2FK1A

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'small unit cell' form, cu(ii)-bound
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
b'EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein precursor
publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fk1A00
2FK3A 2FJZA 1OWTA 2M05A 4PWQA 2FMAA 2FK1A 2FK2A 3KTMA 2FKLA
chains in the Genus database with same CATH superfamily
4DL2A 5H80A 4IAJA 4UCOA 3IG0A 2FLPA 3NGDA 1JX4A 1M7JA 3EPIA 1CE8A 4RUCA 4TV8F 2PMZA 3IN5A 3V6KA 5DGAA 3H0GA 3Q8PB 4Q8EA 2VR1A 3G6XA 4GKKH 2F4VH 1AUXA 1KBLA 4A3DG 4UCUA 3GTOA 5KFSA 3KTMA 2W71A 1A9XA 2R86A 4IZOA 4LF8H 4IRCA 3HOUG 2IP4A 5LYJF 4ED0A 4MTEA 4ZI7F 4A3JG 2R7MA 2VUGA 5KT4A 1A0IA 5DQIA 4RB3C 2DPJA 4F50A 1SYXB 4ETSA 2C2DA 1GSHA 4LF4H 4UCTA 4RU9A 4DR3H 1KJQA 4J9OA 2J6SA 3OUZA 3RUPA 2Q2TA 1RJQA 4HR7A 2ZDHA 5KFKA 3GV8B 3RGXA 5EWGA 4FM9A 5KFXA 4EEYA 4EBEA 5C1OA 3I12A 2W70A 1GSAA 4DV3H 3R5FA 3H4DA 4JV2A 5KFEA 4RUAA 4TQSA 4XX0B 4DL5A 3OTOH 4PDBA 2I80A 4A2BA 2HVSA 3PW0A 3N8DA 2W9CA 2JA8G 3ETHA 3JRWA 3GLKA 1OWTA 4JYAH 2Y0SA 3MR3A 2XCPA 2XGPA 4NXMH 4DUZH 2R93A 4A3LG 4ZOLF 4A3CG 2HVQA 4F4WA 4TUYF 5EZYF 4A2AA 4X66H 3J7AK 2YZNA 5CA1F 2V59A 5JVLA 4ECZA 1IBMH 3V4SA 4EYIB 3T5HA 4AYBE 3PR4A 2VOBA 2W9CB 4M7EA 4RZQA 5L9XA 3R5XA 2R7KA 5CAEB 2C2RA 1S03G 3JSNA 3OHBA 4GKJH 4C5CA 3RBDA 4BY7G 1TWAA 4GC7A 2CQYA 2WYOA 5KFOA 2FK1A 1EUCB 5LMUH 4DR5H 3OSNA 1IOWA 1RK5A 1S0MA 4JI0H 3PO2G 1S10A 5J2TF 5KG4A 1KJ9A 3T5JA 5KFZA 4ECXA 1Y1WA 2C35B 4ME6A 2W7PA 4ECQA 5FD6A 3PW2A 2W6NA 3N41B 4C5AA 2C28A 3QZ7A 1JXLA 4LF6H 2RDJA 1UC8A 2C2EA 1GSOA 5IP9G 4CC5A 2NVYA 2W6ZA 4IWYA 4NXNH 4HYKA 3AYHB 3HKZA 2X0SA 3R5HA 1Z2OX 4QIWE 4DV4H 2FP4B 1DV1A 4ED3A 1R9TA 5BR8H 3J80W 5KFAA 2WAQE 3RAQA 2HGSA 5DLFA 4O3SA 4DL3A 3V4ZA 3MR5A 4JV1A 4DL7A 5KFPA 2YZMA 2W9AA 4HNTA 2E5LH 4IR1A 1XNRH 4ECTA 4RNMA 1GYFA 3R23A 5KFYA 5FJ8G 2W7OA 1CQIB 1EYZA 2R92A 2E2IA 2UVVA 3N6XA 3RB6A 2C00A 4U7CA 1TWFA 5KG7A 2W8KA 5KFVA 3MFIA 5KG2A 2ASDA 1K83A 2DZDA 2R8GA 4YY3H 3RTXA 1W93A 3TQ1A 2ATLA 4JI5H 3KHLA 3OHAA 4A3FG 1PK8A 2IMWP 1IOVA 3RFCA 5C5JA 3HOWG 3WO1A 4ZHQF 3GTGA 2XC9A 2FK2A 4YJ3F 2R7ZG 1N32H 4RB2C 3BAAA 2AGOA 4EBDA 1I50A 5KKNB 5KG6A 1O75A 2JA6G 4MTDA 2I8CA 4R7RA 4RZRA 5L1LA 4DV2H 1SCUB 4O4IF 4XYMB 2J6UA 4I55F 2VA3A 4MV6A 1AUVA 3RIZA 4RB1A 4YJ2F 4J9LA 2V4RA 4LF9H 2P0AA 3RF2A 4UCSA 2UVRA 2NU9B 1ZHSA 4MAMA 4MA5A 4JI2H 4O4LF 5BPFA 3TIIA 1J5EH 2UVWA 1TWHA 3JRXA 3GIIA 2Q2UA 3E5NA 1C3OA 4HNVA 2R7NA 4LH7A 3LP8A 4ED6A 3L4KA 4ED2A 5CA0F 3Q8QB 3V6HA 4HQ6A 2B63A 4E4TA 4LFBH 5KG0A 3HB9A 1HNZH 5D1OA 1N34H 3M4IA 3LMLA 4QIWA 3JSLA 3Q8SB 3I4NG 2JA7G 4LSAA 2UUCH 5IYZF 2WAQA 5KFJA 5L1IA 2QYZA 4X62H 5BMVF 3GTQA 2YS7A 4DR2H 1GGOA 5K2MA 1EUDB 2FMAA 4WD3A 5C8YF 4J9QA 5D1OB 4HNUA 1HR0H 2R84A 3BA8A 4TQRA 4YQWA 3GILA 4M9UA 1VKZA 2WE6A 3U9SA 4DV1H 3RB4A 4EGJA 4QW8A 2VQEH 3J81W 3VPDA 2PBZA 5JQWA 3Q2OA 1S9FA 1ULZA 1CQJB 2R93G 1IBKH 4RB0A 4ECRA 4YAJB 2JEIA 5T14A 3PZPA 5KT6A 4O3PA 2FLLA 4LFAH 2ZM6H 4BY1G 5A2QW 3L2PA 3H40A 4LMYA 3RV3A 4LH6A 2J9GA 2CW7A 1UNNC 3K3VA 4ED7A 4DR6H 4Q0YA 4EYHB 2ZDGA 3T5KA 5KFHA 4ED1A 4GC6A 1Z2PX 3SE7A 3VMMA 1B6SA 2W8LA 4YP3A 1IBLH 2SCUB 4YR2A 1XMOH 4DV7H 2V9WA 1V4YA 1E4GT 2NU8B 5FLMG 2BR0A 5C1PA 1TAEA 2R85A 4FBUA 3TQTA 4J9NA 1K1SA 2V4QA 3PW7A 4BBSG 1EZ1A 4B3MH 2JEJA 2YRWA 3RB0A 2R87A 4X65H 1Y1WG 5FD5A 1JDBB 4JI6H 3CQZA 3HOXG 2JA5A 4Q44A 4RNOA 2CZGA 3ORQA 4MV1A 5KFQA 1T36A 1ZQ7A 5IP7G 3LWBA 5LL6b 5C3EG 4QW9A 2OWOA 4JI1H 2CW8A 3K3PA 4JUZA 5KX5F 1RJRA 4APMA 4DV6H 4DR1H 4I4TF 4B3SH 2AGQA 2RDIA 3WNZA 1M0TA 4J0MA 1S0OA 5C4XG 1KEEA 4A3MG 4F4YA 1VBGA 4DR7H 3PN1A 2FPPB 5FPRA 2VUMA 3I4MG 2UXDH 2BQRA 2DWCA 1UC9A 2R92G 2PMZE 4XZ3B 3KAKA 5KFIA 4YR3A 2BQ3A 3C0FB 4Q8FA 3KHHA 4YHHH 2W9BA 1WCMG 5JUMA 3KAJA 3GTMA 1JKJB 2MCTA 3KXYT 4YAKB 4ECUA 1Y1VA 4EFEA 5IYDG 3M9MB 4OX9H 5IYCG 1DGSA 4F4ZA 2FKLA 2GLTA 1DV2A 1N36H 4J9RA 3FKIA 3MWDA 2AU0A 4G3IA 1KJJA 2UU9H 3HOVG 3TINA 3UQ8A 3GTJA 1HNWH 4NLGA 2W9BB 4IRDA 4O2AF 4O3NA 1T3NA 4X64H 5KFBA 2C22A 3BJYA 4QWAA 5F9LA 3MWEA 4UCRA 4RNNA 4MV7A 2IBKA 4DL6A 3GIDA 4AYBA 3U9TA 1S0NA 4A3EG 1I7NA 5L1JA 1E4EA 2I87A 1GO3E 2W6MA 2XD4A 4UCVA 5D1PA 4ZQIA 5EDWA 4QWDA 3ETJA 3EYYA 4ECSA 4XYLB 1KC7A 1RYRA 3DF7A 4I50F 2NUAB 3M9NB 2J6TA 1RJPA 1FKAH 3MWMA 4DLKA 2RGRA 4DUYH 2WB1E 3KHRA 5LOVF 1DIKA 1E4EB 1BJTA 1BNCA 3F8NA 3H0GG 3GIJA 3RJ0A 3M9OB 1GLVA 2ALZA 5EWFA 4BBRG 4KHPH 3H20A 5DQHA 5FLXW 1B6RA 2B63G 1L2ZA 1WH2A 3SI8A 2FB9A 5C44G 4TV9F 2W6PA 4EG0A 4LF7H 4IR9A 2VQFH 1X9NA 3HOZG 4BXXG 2KSWA 2YZGA 5CB4F 5I47A 3PW4A 5EOYA 3OUUA 2JEFA 2XCAA 4L1KA 5KG5A 2ASLA 3TIGA 5J2UF 5KT7A 4QWBA 4EGQA 5DQGA 4C2MA 4B3RH 5KFLA 3PW5A 4JI7H 3MFHA 4IHJF 2E2HA 4EFBA 3GV5B 3L4JA 2M05A 5DG7A 3WO0A 5KFWA 3RAXA 1VS0A 5DLGA 3HXLA 2ZJTA 2UXCH 2R8JA 4C5BA 3GIQA 3HOYG 3GTKA 2DIKA 4QJFA 4U6PA 2DLNA 1BGWA 4A93G 3HBLA 3HKZE 4I7HA 2XIGA 2JEGA 4QWEA 2V58A 4O3QA 5KFNA 2FLNA 1KJ8A 5EWEA 2OLSA 1AN7A 1CS0A 3G8CA 5KFGA 3G6VA 5F9NA 5HBRB 2RF4A 2WDTA 2FE3A 1WSCA 4A3KG 2JA7A 1B33N 4ECWA 2OH2A 3RV4A 2YU9A 1T94A 3RGZA 4K0KH 1XNQH 4ECYA 3FDSA 1W96A 1HNXH 2R8HA 4R8UA 1XDNA 1VBHA 4Y8VB 3GIMA 1N56A 1TWCA 4QWCA 1JDEA 3K5IA 1I7LA 5LP6F 1I3QA 1E4FT 4MV3A 3RB3A 3GIPA 4LF5H 1I6UA 1MZBA 3GQCA 4JI8H 5KT2A 4A3BG 4O2BF 1TA8A 2NU7B 5KFCA 4EBCA 5DG8A 2O03A 2FJZA 3N42B 5HV6A 4R8UB 2XCLA 5D8DA 2JA5G 4IRKA 5KFDA 3BQ1A 2WB1A 2CKZB 4EEQA 1N33H 2YW2A 2HVRA 3BABA 4DR4H 5KFUA 4JI3H 3UFXB 1SEIA 1Y14B 3T1HH 1FJGH 2FPIB 1XMQH 5FPOA 2IA6A 4O4HF 1K1QA 3GV7B 4F4XA 3QZ8A 1KJIA 4J9SA 3VPBA 3KHGA 2XGQA 5GONF 2NU6B 3BA9A 5KT3A 2R82A 3BQ0A 1V9PA 3GTPA 2YL2A 2YYAA 4GLXA 2VUMG 3GIKA 5IYBG 4JV5H 3N44B 5LXTF 4MV8A 1C30A 2YS6A 4J9KA 1FVIA 3MR6A 4YB8B 2UXBH 5KG1A 4FBTA 3MJFA 4BWSC 4J9MA 3V6JA 3N40P 4DL4A 2YRXA 1Y1VG 3OSPA 1Z2NX 4O3RA 2NVXA 5LMNH 4PWQA 1N48A 3FMAA 3K5HA 1S97A 2RGVA 3FKIG 1BXRA 4IWXA 3EPGA 4A3IG 4DV5H 2HHHH 3T5LA 3PVXA 2VPSA 2R8KA 4CC6A 4FS1A 2DPIA 2FK3A 4MV9A 2AGPA 5JH7F 3GTLA 2GPSA 5KFFA 2UUBH 4UFZA 3T1YH 1M0WA 2R6FA 4LFCH 1RK6A 2VA2A 5LA6F 3MR2A 2VPQA 2ZDQA 3JZIA 3RBEA 4A3GG 2VQDA 5L1KA 1B04A 4YR0A 5KFRA 3VPCA 4RAZA 4DV0H 1ZHQA 1WCMA 1V51A 1M6VA 5KFTA 1PX2A 5DGBA 4WBNF 1VAJA 1TWGA 3Q1KA 3G6YA 1EHIA 2QK4A 4ED8A 3BQ2A 5KG3A 2BQUA 4O3OA 5JVDF 5IT9W 4MV4A 4AQYH 2YCHA 4Q45A 1P8LA 1S68A 2FPGB 2W57A 2Y0SE 2HJWA 2PN1A 4ECVA 1RYSA 4YBZB 2V5AA 4Q43A 4J9PA 2GPWA 5KT5A 5DG9A 2UUAH 2R7LA 1JIHA 4LSXA 3H3VH 4B3TH 4JV0A 2AQ4A 1SFOA 2R8IA 4JI4H 2WTFA 2PVPA 5IWAH 1I94H 3N43B 1ZETA 2R7ZA 3BG5A 2UVUA 3Q8RB 5KFMA 3ORRA 1JLLB 4FS2A 2JA6A 3CVZA 4FU0A 4RAYA 2W6QA 2W6OA 2ASJA 1WR2A 3JAMW 3KALA 4MA0A 3QFFA 3PO3G 5BPHA 3H4BA 3PR5B
chains in the Genus database with same CATH topology
2FK3A 2FJZA 1OWTA 2M05A 4PWQA 2FMAA 2FK1A 2FK2A 3KTMA 2FKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FK3 A;  2FJZ A;  1OWT A;  2M05 A;  4PWQ A;  2FMA A;  2FK1 A;  2FK2 A;  3KTM A;  2FKL A; 
#chains in the Genus database with same CATH topology
 4DL2 A;  5H80 A;  4IAJ A;  4UCO A;  3IG0 A;  2FLP A;  3NGD A;  1JX4 A;  1M7J A;  3EPI A;  1CE8 A;  4RUC A;  4TV8 F;  2PMZ A;  3IN5 A;  3V6K A;  5DGA A;  3H0G A;  3Q8P B;  4Q8E A;  2VR1 A;  3G6X A;  4GKK H;  2F4V H;  1AUX A;  1KBL A;  4A3D G;  4UCU A;  3GTO A;  5KFS A;  3KTM A;  2W71 A;  1A9X A;  2R86 A;  4IZO A;  4LF8 H;  4IRC A;  3HOU G;  2IP4 A;  5LYJ F;  4ED0 A;  4MTE A;  4ZI7 F;  4A3J G;  2R7M A;  2VUG A;  5KT4 A;  1A0I A;  5DQI A;  4RB3 C;  2DPJ A;  4F50 A;  1SYX B;  4ETS A;  2C2D A;  1GSH A;  4LF4 H;  4UCT A;  4RU9 A;  4DR3 H;  1KJQ A;  4J9O A;  2J6S A;  3OUZ A;  3RUP A;  2Q2T A;  1RJQ A;  4HR7 A;  2ZDH A;  5KFK A;  3GV8 B;  3RGX A;  5EWG A;  4FM9 A;  5KFX A;  4EEY A;  4EBE A;  5C1O A;  3I12 A;  2W70 A;  1GSA A;  4DV3 H;  3R5F A;  3H4D A;  4JV2 A;  5KFE A;  4RUA A;  4TQS A;  4XX0 B;  4DL5 A;  3OTO H;  4PDB A;  2I80 A;  4A2B A;  2HVS A;  3PW0 A;  3N8D A;  2W9C A;  2JA8 G;  3ETH A;  3JRW A;  3GLK A;  1OWT A;  4JYA H;  2Y0S A;  3MR3 A;  2XCP A;  2XGP A;  4NXM H;  4DUZ H;  2R93 A;  4A3L G;  4ZOL F;  4A3C G;  2HVQ A;  4F4W A;  4TUY F;  5EZY F;  4A2A A;  4X66 H;  3J7A K;  2YZN A;  5CA1 F;  2V59 A;  5JVL A;  4ECZ A;  1IBM H;  3V4S A;  4EYI B;  3T5H A;  4AYB E;  3PR4 A;  2VOB A;  2W9C B;  4M7E A;  4RZQ A;  5L9X A;  3R5X A;  2R7K A;  5CAE B;  2C2R A;  1S03 G;  3JSN A;  3OHB A;  4GKJ H;  4C5C A;  3RBD A;  4BY7 G;  1TWA A;  4GC7 A;  2CQY A;  2WYO A;  5KFO A;  2FK1 A;  1EUC B;  5LMU H;  4DR5 H;  3OSN A;  1IOW A;  1RK5 A;  1S0M A;  4JI0 H;  3PO2 G;  1S10 A;  5J2T F;  5KG4 A;  1KJ9 A;  3T5J A;  5KFZ A;  4ECX A;  1Y1W A;  2C35 B;  4ME6 A;  2W7P A;  4ECQ A;  5FD6 A;  3PW2 A;  2W6N A;  3N41 B;  4C5A A;  2C28 A;  3QZ7 A;  1JXL A;  4LF6 H;  2RDJ A;  1UC8 A;  2C2E A;  1GSO A;  5IP9 G;  4CC5 A;  2NVY A;  2W6Z A;  4IWY A;  4NXN H;  4HYK A;  3AYH B;  3HKZ A;  2X0S A;  3R5H A;  1Z2O X;  4QIW E;  4DV4 H;  2FP4 B;  1DV1 A;  4ED3 A;  1R9T A;  5BR8 H;  3J80 W;  5KFA A;  2WAQ E;  3RAQ A;  2HGS A;  5DLF A;  4O3S A;  4DL3 A;  3V4Z A;  3MR5 A;  4JV1 A;  4DL7 A;  5KFP A;  2YZM A;  2W9A A;  4HNT A;  2E5L H;  4IR1 A;  1XNR H;  4ECT A;  4RNM A;  1GYF A;  3R23 A;  5KFY A;  5FJ8 G;  2W7O A;  1CQI B;  1EYZ A;  2R92 A;  2E2I A;  2UVV A;  3N6X A;  3RB6 A;  2C00 A;  4U7C A;  1TWF A;  5KG7 A;  2W8K A;  5KFV A;  3MFI A;  5KG2 A;  2ASD A;  1K83 A;  2DZD A;  2R8G A;  4YY3 H;  3RTX A;  1W93 A;  3TQ1 A;  2ATL A;  4JI5 H;  3KHL A;  3OHA A;  4A3F G;  1PK8 A;  2IMW P;  1IOV A;  3RFC A;  5C5J A;  3HOW G;  3WO1 A;  4ZHQ F;  3GTG A;  2XC9 A;  2FK2 A;  4YJ3 F;  2R7Z G;  1N32 H;  4RB2 C;  3BAA A;  2AGO A;  4EBD A;  1I50 A;  5KKN B;  5KG6 A;  1O75 A;  2JA6 G;  4MTD A;  2I8C A;  4R7R A;  4RZR A;  5L1L A;  4DV2 H;  1SCU B;  4O4I F;  4XYM B;  2J6U A;  4I55 F;  2VA3 A;  4MV6 A;  1AUV A;  3RIZ A;  4RB1 A;  4YJ2 F;  4J9L A;  2V4R A;  4LF9 H;  2P0A A;  3RF2 A;  4UCS A;  2UVR A;  2NU9 B;  1ZHS A;  4MAM A;  4MA5 A;  4JI2 H;  4O4L F;  5BPF A;  3TII A;  1J5E H;  2UVW A;  1TWH A;  3JRX A;  3GII A;  2Q2U A;  3E5N A;  1C3O A;  4HNV A;  2R7N A;  4LH7 A;  3LP8 A;  4ED6 A;  3L4K A;  4ED2 A;  5CA0 F;  3Q8Q B;  3V6H A;  4HQ6 A;  2B63 A;  4E4T A;  4LFB H;  5KG0 A;  3HB9 A;  1HNZ H;  5D1O A;  1N34 H;  3M4I A;  3LML A;  4QIW A;  3JSL A;  3Q8S B;  3I4N G;  2JA7 G;  4LSA A;  2UUC H;  5IYZ F;  2WAQ A;  5KFJ A;  5L1I A;  2QYZ A;  4X62 H;  5BMV F;  3GTQ A;  2YS7 A;  4DR2 H;  1GGO A;  5K2M A;  1EUD B;  2FMA A;  4WD3 A;  5C8Y F;  4J9Q A;  5D1O B;  4HNU A;  1HR0 H;  2R84 A;  3BA8 A;  4TQR A;  4YQW A;  3GIL A;  4M9U A;  1VKZ A;  2WE6 A;  3U9S A;  4DV1 H;  3RB4 A;  4EGJ A;  4QW8 A;  2VQE H;  3J81 W;  3VPD A;  2PBZ A;  5JQW A;  3Q2O A;  1S9F A;  1ULZ A;  1CQJ B;  2R93 G;  1IBK H;  4RB0 A;  4ECR A;  4YAJ B;  2JEI A;  5T14 A;  3PZP A;  5KT6 A;  4O3P A;  2FLL A;  4LFA H;  2ZM6 H;  4BY1 G;  5A2Q W;  3L2P A;  3H40 A;  4LMY A;  3RV3 A;  4LH6 A;  2J9G A;  2CW7 A;  1UNN C;  3K3V A;  4ED7 A;  4DR6 H;  4Q0Y A;  4EYH B;  2ZDG A;  3T5K A;  5KFH A;  4ED1 A;  4GC6 A;  1Z2P X;  3SE7 A;  3VMM A;  1B6S A;  2W8L A;  4YP3 A;  1IBL H;  2SCU B;  4YR2 A;  1XMO H;  4DV7 H;  2V9W A;  1V4Y A;  1E4G T;  2NU8 B;  5FLM G;  2BR0 A;  5C1P A;  1TAE A;  2R85 A;  4FBU A;  3TQT A;  4J9N A;  1K1S A;  2V4Q A;  3PW7 A;  4BBS G;  1EZ1 A;  4B3M H;  2JEJ A;  2YRW A;  3RB0 A;  2R87 A;  4X65 H;  1Y1W G;  5FD5 A;  1JDB B;  4JI6 H;  3CQZ A;  3HOX G;  2JA5 A;  4Q44 A;  4RNO A;  2CZG A;  3ORQ A;  4MV1 A;  5KFQ A;  1T36 A;  1ZQ7 A;  5IP7 G;  3LWB A;  5LL6 b;  5C3E G;  4QW9 A;  2OWO A;  4JI1 H;  2CW8 A;  3K3P A;  4JUZ A;  5KX5 F;  1RJR A;  4APM A;  4DV6 H;  4DR1 H;  4I4T F;  4B3S H;  2AGQ A;  2RDI A;  3WNZ A;  1M0T A;  4J0M A;  1S0O A;  5C4X G;  1KEE A;  4A3M G;  4F4Y A;  1VBG A;  4DR7 H;  3PN1 A;  2FPP B;  5FPR A;  2VUM A;  3I4M G;  2UXD H;  2BQR A;  2DWC A;  1UC9 A;  2R92 G;  2PMZ E;  4XZ3 B;  3KAK A;  5KFI A;  4YR3 A;  2BQ3 A;  3C0F B;  4Q8F A;  3KHH A;  4YHH H;  2W9B A;  1WCM G;  5JUM A;  3KAJ A;  3GTM A;  1JKJ B;  2MCT A;  3KXY T;  4YAK B;  4ECU A;  1Y1V A;  4EFE A;  5IYD G;  3M9M B;  4OX9 H;  5IYC G;  1DGS A;  4F4Z A;  2FKL A;  2GLT A;  1DV2 A;  1N36 H;  4J9R A;  3FKI A;  3MWD A;  2AU0 A;  4G3I A;  1KJJ A;  2UU9 H;  3HOV G;  3TIN A;  3UQ8 A;  3GTJ A;  1HNW H;  4NLG A;  2W9B B;  4IRD A;  4O2A F;  4O3N A;  1T3N A;  4X64 H;  5KFB A;  2C22 A;  3BJY A;  4QWA A;  5F9L A;  3MWE A;  4UCR A;  4RNN A;  4MV7 A;  2IBK A;  4DL6 A;  3GID A;  4AYB A;  3U9T A;  1S0N A;  4A3E G;  1I7N A;  5L1J A;  1E4E A;  2I87 A;  1GO3 E;  2W6M A;  2XD4 A;  4UCV A;  5D1P A;  4ZQI A;  5EDW A;  4QWD A;  3ETJ A;  3EYY A;  4ECS A;  4XYL B;  1KC7 A;  1RYR A;  3DF7 A;  4I50 F;  2NUA B;  3M9N B;  2J6T A;  1RJP A;  1FKA H;  3MWM A;  4DLK A;  2RGR A;  4DUY H;  2WB1 E;  3KHR A;  5LOV F;  1DIK A;  1E4E B;  1BJT A;  1BNC A;  3F8N A;  3H0G G;  3GIJ A;  3RJ0 A;  3M9O B;  1GLV A;  2ALZ A;  5EWF A;  4BBR G;  4KHP H;  3H20 A;  5DQH A;  5FLX W;  1B6R A;  2B63 G;  1L2Z A;  1WH2 A;  3SI8 A;  2FB9 A;  5C44 G;  4TV9 F;  2W6P A;  4EG0 A;  4LF7 H;  4IR9 A;  2VQF H;  1X9N A;  3HOZ G;  4BXX G;  2KSW A;  2YZG A;  5CB4 F;  5I47 A;  3PW4 A;  5EOY A;  3OUU A;  2JEF A;  2XCA A;  4L1K A;  5KG5 A;  2ASL A;  3TIG A;  5J2U F;  5KT7 A;  4QWB A;  4EGQ A;  5DQG A;  4C2M A;  4B3R H;  5KFL A;  3PW5 A;  4JI7 H;  3MFH A;  4IHJ F;  2E2H A;  4EFB A;  3GV5 B;  3L4J A;  2M05 A;  5DG7 A;  3WO0 A;  5KFW A;  3RAX A;  1VS0 A;  5DLG A;  3HXL A;  2ZJT A;  2UXC H;  2R8J A;  4C5B A;  3GIQ A;  3HOY G;  3GTK A;  2DIK A;  4QJF A;  4U6P A;  2DLN A;  1BGW A;  4A93 G;  3HBL A;  3HKZ E;  4I7H A;  2XIG A;  2JEG A;  4QWE A;  2V58 A;  4O3Q A;  5KFN A;  2FLN A;  1KJ8 A;  5EWE A;  2OLS A;  1AN7 A;  1CS0 A;  3G8C A;  5KFG A;  3G6V A;  5F9N A;  5HBR B;  2RF4 A;  2WDT A;  2FE3 A;  1WSC A;  4A3K G;  2JA7 A;  1B33 N;  4ECW A;  2OH2 A;  3RV4 A;  2YU9 A;  1T94 A;  3RGZ A;  4K0K H;  1XNQ H;  4ECY A;  3FDS A;  1W96 A;  1HNX H;  2R8H A;  4R8U A;  1XDN A;  1VBH A;  4Y8V B;  3GIM A;  1N56 A;  1TWC A;  4QWC A;  1JDE A;  3K5I A;  1I7L A;  5LP6 F;  1I3Q A;  1E4F T;  4MV3 A;  3RB3 A;  3GIP A;  4LF5 H;  1I6U A;  1MZB A;  3GQC A;  4JI8 H;  5KT2 A;  4A3B G;  4O2B F;  1TA8 A;  2NU7 B;  5KFC A;  4EBC A;  5DG8 A;  2O03 A;  2FJZ A;  3N42 B;  5HV6 A;  4R8U B;  2XCL A;  5D8D A;  2JA5 G;  4IRK A;  5KFD A;  3BQ1 A;  2WB1 A;  2CKZ B;  4EEQ A;  1N33 H;  2YW2 A;  2HVR A;  3BAB A;  4DR4 H;  5KFU A;  4JI3 H;  3UFX B;  1SEI A;  1Y14 B;  3T1H H;  1FJG H;  2FPI B;  1XMQ H;  5FPO A;  2IA6 A;  4O4H F;  1K1Q A;  3GV7 B;  4F4X A;  3QZ8 A;  1KJI A;  4J9S A;  3VPB A;  3KHG A;  2XGQ A;  5GON F;  2NU6 B;  3BA9 A;  5KT3 A;  2R82 A;  3BQ0 A;  1V9P A;  3GTP A;  2YL2 A;  2YYA A;  4GLX A;  2VUM G;  3GIK A;  5IYB G;  4JV5 H;  3N44 B;  5LXT F;  4MV8 A;  1C30 A;  2YS6 A;  4J9K A;  1FVI A;  3MR6 A;  4YB8 B;  2UXB H;  5KG1 A;  4FBT A;  3MJF A;  4BWS C;  4J9M A;  3V6J A;  3N40 P;  4DL4 A;  2YRX A;  1Y1V G;  3OSP A;  1Z2N X;  4O3R A;  2NVX A;  5LMN H;  4PWQ A;  1N48 A;  3FMA A;  3K5H A;  1S97 A;  2RGV A;  3FKI G;  1BXR A;  4IWX A;  3EPG A;  4A3I G;  4DV5 H;  2HHH H;  3T5L A;  3PVX A;  2VPS A;  2R8K A;  4CC6 A;  4FS1 A;  2DPI A;  2FK3 A;  4MV9 A;  2AGP A;  5JH7 F;  3GTL A;  2GPS A;  5KFF A;  2UUB H;  4UFZ A;  3T1Y H;  1M0W A;  2R6F A;  4LFC H;  1RK6 A;  2VA2 A;  5LA6 F;  3MR2 A;  2VPQ A;  2ZDQ A;  3JZI A;  3RBE A;  4A3G G;  2VQD A;  5L1K A;  1B04 A;  4YR0 A;  5KFR A;  3VPC A;  4RAZ A;  4DV0 H;  1ZHQ A;  1WCM A;  1V51 A;  1M6V A;  5KFT A;  1PX2 A;  5DGB A;  4WBN F;  1VAJ A;  1TWG A;  3Q1K A;  3G6Y A;  1EHI A;  2QK4 A;  4ED8 A;  3BQ2 A;  5KG3 A;  2BQU A;  4O3O A;  5JVD F;  5IT9 W;  4MV4 A;  4AQY H;  2YCH A;  4Q45 A;  1P8L A;  1S68 A;  2FPG B;  2W57 A;  2Y0S E;  2HJW A;  2PN1 A;  4ECV A;  1RYS A;  4YBZ B;  2V5A A;  4Q43 A;  4J9P A;  2GPW A;  5KT5 A;  5DG9 A;  2UUA H;  2R7L A;  1JIH A;  4LSX A;  3H3V H;  4B3T H;  4JV0 A;  2AQ4 A;  1SFO A;  2R8I A;  4JI4 H;  2WTF A;  2PVP A;  5IWA H;  1I94 H;  3N43 B;  1ZET A;  2R7Z A;  3BG5 A;  2UVU A;  3Q8R B;  5KFM A;  3ORR A;  1JLL B;  4FS2 A;  2JA6 A;  3CVZ A;  4FU0 A;  4RAY A;  2W6Q A;  2W6O A;  2ASJ A;  1WR2 A;  3JAM W;  3KAL A;  4MA0 A;  3QFF A;  3PO3 G;  5BPH A;  3H4B A;  3PR5 B; 
#chains in the Genus database with same CATH homology
 2FK3 A;  2FJZ A;  1OWT A;  2M05 A;  4PWQ A;  2FMA A;  2FK1 A;  2FK2 A;  3KTM A;  2FKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...