2FK1A

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'small unit cell' form, cu(ii)-bound
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Amyloid beta A4 protein precursor
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fk1A00
2FK3A 4PWQA 1OWTA 2M05A 2FK2A 2FJZA 3KTMA 2FK1A 2FMAA 2FKLA
chains in the Genus database with same CATH superfamily
4ZOLF 2PVPA 3PR5B 1RJRA 4A3MG 4IRDA 2WB1E 3CQZA 2GPWA 2FB9A 4O2BF 4DV2H 1GSOA 1E4EA 2VUGA 2YW2A 4MV1A 5T14A 4YB8B 2ZJTA 4J9OA 2AGQA 2UUBH 2OWOA 1M7JA 1JXLA 2FPGB 3K3VA 3U9TA 5KFMA 3RB4A 4YQWA 2XGQA 4ETSA 5CAEB 2AGOA 2UVRA 1VAJA 1GO3E 5KFHA 1KEEA 3IN5A 2UVWA 5FLMG 5KX5F 1RJQA 1TWFA 4GC7A 4FU0A 2CQYA 3BG5A 3VMMA 5JQWA 5KFEA 5KFRA 5J2TF 4LF7H 3KHGA 1SCUB 1CQJB 1TWHA 2VA3A 4RB3C 3J81W 2R87A 5H80A 2W9AA 5D1OB 4IHJF 1W93A 3MWEA 2GLTA 2JEGA 4FBTA 5C4XG 4K0KH 3LMLA 1ULZA 5KFAA 2NUAB 4DLKA 4A3DG 3TINA 4TUYF 3MR6A 4ED7A 4WD3A 4EEYA 1V4YA 1N34H 2W71A 2W6OA 3G6XA 4TV9F 4YR2A 4LF8H 2QYZA 4EFEA 3K3PA 3OSPA 5KT6A 4JV2A 5A2QW 1L2ZA 1N56A 5IYCG 3K5IA 4B3MH 4HQ6A 4JI3H 1XDNA 1I50A 5L9XA 1FVIA 4KHPH 4JI7H 4JI4H 4MV4A 4EGQA 4MV6A 1GYFA 2CW8A 2FK1A 4RAYA 3VPCA 4AYBA 4UCSA 5KFBA 1S03G 4A3IG 1AN7A 1Y1WG 5JVLA 3BJYA 5DGAA 5J2UF 3JSLA 4MV7A 5LL6b 4F4XA 2UXCH 5C5JA 3RUPA 1K83A 2R7MA 4RU9A 4BBRG 4LSXA 4M9UA 5EWEA 4LSAA 3TIGA 3ETHA 3GIMA 3BA9A 3GV7B 3I12A 2M05A 1VS0A 3R5XA 5L1LA 3N41B 2OH2A 4TV8F 4LF6H 1HNWH 3GILA 1E4EB 3Q8QB 4MAMA 3HBLA 2FPPB 4X62H 3PW0A 2FE3A 2DPJA 4JV5H 2PMZA 4ECYA 2E5LH 3RV4A 2QK4A 4PWQA 5FJ8G 3RAXA 1RK6A 3QZ7A 1EZ1A 2UVVA 2VQDA 4C5CA 2W6MA 5JVDF 2ASJA 4UFZA 3RF2A 3Q2OA 3OHBA 2VA2A 2UXBH 4RNNA 3JRXA 2WAQA 5L1IA 4B3RH 2R8JA 5LP6F 4RB2C 5KFVA 2FLPA 3GQCA 3KXYT 4F4YA 1V51A 1JDEA 4XYMB 5KFZA 2AU0A 1TWAA 3KALA 1SEIA 3N43B 1B33N 5KKNB 1N33H 2XC9A 4RB0A 4A3BG 1S97A 1E4GT 2W7OA 4LF9H 3GTQA 2RGVA 2FLLA 4EYIB 3BQ1A 2UUCH 4EYHB 5KFGA 2BQUA 4L1KA 4M7EA 5C8YF 3G6YA 1T36A 5FPOA 4J9QA 3ORRA 4UCTA 5KG7A 5C44G 1ZETA 2YZMA 3HXLA 1IBLH 5D1PA 5K2MA 4QIWE 4QW8A 5C1OA 4Q8EA 4A3CG 2JEJA 3HKZA 4E4TA 5BMVF 4U7CA 3R5FA 2VQFH 1A0IA 3C0FB 5KG4A 4J9SA 2R7ZG 1V9PA 4EBCA 1WSCA 3H20A 4LF5H 4IAJA 1BNCA 1Y1VG 3AYHB 4O4IF 1WH2A 2DZDA 4X65H 3L4JA 1FKAH 1PK8A 3QZ8A 2R8IA 3Q8RB 3RIZA 4DR4H 1ZHSA 4O4HF 1X9NA 3BABA 3G8CA 3HOZG 4BBSG 5KFIA 5KG6A 4BWSC 2YRXA 3KHLA 1CS0A 3JSNA 3DF7A 4DL3A 1VBHA 2R7NA 3MR2A 4ZQIA 3KHRA 3FDSA 4X64H 2HHHH 2IMWP 4IR9A 2VPSA 5L1JA 4ECZA 4O2AF 1KJ8A 3EPGA 2FK3A 2RF4A 5EWGA 4IWYA 4MTDA 2XD4A 1M0WA 1Z2OX 3T1YH 2JA7A 1N32H 5KG2A 2PMZE 3H0GG 3VPDA 4ED0A 5LMUH 2UU9H 1WCMA 3KAJA 2W70A 5KFDA 2Q2UA 3BA8A 5KFSA 4EFBA 4MA5A 2BQ3A 3BQ0A 3T1HH 3H4BA 4G3IA 3M9OB 5IYZF 3HOVG 5DQIA 3L4KA 1JX4A 4X66H 4DR3H 3HOXG 5LMNH 3J80W 5KFQA 1S0MA 2Y0SA 3FMAA 4I7HA 2R8KA 2PN1A 2XCLA 4I50F 3V4ZA 2JA5A 3JZIA 4QWDA 4AYBE 4LH7A 4O3QA 3R5HA 4A2BA 4GKJH 2DPIA 4BY1G 4CC6A 2J6UA 3U9SA 3T5JA 2J6TA 2V5AA 3OTOH 3UFXB 2FPIB 3BAAA 1R9TA 2CKZB 2IA6A 2C22A 3GTGA 2W57A 2I87A 1PX2A 2HJWA 3GTJA 3N44B 3L2PA 4YR3A 1Z2PX 5IP9G 2W9CA 4DV0H 3H40A 4FS2A 3EPIA 4R7RA 4J9LA 3WO0A 2FMAA 3MWMA 4MV3A 1FJGH 4NXMH 4YJ3F 2VQEH 5BPHA 5KFWA 3PW5A 2AGPA 4QWEA 2W8LA 3Q8PB 2W8KA 4Q44A 2I8CA 3SI8A 4DV3H 3GV8B 3OUUA 4JI0H 4UCUA 2ASDA 1K1SA 2C2DA 2V59A 1J5EH 1XNRH 1ZQ7A 3GIPA 3LP8A 4UCOA 5DLFA 3QFFA 4FS1A 5DG7A 2VUMA 4HNUA 5JH7F 1DIKA 1AUXA 5D8DA 1C3OA 4ECUA 4A3LG 4IWXA 1GLVA 1T94A 3RB0A 2DWCA 4CC5A 4RNOA 3KTMA 4A3JG 2UXDH 5KT3A 4HNVA 2R92G 2R86A 3T5LA 4BY7G 1KJJA 3CVZA 3PO3G 5IP7G 2HGSA 4QJFA 2JA5G 4DL6A 2R93G 1EHIA 2WDTA 1TAEA 3TQ1A 1CE8A 2WTFA 4Q45A 4FBUA 4ECXA 3TIIA 2IBKA 2W6ZA 4ED2A 2RGRA 4J9KA 4QWCA 2B63G 3HOWG 2R93A 2JA6G 4LFBH 3E5NA 4EGJA 2CZGA 1T3NA 4Q8FA 2VR1A 4GLXA 2YS6A 4OX9H 2RDJA 3N40P 1ZHQA 3OUZA 3H0GA 3T5KA 3MJFA 5LA6F 5KFJA 3GTLA 4O3NA 3V4SA 1RJPA 2CW7A 3PW4A 1IOWA 1DV2A 2RDIA 3LWBA 3MWDA 3J7AK 1P8LA 2FP4B 1M0TA 5L1KA 3GIJA 4NXNH 2W6QA 1KBLA 3OSNA 2FJZA 4ZHQF 3V6HA 1VKZA 4RAZA 5F9NA 4ECRA 2NU7B 3VPBA 2JA6A 1EUDB 1RK5A 4YHHH 4DV7H 1HNXH 1CQIB 1GSHA 5C1PA 2YU9A 2J6SA 5KT2A 3RGXA 3PW2A 3RGZA 1S68A 3GTOA 2V58A 2YZGA 5KT7A 4JI5H 1TWCA 3RFCA 5KFCA 1I94H 3F8NA 5JUMA 4DL2A 2C28A 5KT5A 5IYBG 2R7ZA 1O75A 3EYYA 5KFKA 5EWFA 2YRWA 4XX0B 2W9BA 4J9RA 2XIGA 4ED1A 3IG0A 5KG3A 1B04A 3FKIG 3K5HA 5KFTA 1XNQH 4TQRA 5IYDG 4GC6A 4C5AA 2YYAA 2BQRA 3FKIA 5DQHA 4NLGA 3OHAA 3RAQA 4ECSA 5KG0A 5KT4A 1C30A 2PBZA 5CA0F 4JI6H 2XGPA 3PVXA 1S0OA 2WYOA 1I7NA 3Q1KA 2ZDQA 3GIDA 3Q8SB 3M9MB 3T5HA 2I80A 3RB6A 2HVRA 5KFPA 4JI1H 5FD5A 3ETJA 2O03A 4FM9A 2UVUA 4ME6A 5BPFA 4JYAH 1TWGA 2YS7A 1SYXB 2W9BB 2V4QA 4A93G 4RZRA 5CB4F 4J9MA 1SFOA 1I6UA 5I47A 4TQSA 2FKLA 4DL5A 3SE7A 4AQYH 2R8HA 3HB9A 1I7LA 1A9XA 1DGSA 1WCMG 5DGBA 3I4MG 3JAMW 2XCPA 3KHHA 1XMOH 4DR1H 2MCTA 3RB3A 1TA8A 2ASLA 3JRWA 4HR7A 1DV1A 4O4LF 2BR0A 4IRKA 4Q43A 2ZDHA 4HNTA 2JEIA 2ZDGA 4YAJB 4YP3A 2DIKA 2WB1A 4F4WA 3WO1A 3RBDA 3I4NG 4R8UB 4APMA 5F9LA 2E2IA 4B3SH 4JI2H 5KFXA 5CA1F 4RB1A 4J9PA 4EBEA 3UQ8A 2VUMG 4DL4A 4J0MA 4YAKB 2Y0SE 1AUVA 2NU6B 1EYZA 4ED3A 4ED6A 4O3SA 3PO2G 5KFFA 2W6PA 2B63A 1KJ9A 2FK2A 4A2AA 1JIHA 5FD6A 5DQGA 2JA8G 2VPQA 4LF4H 3PW7A 2W9CB 1W96A 4MTEA 4UCVA 2W7PA 2C2EA 2GPSA 4IR1A 3N8DA 4UCRA 2KSWA 1B6RA 2NU9B 1N36H 2R92A 1I3QA 1VBGA 4YBZB 4QW9A 4DV6H 1JLLB 2DLNA 4JUZA 5DG9A 5BR8H 2SCUB 5FPRA 5DLGA 5IWAH 3GTPA 2HVSA 4DR7H 3N6XA 4YR0A 2R84A 1BGWA 4A3FG 2NVYA 3GLKA 4A3GG 5IT9W 1XMQH 3R23A 2W6NA 1Z2NX 3GTKA 1UC8A 4ZI7F 2AQ4A 3BQ2A 2NVXA 3V6JA 2Q2TA 1Y14B 3H4DA 4ECQA 3HKZE 2C2RA 1B6SA 3RBEA 2IP4A 2JEFA 5KFUA 1WR2A 4F4ZA 5KFOA 3M4IA 4I55F 4MA0A 5HBRB 3TQTA 3NGDA 3GIKA 2R7KA 1RYRA 3GIQA 4BXXG 4GKKH 2R85A 3MFHA 2R7LA 4XZ3B 2V4RA 4LFCH 4DR6H 1HR0H 2WE6A 1IOVA 3ORQA 1GGOA 4MV8A 4EG0A 1UNNC 3H3VH 2VOBA 1Y1VA 4ED8A 5FLXW 2J9GA 1S0NA 4XYLB 2R8GA 4B3TH 4I4TF 1OWTA 3GV5B 5LOVF 1EUCB 4DUZH 1KJQA 4QIWA 4DL7A 1M6VA 5KG5A 2R6FA 2YZNA 3RJ0A 4Y8VB 2NU8B 1IBKH 4RUCA 2V9WA 2F4VH 5EZYF 3HOUG 1GSAA 3GTMA 2XCAA 4Q0YA 5KFNA 3RV3A 4QWAA 4IZOA 3V6KA 4C5BA 1KJIA 1KC7A 4HYKA 1UC9A 4RZQA 4DV5H 4O3OA 5LXTF 4DUYH 4LMYA 2E2HA 1RYSA 2UUAH 4R8UA 2P0AA 3WNZA 5KFLA 5EOYA 5EDWA 2YL2A 4YY3H 4PDBA 5C3EG 4DR5H 2ALZA 4O3PA 4WBNF 4U6PA 4JI8H 4A3EG 4A3KG 5LYJF 1MZBA 2C00A 3GIIA 4EBDA 1S10A 4LH6A 1HNZH 4DR2H 4LFAH 1E4FT 5KFYA 4RNMA 1K1QA 2C35B 5KG1A 4YJ2F 4EEQA 4ECVA 1BXRA 1S9FA 1BJTA 2R82A 1JKJB 4ECWA 3PZPA 4O3RA 3MR5A 4MV9A 4DV1H 4JV1A 3MR3A 2WAQE 3PN1A 3HOYG 5D1OA 5DG8A 4JV0A 2OLSA 4IRCA 4ECTA 2JA7G 1JDBB 4DV4H 4RUAA 4J9NA 2YCHA 3KAKA 4C2MA 4QWBA 1N48A 2FLNA 1Y1WA 4F50A 5GONF 2ATLA 3M9NB 2ZM6H 3G6VA 3RTXA 3N42B 2X0SA 5HV6A 3PR4A 1IBMH 2HVQA 3MFIA
chains in the Genus database with same CATH topology
2FK3A 4PWQA 1OWTA 2M05A 2FK2A 2FJZA 3KTMA 2FK1A 2FMAA 2FKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FK3 A;  4PWQ A;  1OWT A;  2M05 A;  2FK2 A;  2FJZ A;  3KTM A;  2FK1 A;  2FMA A;  2FKL A; 
#chains in the Genus database with same CATH topology
 4ZOL F;  2PVP A;  3PR5 B;  1RJR A;  4A3M G;  4IRD A;  2WB1 E;  3CQZ A;  2GPW A;  2FB9 A;  4O2B F;  4DV2 H;  1GSO A;  1E4E A;  2VUG A;  2YW2 A;  4MV1 A;  5T14 A;  4YB8 B;  2ZJT A;  4J9O A;  2AGQ A;  2UUB H;  2OWO A;  1M7J A;  1JXL A;  2FPG B;  3K3V A;  3U9T A;  5KFM A;  3RB4 A;  4YQW A;  2XGQ A;  4ETS A;  5CAE B;  2AGO A;  2UVR A;  1VAJ A;  1GO3 E;  5KFH A;  1KEE A;  3IN5 A;  2UVW A;  5FLM G;  5KX5 F;  1RJQ A;  1TWF A;  4GC7 A;  4FU0 A;  2CQY A;  3BG5 A;  3VMM A;  5JQW A;  5KFE A;  5KFR A;  5J2T F;  4LF7 H;  3KHG A;  1SCU B;  1CQJ B;  1TWH A;  2VA3 A;  4RB3 C;  3J81 W;  2R87 A;  5H80 A;  2W9A A;  5D1O B;  4IHJ F;  1W93 A;  3MWE A;  2GLT A;  2JEG A;  4FBT A;  5C4X G;  4K0K H;  3LML A;  1ULZ A;  5KFA A;  2NUA B;  4DLK A;  4A3D G;  3TIN A;  4TUY F;  3MR6 A;  4ED7 A;  4WD3 A;  4EEY A;  1V4Y A;  1N34 H;  2W71 A;  2W6O A;  3G6X A;  4TV9 F;  4YR2 A;  4LF8 H;  2QYZ A;  4EFE A;  3K3P A;  3OSP A;  5KT6 A;  4JV2 A;  5A2Q W;  1L2Z A;  1N56 A;  5IYC G;  3K5I A;  4B3M H;  4HQ6 A;  4JI3 H;  1XDN A;  1I50 A;  5L9X A;  1FVI A;  4KHP H;  4JI7 H;  4JI4 H;  4MV4 A;  4EGQ A;  4MV6 A;  1GYF A;  2CW8 A;  2FK1 A;  4RAY A;  3VPC A;  4AYB A;  4UCS A;  5KFB A;  1S03 G;  4A3I G;  1AN7 A;  1Y1W G;  5JVL A;  3BJY A;  5DGA A;  5J2U F;  3JSL A;  4MV7 A;  5LL6 b;  4F4X A;  2UXC H;  5C5J A;  3RUP A;  1K83 A;  2R7M A;  4RU9 A;  4BBR G;  4LSX A;  4M9U A;  5EWE A;  4LSA A;  3TIG A;  3ETH A;  3GIM A;  3BA9 A;  3GV7 B;  3I12 A;  2M05 A;  1VS0 A;  3R5X A;  5L1L A;  3N41 B;  2OH2 A;  4TV8 F;  4LF6 H;  1HNW H;  3GIL A;  1E4E B;  3Q8Q B;  4MAM A;  3HBL A;  2FPP B;  4X62 H;  3PW0 A;  2FE3 A;  2DPJ A;  4JV5 H;  2PMZ A;  4ECY A;  2E5L H;  3RV4 A;  2QK4 A;  4PWQ A;  5FJ8 G;  3RAX A;  1RK6 A;  3QZ7 A;  1EZ1 A;  2UVV A;  2VQD A;  4C5C A;  2W6M A;  5JVD F;  2ASJ A;  4UFZ A;  3RF2 A;  3Q2O A;  3OHB A;  2VA2 A;  2UXB H;  4RNN A;  3JRX A;  2WAQ A;  5L1I A;  4B3R H;  2R8J A;  5LP6 F;  4RB2 C;  5KFV A;  2FLP A;  3GQC A;  3KXY T;  4F4Y A;  1V51 A;  1JDE A;  4XYM B;  5KFZ A;  2AU0 A;  1TWA A;  3KAL A;  1SEI A;  3N43 B;  1B33 N;  5KKN B;  1N33 H;  2XC9 A;  4RB0 A;  4A3B G;  1S97 A;  1E4G T;  2W7O A;  4LF9 H;  3GTQ A;  2RGV A;  2FLL A;  4EYI B;  3BQ1 A;  2UUC H;  4EYH B;  5KFG A;  2BQU A;  4L1K A;  4M7E A;  5C8Y F;  3G6Y A;  1T36 A;  5FPO A;  4J9Q A;  3ORR A;  4UCT A;  5KG7 A;  5C44 G;  1ZET A;  2YZM A;  3HXL A;  1IBL H;  5D1P A;  5K2M A;  4QIW E;  4QW8 A;  5C1O A;  4Q8E A;  4A3C G;  2JEJ A;  3HKZ A;  4E4T A;  5BMV F;  4U7C A;  3R5F A;  2VQF H;  1A0I A;  3C0F B;  5KG4 A;  4J9S A;  2R7Z G;  1V9P A;  4EBC A;  1WSC A;  3H20 A;  4LF5 H;  4IAJ A;  1BNC A;  1Y1V G;  3AYH B;  4O4I F;  1WH2 A;  2DZD A;  4X65 H;  3L4J A;  1FKA H;  1PK8 A;  3QZ8 A;  2R8I A;  3Q8R B;  3RIZ A;  4DR4 H;  1ZHS A;  4O4H F;  1X9N A;  3BAB A;  3G8C A;  3HOZ G;  4BBS G;  5KFI A;  5KG6 A;  4BWS C;  2YRX A;  3KHL A;  1CS0 A;  3JSN A;  3DF7 A;  4DL3 A;  1VBH A;  2R7N A;  3MR2 A;  4ZQI A;  3KHR A;  3FDS A;  4X64 H;  2HHH H;  2IMW P;  4IR9 A;  2VPS A;  5L1J A;  4ECZ A;  4O2A F;  1KJ8 A;  3EPG A;  2FK3 A;  2RF4 A;  5EWG A;  4IWY A;  4MTD A;  2XD4 A;  1M0W A;  1Z2O X;  3T1Y H;  2JA7 A;  1N32 H;  5KG2 A;  2PMZ E;  3H0G G;  3VPD A;  4ED0 A;  5LMU H;  2UU9 H;  1WCM A;  3KAJ A;  2W70 A;  5KFD A;  2Q2U A;  3BA8 A;  5KFS A;  4EFB A;  4MA5 A;  2BQ3 A;  3BQ0 A;  3T1H H;  3H4B A;  4G3I A;  3M9O B;  5IYZ F;  3HOV G;  5DQI A;  3L4K A;  1JX4 A;  4X66 H;  4DR3 H;  3HOX G;  5LMN H;  3J80 W;  5KFQ A;  1S0M A;  2Y0S A;  3FMA A;  4I7H A;  2R8K A;  2PN1 A;  2XCL A;  4I50 F;  3V4Z A;  2JA5 A;  3JZI A;  4QWD A;  4AYB E;  4LH7 A;  4O3Q A;  3R5H A;  4A2B A;  4GKJ H;  2DPI A;  4BY1 G;  4CC6 A;  2J6U A;  3U9S A;  3T5J A;  2J6T A;  2V5A A;  3OTO H;  3UFX B;  2FPI B;  3BAA A;  1R9T A;  2CKZ B;  2IA6 A;  2C22 A;  3GTG A;  2W57 A;  2I87 A;  1PX2 A;  2HJW A;  3GTJ A;  3N44 B;  3L2P A;  4YR3 A;  1Z2P X;  5IP9 G;  2W9C A;  4DV0 H;  3H40 A;  4FS2 A;  3EPI A;  4R7R A;  4J9L A;  3WO0 A;  2FMA A;  3MWM A;  4MV3 A;  1FJG H;  4NXM H;  4YJ3 F;  2VQE H;  5BPH A;  5KFW A;  3PW5 A;  2AGP A;  4QWE A;  2W8L A;  3Q8P B;  2W8K A;  4Q44 A;  2I8C A;  3SI8 A;  4DV3 H;  3GV8 B;  3OUU A;  4JI0 H;  4UCU A;  2ASD A;  1K1S A;  2C2D A;  2V59 A;  1J5E H;  1XNR H;  1ZQ7 A;  3GIP A;  3LP8 A;  4UCO A;  5DLF A;  3QFF A;  4FS1 A;  5DG7 A;  2VUM A;  4HNU A;  5JH7 F;  1DIK A;  1AUX A;  5D8D A;  1C3O A;  4ECU A;  4A3L G;  4IWX A;  1GLV A;  1T94 A;  3RB0 A;  2DWC A;  4CC5 A;  4RNO A;  3KTM A;  4A3J G;  2UXD H;  5KT3 A;  4HNV A;  2R92 G;  2R86 A;  3T5L A;  4BY7 G;  1KJJ A;  3CVZ A;  3PO3 G;  5IP7 G;  2HGS A;  4QJF A;  2JA5 G;  4DL6 A;  2R93 G;  1EHI A;  2WDT A;  1TAE A;  3TQ1 A;  1CE8 A;  2WTF A;  4Q45 A;  4FBU A;  4ECX A;  3TII A;  2IBK A;  2W6Z A;  4ED2 A;  2RGR A;  4J9K A;  4QWC A;  2B63 G;  3HOW G;  2R93 A;  2JA6 G;  4LFB H;  3E5N A;  4EGJ A;  2CZG A;  1T3N A;  4Q8F A;  2VR1 A;  4GLX A;  2YS6 A;  4OX9 H;  2RDJ A;  3N40 P;  1ZHQ A;  3OUZ A;  3H0G A;  3T5K A;  3MJF A;  5LA6 F;  5KFJ A;  3GTL A;  4O3N A;  3V4S A;  1RJP A;  2CW7 A;  3PW4 A;  1IOW A;  1DV2 A;  2RDI A;  3LWB A;  3MWD A;  3J7A K;  1P8L A;  2FP4 B;  1M0T A;  5L1K A;  3GIJ A;  4NXN H;  2W6Q A;  1KBL A;  3OSN A;  2FJZ A;  4ZHQ F;  3V6H A;  1VKZ A;  4RAZ A;  5F9N A;  4ECR A;  2NU7 B;  3VPB A;  2JA6 A;  1EUD B;  1RK5 A;  4YHH H;  4DV7 H;  1HNX H;  1CQI B;  1GSH A;  5C1P A;  2YU9 A;  2J6S A;  5KT2 A;  3RGX A;  3PW2 A;  3RGZ A;  1S68 A;  3GTO A;  2V58 A;  2YZG A;  5KT7 A;  4JI5 H;  1TWC A;  3RFC A;  5KFC A;  1I94 H;  3F8N A;  5JUM A;  4DL2 A;  2C28 A;  5KT5 A;  5IYB G;  2R7Z A;  1O75 A;  3EYY A;  5KFK A;  5EWF A;  2YRW A;  4XX0 B;  2W9B A;  4J9R A;  2XIG A;  4ED1 A;  3IG0 A;  5KG3 A;  1B04 A;  3FKI G;  3K5H A;  5KFT A;  1XNQ H;  4TQR A;  5IYD G;  4GC6 A;  4C5A A;  2YYA A;  2BQR A;  3FKI A;  5DQH A;  4NLG A;  3OHA A;  3RAQ A;  4ECS A;  5KG0 A;  5KT4 A;  1C30 A;  2PBZ A;  5CA0 F;  4JI6 H;  2XGP A;  3PVX A;  1S0O A;  2WYO A;  1I7N A;  3Q1K A;  2ZDQ A;  3GID A;  3Q8S B;  3M9M B;  3T5H A;  2I80 A;  3RB6 A;  2HVR A;  5KFP A;  4JI1 H;  5FD5 A;  3ETJ A;  2O03 A;  4FM9 A;  2UVU A;  4ME6 A;  5BPF A;  4JYA H;  1TWG A;  2YS7 A;  1SYX B;  2W9B B;  2V4Q A;  4A93 G;  4RZR A;  5CB4 F;  4J9M A;  1SFO A;  1I6U A;  5I47 A;  4TQS A;  2FKL A;  4DL5 A;  3SE7 A;  4AQY H;  2R8H A;  3HB9 A;  1I7L A;  1A9X A;  1DGS A;  1WCM G;  5DGB A;  3I4M G;  3JAM W;  2XCP A;  3KHH A;  1XMO H;  4DR1 H;  2MCT A;  3RB3 A;  1TA8 A;  2ASL A;  3JRW A;  4HR7 A;  1DV1 A;  4O4L F;  2BR0 A;  4IRK A;  4Q43 A;  2ZDH A;  4HNT A;  2JEI A;  2ZDG A;  4YAJ B;  4YP3 A;  2DIK A;  2WB1 A;  4F4W A;  3WO1 A;  3RBD A;  3I4N G;  4R8U B;  4APM A;  5F9L A;  2E2I A;  4B3S H;  4JI2 H;  5KFX A;  5CA1 F;  4RB1 A;  4J9P A;  4EBE A;  3UQ8 A;  2VUM G;  4DL4 A;  4J0M A;  4YAK B;  2Y0S E;  1AUV A;  2NU6 B;  1EYZ A;  4ED3 A;  4ED6 A;  4O3S A;  3PO2 G;  5KFF A;  2W6P A;  2B63 A;  1KJ9 A;  2FK2 A;  4A2A A;  1JIH A;  5FD6 A;  5DQG A;  2JA8 G;  2VPQ A;  4LF4 H;  3PW7 A;  2W9C B;  1W96 A;  4MTE A;  4UCV A;  2W7P A;  2C2E A;  2GPS A;  4IR1 A;  3N8D A;  4UCR A;  2KSW A;  1B6R A;  2NU9 B;  1N36 H;  2R92 A;  1I3Q A;  1VBG A;  4YBZ B;  4QW9 A;  4DV6 H;  1JLL B;  2DLN A;  4JUZ A;  5DG9 A;  5BR8 H;  2SCU B;  5FPR A;  5DLG A;  5IWA H;  3GTP A;  2HVS A;  4DR7 H;  3N6X A;  4YR0 A;  2R84 A;  1BGW A;  4A3F G;  2NVY A;  3GLK A;  4A3G G;  5IT9 W;  1XMQ H;  3R23 A;  2W6N A;  1Z2N X;  3GTK A;  1UC8 A;  4ZI7 F;  2AQ4 A;  3BQ2 A;  2NVX A;  3V6J A;  2Q2T A;  1Y14 B;  3H4D A;  4ECQ A;  3HKZ E;  2C2R A;  1B6S A;  3RBE A;  2IP4 A;  2JEF A;  5KFU A;  1WR2 A;  4F4Z A;  5KFO A;  3M4I A;  4I55 F;  4MA0 A;  5HBR B;  3TQT A;  3NGD A;  3GIK A;  2R7K A;  1RYR A;  3GIQ A;  4BXX G;  4GKK H;  2R85 A;  3MFH A;  2R7L A;  4XZ3 B;  2V4R A;  4LFC H;  4DR6 H;  1HR0 H;  2WE6 A;  1IOV A;  3ORQ A;  1GGO A;  4MV8 A;  4EG0 A;  1UNN C;  3H3V H;  2VOB A;  1Y1V A;  4ED8 A;  5FLX W;  2J9G A;  1S0N A;  4XYL B;  2R8G A;  4B3T H;  4I4T F;  1OWT A;  3GV5 B;  5LOV F;  1EUC B;  4DUZ H;  1KJQ A;  4QIW A;  4DL7 A;  1M6V A;  5KG5 A;  2R6F A;  2YZN A;  3RJ0 A;  4Y8V B;  2NU8 B;  1IBK H;  4RUC A;  2V9W A;  2F4V H;  5EZY F;  3HOU G;  1GSA A;  3GTM A;  2XCA A;  4Q0Y A;  5KFN A;  3RV3 A;  4QWA A;  4IZO A;  3V6K A;  4C5B A;  1KJI A;  1KC7 A;  4HYK A;  1UC9 A;  4RZQ A;  4DV5 H;  4O3O A;  5LXT F;  4DUY H;  4LMY A;  2E2H A;  1RYS A;  2UUA H;  4R8U A;  2P0A A;  3WNZ A;  5KFL A;  5EOY A;  5EDW A;  2YL2 A;  4YY3 H;  4PDB A;  5C3E G;  4DR5 H;  2ALZ A;  4O3P A;  4WBN F;  4U6P A;  4JI8 H;  4A3E G;  4A3K G;  5LYJ F;  1MZB A;  2C00 A;  3GII A;  4EBD A;  1S10 A;  4LH6 A;  1HNZ H;  4DR2 H;  4LFA H;  1E4F T;  5KFY A;  4RNM A;  1K1Q A;  2C35 B;  5KG1 A;  4YJ2 F;  4EEQ A;  4ECV A;  1BXR A;  1S9F A;  1BJT A;  2R82 A;  1JKJ B;  4ECW A;  3PZP A;  4O3R A;  3MR5 A;  4MV9 A;  4DV1 H;  4JV1 A;  3MR3 A;  2WAQ E;  3PN1 A;  3HOY G;  5D1O A;  5DG8 A;  4JV0 A;  2OLS A;  4IRC A;  4ECT A;  2JA7 G;  1JDB B;  4DV4 H;  4RUA A;  4J9N A;  2YCH A;  3KAK A;  4C2M A;  4QWB A;  1N48 A;  2FLN A;  1Y1W A;  4F50 A;  5GON F;  2ATL A;  3M9N B;  2ZM6 H;  3G6V A;  3RTX A;  3N42 B;  2X0S A;  5HV6 A;  3PR4 A;  1IBM H;  2HVQ A;  3MFI A; 
#chains in the Genus database with same CATH homology
 2FK3 A;  4PWQ A;  1OWT A;  2M05 A;  2FK2 A;  2FJZ A;  3KTM A;  2FK1 A;  2FMA A;  2FKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...