  1EUC B;  5KFB A;  1Y1W A;  5KFU A;  4Q8F A;  2AU0 A;  3GLK A;  5BR8 H;  3HOX G;  5C1P A;  3QZ8 A;  5D8D A;  1X9N A;  1TWH A;  4DR6 H;  1S0N A;  4X66 H;  3WNZ A;  4CC5 A;  3C0F B;  4O3N A;  1Z2N X;  4O3Q A;  5KFV A;  5KFY A;  3ETH A;  3TIG A;  2R8H A;  4J9K A;  2JA7 A;  2WAQ A;  1FJG H;  3H0G G;  3I12 A;  3HKZ A;  1B33 N;  2XC9 A;  3GII A;  1J5E H;  2PMZ A;  3E5N A;  2P0A A;  1HNX H;  4LH6 A;  4DL4 A;  2PN1 A;  5IP9 G;  2C35 B;  3Q1K A;  1SYX B;  2OWO A;  4ECZ A;  5D1O A;  4Q0Y A;  2XCL A;  5LOV F;  4RB3 C;  3QFF A;  2W7O A;  5C8Y F;  2YS6 A;  4A2A A;  2NU7 B;  3Q8P B;  4EYH B;  3VPB A;  3R5H A;  4DR1 H;  4LF9 H;  3GTO A;  2M05 A;  2WTF A;  5LMU H;  4J9S A;  4QIW E;  5DQI A;  2W57 A;  3K3V A;  2R8J A;  1KEE A;  2FB9 A;  2I87 A;  5CAE B;  2BQR A;  5K2M A;  5DQH A;  4JV5 H;  1AUX A;  2YZN A;  1PX2 A;  2XGQ A;  3MFH A;  2AGP A;  1RYR A;  2E5L H;  5L9X A;  4NXN H;  3PW5 A;  3H40 A;  2R8I A;  2ZDG A;  4O3P A;  4A3B G;  3N42 B;  5IWA H;  4EGJ A;  1UC9 A;  1GGO A;  4A3I G;  1M6V A;  2AGO A;  1XMO H;  4RAZ A;  1IBL H;  4JI7 H;  4MV9 A;  4UFZ A;  5F9L A;  4HQ6 A;  1T3N A;  1Y1V G;  4FU0 A;  4J9O A;  3K3P A;  1N56 A;  4YR0 A;  2VQD A;  4RNO A;  4EEQ A;  1E4E B;  2AQ4 A;  1HNW H;  3K5H A;  4BBS G;  4RUA A;  2FE3 A;  3T5K A;  3MR6 A; 
#chains in the Genus database with same CATH homology
 2FKL A;  1OWT A;  2M05 A;  2FK3 A;  2FK1 A;  2FMA A;  2FK2 A;  3KTM A;  4PWQ A;  2FJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...