2FK8A

Crystal structure of hma (mmaa4) from mycobacterium tuberculosis complexed with s-adenosylmethionine
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
281
structure length
281
Chain Sequence
IQAHYDVSDDFFALFQDPTRTYSCAYFEPPELTLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKNQHARCEQVLASIDTNRSRQVLLQGWEDFAEPVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRMTVQSSVSYHPYEMAARGKKLSFETARFIKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHYFTDEMLDCSLVTYLKPGAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords methoxy mycolic acid synthase 4
publication title Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 103
structure length 281
sequence length 281
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2fk8A00
1PJZA 5F2OA 5DSXA 1KYZA 3KPVA 1Q0TA 1NKVA 2Q41A 3GJYA 4RX1A 4PYMA 3SSMA 1KP9A 5CVDA 3OCJA 3G2QA 1IXKA 5IH3A 1WZNA 1BKYA 2JHAA 3LKZA 1WXWA 4GOOD 5EVJA 3TM5A 4EK9A 3G5TA 1TW3A 1SG9A 5EEGA 4FGZA 1YZ3A 2P3LA 5HFJA 1SVUA 1AQIA 3P8ZA 1FJXA 1NW6A 4MWZA 1I4WA 1YFLA 3FPEA 3QOXA 3FTEA 5CCXA 1RI5A 1KPHA 3TPZA 2CL5A 2OY0A 3B3JA 3LL7A 3ORHA 3SGLA 2ESRA 5E2BA 3TFWA 2HNKA 3V8VA 3EEOA 2IH5A 3DXYA 1VIDA 1L9KA 1EAMA 3LBFA 4X41A 3UZUA 1UWVA 4P7KA 1FP1D 4CTKA 4F84A 3CBGA 2B78A 2PWPA 4P7GA 5HIKA 5HOQA 5FULA 5DTMA 2C7QA 1R00A 3GWZA 5EQJB 1X19A 2FK7A 3UJ9A 2ZIFA 2QYOA 3FZGA 5ICCA 1QAOA 5K0NA 2I6GA 1WS6A 4DA4A 5LR6A 3SSOA 3TRKA 4DCGA 1ZQ9A 2AN4A 5D1NA 2FCAA 2OBFA 1R6AA 4EQZA 5DX8A 5K09A 1XVAA 3Q87B 1NW7A 1D2CA 4DKJA 3KQTA 5HIJA 1EQAA 2FRXA 5E1DA 2E5WA 2BR3A 4M38A 5CUQA 3BKXA 3P2IA 3JWGA 2HR1A 3P97A 3BT7A 4RTNA 2A14A 1NW5A 3R3HA 5DXAA 4PIPA 4HTFB 4RSRA 3LHDA 1IM8A 4IKPA 1DUSA 3HCDA 4GQBA 2O06A 2P8JA 4PYQA 2UZ4A 1R8XA 3UJAA 1SUSA 2ZW9A 3B3GA 2IGTA 2XYQA 1JR4A 2Y1XA 1KPIA 3GRRA 5BXYA 2P7IA 2P1DA 2AOTB 1PRYA 2VP3A 3BUSA 3EVDA 3LBYA 5ERGB 2Z6UA 3M6UA 2H11A 4GUAA 4KDCA 1L3CA 3EVAA 1NE2A 2R3SA 5CCBA 3EVGA 3BWCA 2I9KA 4YUVA 1UIRA 4CKEA 2AR0A 4GBED 2Z6QA 2OPBA 1R8YA 3P2EA 3PLAE 3D2LA 5GIPE 4DF3A 3HCFA 4JXJA 2YQZA 3KR9A 5ICFA 4GC5A 4RTRA 5CIYA 1G8SA 3REOA 1R74A 1YFJA 3O7WA 3G88A 2ZBQA 3KU1A 3ELWA 3TQSA 4B17A 2QM3A 3LDFA 1X1AA 4GOND 3NJRA 3FRHA 4RVHA 3PFHA 1RI2A 3AXSA 4C08A 3A7EA 1M6EX 2HTEA 3C6KA 3CC8A 2IDJA 3HEMA 3OFJA 5CVUA 5HEKA 4U7PB 1Y8CA 3A4TA 4ER3A 3HVJA 2B3TA 5E9WA 4R8SA 1XDSA 1TW2A 2PY6A 2ZFUA 3TLJA 3BXOA 1VLMA 1TPYA 1D2GA 4M36A 5EC8A 5EGSA 1G38A 3RW9A 3FPGA 2PV0A 3UWPA 5JUWA 3NMUF 3DLIA 5EZSA 5GINE 2JG3A 5C9ZA 3C3YA 4AX8A 4R8RA 4XCXA 2BM9A 3DR5A 1SKMA 3UA4A 2PT6A 1NT2A 2AS0A 3I5UA 5DM2A 5EEHA 1NV8A 3JWHA 3TMAA 4DQ0A 4PCLA 2AN5A 3EVZA 5EHGA 10MHA 1RI4A 5FQOA 4PYIA 3BGVA 1OR8A 4HGZA 1H1DA 3A26A 3GXOA 4YMHA 5K03A 2IIPA 3Q7EA 2YVLA 4GOMD 2JHPA 3UJ8A 3KQMA 4O29A 4YMGA 1BOOA 1VL5A 2YXEA 3OE4A 4OQEA 5LQKA 2O07A 2H00A 5EHIA 3JWIA 4V0RA 2OXTA 3TKYA 3TOSA 2FHPA 3G89A 3EGEA 1F3LA 1NBHA 2XVMA 5E1BA 1WG8A 4HC4A 2IBSA 3GRVA 3DULA 4PYOA 4ZTBA 4BP1A 5DSTA 3C0KA 3VSEA 2ERCA 4KIFA 1NBIA 3SX0A 1N7JA 3KQPA 3UJBA 4H0NA 2YR0A 4YUWA 3ELDA 4FT2A 5E9QA 4BLWA 3IYLW 4QTUB 3IHTA 3LCCA 4BLUA 5DRYA 3HA3A 3FUTA 4KDRA 5FQNA 5T67A 1SQGA 3CCFA 1NW3A 3M6WA 3HA7A 2EG5A 2EFJA 3O4FA 2YTZA 3PFGA 2P41A 2ZIEA 4FR0A 5GM2A 5K0BA 5FWAA 5F2KA 3KQSA 3C6MA 5EMMA 5C0OE 3EVEA 5DT2A 5CVVA 3AWIA 3LCUA 3HVHA 3SR4A 3HCCA 3LDGA 2AN3A 1FP2A 2O57A 2AOXA 5E1MA 4BP3A 1VPTA 3EPPA 1XTPA 2FPOA 3ER9A 3HTXA 3AJDA 4EVIA 4QVGA 2ZLBA 4Y2HA 3R24A 3DMHA 1ZKDA 2JH9A 3OU6A 5CVEA 2BM8A 1QANA 1RJEA 1RJDA 3RODA 3SM3A 3KPYA 2K4MA 2IP2A 1KXZA 2ONYA 3BGDA 2G1PA 3FYCA 5LSAA 3BWYA 4BY9E 3UA3A 1QYRA 1XXLA 3A27A 3GRZA 4P7FA 5EG5A 2GS9A 3P71T 3GNLA 1JG2A 3PT9A 4ISCA 4KRGA 3BZBA 3PX2A 1T43A 3R6TA 1X1DA 3F4KA 4YUZA 4E31A 4RTQA 1AQJA 2NXJA 2O0LA 2ZZMA 1X1BA 3SVZA 5HZMA 5M5BA 4E70A 4AZSA 5IKMA 4LWOA 4RTSA 2ZCJA 2C7PA 3E7PA 1G60A 3NW9A 4RTPA 4QDJA 3ANXA 4R05A 2ZBRA 1YUBA 2VDVE 5P8WA 3H2BA 4RTMA 3VC1A 4YV1A 3B89A 1YB2A 2IPXA 2H1RA 5DX1A 3VYWA 2XYVA 2AZTA 3NDJA 3S68A 5T6BA 4EMSA 4KVZA 3E23A 2B25A 2BR5A 1JQEA 2HWKA 3MTIA 3HVKA 4IV8A 1N7IA 3V97A 4E33A 5EIFA 2V74B 5EIWA 5FHQA 2PXXA 2P3QA 3QV2A 4FZVA 2AOVA 4DM3A 4G56A 2BZGA 5E8JA 2YUIA 7MHTA 4QTTB 3LPMA 5CVJA 1JG4A 1VP9A 2PBFA 3MB5A 4YUXA 2P7HA 3GIWA 1L1EA 1ORHA 4PGGA 3K0BA 3RIEA 3THSA 2NP7A 1KPGA 3B3FA 3GU3A 2FYTA 1VQ1A 1MJFA 3ME5A 3EVFA 1FBNA 5DWQA 5B1SA 5K0JA 2XBMA 3B5IA 3PS9A 1KYWA 4V0QA 4YV0A 2N47A 4HGYA 4RTOA 2V7EA 5LQAA 2WA2A 4DCMA 1DCTA 2OKCA 3EVBA 3GGDA 4RTLA 1EIZA 2PX4A 3BKWA 1X1CA 1G55A 4F86A 3E05A 1YF3A 2G71A 1RI1A 2ZZKA 3I53A 5K0CA 2ZTHA 2VDWA 4X63A 3KPUA 4POOA 3I64A 5KS2A 4WVLA 2OO3A 3M4XA 3O31A 2DPMA 3ELYA 3BWBA 1O9GA 4QQNA 4ER7A 1UFKA 5JR3A 1MHTA 2AOUA 3M70A 4C04A 3GRYA 2BH2A 4L7VA 4WXHA 4PONA 4A6DA 2KW5A 5GOZA 1RI3A 4A6EA 4PWYA 5BW5A 1G8AA 3JWJA 3M33A 5DPMA 1JQ3A 5C1IA 4C4AA 2CKDA 1VE3A 3LGAA 5DM1A 3ER8A 2JH8A 3T7SA 3UJDA 2NNWB 2UYQA 1ZGJA 2IH2A 5K0FA 5DRTA 2ZWVA 3CVOA 2YXLA 4PNEA 2GLUA 3PB3A 4C05A 3EEYA 1XDZA 4XUCA 1ZGAA 3I9FA 4QDKA 5LQNA 5EKXA 1JTFA 1KIAA 3DTNA 3LECA 3CJTA 3BWMA 3P9IA 3FUVA 4UOEA 2IBTA 2CWWA 3DMFA 2IFTA 3KQYA 3OU7A 1QAQA 4LECA 3OU2A 4E2WA 1HNNA 4PYJA 2ZIGA 2GPYA 5KVAA 4CXMA 3BGIA 4YUYA 4E2YA 2AVDA 2PKWA 5GIOE 2NP6A 4EKIA 3FTDA 3MCZA 3NDIA 2OZVA 4LWPA 5D1HA 3SSNA 1O9HA 2HV9A 2EJUA 3MTEA 2UYOA 3UFBA 2QY6A 1JSZA 4XUEA 5K0LA 3MGGA 2OYRA 1JTEA 1SQFA 2AOWA 2HMYB 4OA5A 3LSTA 5HIMA 4GOLD 5G02A 2PWYA 3EMBA 3G2OA 2VZ9A 4XUDA 4AUKA 4PINA 3EGIA 4C03A 2CMGA 3KPWA 1HMYA 3IV6A 3DP7A 3EMDA 4OBXA 4RV9A 3T7RA 3M6XA 5K8VA 9MHTA 3HVIA 2PGXA 2IDKA 3CJQA 4PGHA 4GEKA 1IY9A 3UJCA 3CGGA 5HILA 1JG3A 5FUBA 1ORIA 2JJQA 5LQUA 2FK8A 2G72A 2YXDA 1RJGA 2ZVJA 2NXCA 3LDUA 3OE5A 3FUWA 4FSXA 1NV9A 3OZRA 5F2NA 4MHTA 4PYKA 2G70A 2Y1WA 3A7DA 5DLYA 1ZG3A 2I62A 2AVNA 3PVCA 4OBWA 4QPPA 5GWXA 4RTKA 5K05A 5GP1A 3R9XB 4QQKA 2C7OA 3KPJA 3UBTA 1Q0SA 1I9GA 5GM1A 2B9EA 2QE6A 3GDHA 3GO4A 3HCBA 5K0EA 4Z2YA 4ER0A 3FUXA 1U2ZA 3KQVA 4MIKA 3THRA 3HNRA 2AOUB 4MQ4A 4ATNA 5EMKA 3P9KA 5LQCA 3HM2A 2LD4A 5HIIA 5FHRA 3U81A 4ER6A 2IH4A 3MHTA 3PX3A 3FPJA 3P9CA 1DL5A 3UJ7A 2R6ZA 1ZHFA 4PIMA 1BC5A 4R6WA 5EKUA 1YZHA 4GF5A 4CTJA 2GB4A 1XDUA 1EJ0A 2GA9A 2PLWA 3DUWA 3OZSA 4CKBA 2VS1A 2EX4A 1L3BA 2PXCA 3AY0A 3P2KA 1WXXA 3ID6C 4P7JA 5E2AA 3TR6A 4MTLA 2XYRA 3CJRA 4PYLA 3C3PA 1P91A 3FPFA 4RVFA 4X1OA 3DLCA 4F85A 2GAFA 3FPHA 2Z6AA 4DZRA 3NVMB 1I1NA 3SXJA 4ER5A 5FCDA 3PTAA 4CWAA 2NXEA 5EMLA 4CKCA 4LG1A 3UJ6A 5FA5A 1V39A 1XCLA 2XVAA 3QOWA 4BLVA 3TKAA 5DTRA 5BW4A 1RJFA 3DXXA 5DX0A 1EJ6A 1SUIA 3FYDA 4E2XA 1AV6A 1M6YA 3G2PA 3G5LA 3OFKA 2OB1A 1BHJA 3HA5A 3LX6A 4HSGA 4Y30A 5FA8A 1KR5A 2P3OA 1VBFA 4HH4A 3HP7A 3I58A 4PCAA 4QVKA 1D2HA 3ELUA 3KQWA 5K0GA 1NW8A 2ZULA 4OX9Y 5LQJA 5H02A 3T0IA 3LCVB 1XCJA 4HG2A 1XJ5A 3CKKA 4OQDA 3MERA 2ONZA 1EG2A 2QRVB 4RVDA 5FADA 3X0DA 3MQ2A 2WA1A 4AZVA 3E8SA 3FRIA 2YX1A 4FSDA 3G8AA 2I7CA 4U7TB 5K01A 2EJTA 4OA8A 1Z3CA 5BP7A 4AZWA 3G2MA 1B42A 2P35A 2JHCA 5CM2Z 3TM4A 4FP9A 2NYUA 3G7UA 1AF7A 2PX8A 5EPEA 1M0EA 2ZZNA 3LKDA 2NXNA 3A25A 2F8LA 3L8DA 3WSTA 3KQQA 5ICGA 3ERCA 4P58A 3G8BA 3NWEA 5LQRA 1G6Q1 1N2XA 3KR1A 3R0QA 2ORED 3DH0A 3FTCA 4E30A 4IV0A 1P1CA 3M6VA 2PJDA 1JG1A 3FUUA 1WY7A 2PXAA 3MCTA 4K6MA 5E8RA 2ZWAA 1VP3A 3DOUA 3GCZA 1O54A 4RWZA 5FWDA 1P1BA 5E1OA 3OZTA 5KQRA 4PYNA 5DTQA 4M37A 5DXJA 5EOVA 4KWCA 4R6XA 1QAMA 5E9JA 3NVKI 5EZQA 3AXTA 2CMHA 5EMJA 4NECA 2PX2A 3KR2A 3MAGA 3KR0A 4E2ZA 4C07A 5DM0A 2O05A 4FS8A 3OPNA 2ZBPA 3HCAA 3P9NA 3KHKA 4RVGA 5FTWA 3DXZA 2PVCA 3SMQA 3EGVA 2BR4A 4DMGA 3FTFA 2ZSUA 4C06A 4YV2A 2VDUE 2WK1A 1INLA 5DM4A 1FPQA 3HCEA 1L3IA 4QPNA 4RYLA 2P40A 3KKZA 4HRAA 4X60A 4E32A 3KQOA 3NWBA 2PSSA 2UYCA 5CD1A 1QZZA 3IEIA 2PX5A 2B2CA 2G8NA 5KYGA 8MHTA 4HTFA 3DMGA 3NTVA 2UYHA 5T64A 4FT4A 2DULA 5KQSA 4RTJA 4M7RA 3T7TA 4GC9A 4AZTA 3B7PA 2ADMA 2PT9A 1JSXA 3K6RA 1P39A 4KW7A 3VC2A 2QRVA 5U4XA 4EKGA 5ICEA 1R18A 4IWNA 2C7RA 2AOTA 3EVCA 2GH1A 4KIGA 4X61A 5MHTA 1KHHA 2OB2A 1JQDA 1F38A 3GRUA
chains in the Genus database with same CATH superfamily
1IN5A 5CCDA 1PJRA 1JHUA 4IF6A 1TCUA 1TM1E 5ARBA 1SAYA 4CIVA 1PK9A 4RQTA 4V1CA 2VOJA 5LZ8A 4TTVA 2BRUA 1IEQA 1T34A 4UAJA 1OH8A 2PUEA 1OKKA 2FP4B 3CT6A 4QO7A 5EEGA 1F6DA 3K70C 2ISCA 1FJXA 1KA9H 4MR7A 1GTSA 1A69A 1ADCA 3NHWA 3PNQA 3LFUA 4MQBA 3X2SA 1Q19A 4I2NA 1SUPA 3T5GA 3UB2A 4X45A 4C0BA 1F12A 2QD4A 4PG5A 3KNZA 2CL5A 4BBZA 1W0KA 4YLGA 4Q4HA 2ETXA 1TVCA 3CF6R 2WYOA 3L8EA 5KYVA 4D4GA 4E08A 2CCGA 2WC1A 1HKUA 3DEAA 4FJ2A 3U9LA 3SQMA 2ZTUA 4BTEA 4E5SA 1FDUA 4Y2VA 5H9VA 4HVLA 2XTNA 5FULA 1RXCA 2EIXA 3IHWA 4O4HA 5TQ2A 2WYVA 3X1XA 2M6SA 3F2VA 4II2A 3VPAA 3SVTA 5TMDA 3RHFA 3EODA 4BCDA 2ZS8A 3C43A 3FFTA 2JKVA 2RB5A 5K3OA 2HW8A 4EFKA 1KU0A 1Q2XA 1C9JA 1F8XA 3K05A 5D1NA 4F7WA 1EFRD 2FG7C 3GHYA 5LLSA 2MCFA 2RBGA 3TL2A 5CBPA 1FW6A 2XYGA 1YAJA 5LA6B 3AB7A 1GL6A 5CW1A 2HJHA 1E62A 5L6MB 1GAJA 3K2IA 1FLNA 4OSOA 5E1DA 3OZGA 5ALUA 1SVLA 4F2DA 4Z1OA 4HGNA 3CLUD 4AJLA 4ZV4A 3LHDA 4UTXA 4FX2A 4X6XA 4I50A 5FFMA 5IF9A 1KI1A 2ISQA 2XKAA 4OEHA 4I6JA 2AYXA 4R4JA 4URWR 3IP9A 2QN7A 5BSGA 3AVYA 2A30A 3GUUA 2ZBGA 3ESQA 1E1DA 2QP3A 3U4GA 7MDHA 4I6EA 2HIMA 4YMWA 2RHHA 3ZV3A 2O54A 1PWXA 5SICE 3SJUA 3KVNA 5GPBA 3GLHA 3DNFA 1NBMA 4IIHA 1RQGA 3TVDA 3ZWVA 1L7VC 2DWUA 5ECDA 3VJKA 3DWFA 4V1CB 2J33A 1W1IA 3AU8A 3ICPA 3T7AA 1KI2A 4X8OA 4YUVA 2GWHA 4LRSB 1Y81A 3FDZA 1HNXB 3JW8A 3A4IA 4BFLA 4N7BA 5H3HA 1Y3FE 2PH5A 4I19A 4RM3A 1MQ9A 4UXIA 1JHZA 3VSDA 3S40A 3O7WA 4EAAA 4HP8A 4DAOA 5F21A 5HKBA 1LF5A 3L6RA 3UHPA 2AR7A 3EIHA 4BO0A 2EZ8A 1LK0A 1W48A 3NB0A 4PGFA 3REQA 1K7YA 4KX3A 1M6EX 2Y0EA 3JPWA 3JD3A 2PH1A 5MGNA 2H51A 2OBMA 4KXWA 4FFMA 2MIIA 3MTQA 1PK7A 4IMRA 5E9WA 2WF8A 3CRVA 5FR2A 1A97A 1U0NA 5TQ2B 4O4HB 4BVAA 1GXSA 1MX3A 2IS4A 2W6CX 4A2PA 3BXOA 4ND5A 5H3LA 4MYRA 3NIBA 3O8OA 2ZRKA 4GLBA 3ZQJA 3B70A 5C3UA 3VKVA 5KWVA 1EP9A 2IXAA 3ZHXA 2AFHE 4BQRA 1R50A 4YECA 3QYFA 3KUXA 4QBKA 1M1XB 3OOEA 1GLGA 3UWKA 3QY0A 3WMEA 2HCFA 2R00A 1W36C 4LYGA 2V5VA 1EVJA 4YRAA 2Q2QA 1K6MA 1IQPA 5IDXA 1KZ4A 5CT6A 1Z16A 4A15A 1ZI8A 3F49S 1H4VB 2VAWA 1IZ0A 3RRBA 2I0FA 3L92A 1PYDA 1S3FA 5L7WA 3HG7A 4NXNB 1T24A 2V7PA 4ZVSA 5LQSA 4ZI5A 4I50B 4PEVA 4MYUA 3L0DA 4FYWA 4WQMA 5A3RA 4A0HA 3EPJA 4ZPJA 1DJOA 3ZU5A 1IVNA 1U04A 3EXAA 4EY5A 3ETCA 3TI9A 3I23A 1QOPB 2ZSDA 5JI2E 3IMEA 2IYSA 3C0KA 2XMBA 2ZK7A 1NZDA 1OA0A 3GLHB 3OPVA 2PQ2A 1CFZA 2Q8PA 5DYNA 2P6NA 5BVHA 1SHTX 1AQNA 3ZHQA 3LCCA 3KJQA 3I30X 5DRYA 1GGKA 4KDRA 4ZDIA 2NVWA 5CCEA 3M6WA 4HVCA 4RJ2A 4KQKA 4PG8A 1XZDA 1G5HA 2IU4A 5D3MA 5JYEA 2CLLB 3FDZB 3QUQA 4UNQA 5FWAA 3VKHA 3WA7A 3KOXA 2GJ4A 4QO8A 4K05A 1E5DA 3JD1A 5CVVA 1R66A 1R8JA 1A5ZA 2VRCD 5COQA 1D2MA 1FZQA 1NVMB 1ZK2A 1TUEA 2O57A 3I0ZA 4R41A 2XW6A 1S02A 3I2IA 1OXMA 4PO1A 4CF3A 3AL0C 1GEEA 3RTAA 5YASA 3WNQA 2VTBA 3DM9B 3SWWA 3W1VA 1QRSA 3CRZA 5FF9A 4MYSA 2FF5A 3FCCA 2G36A 4R9SA 3REQB 2SBTA 5A5GA 3TRJA 1RJEA 4G4GA 4RU1A 4XWGA 3ROEA 2PIAA 5LVAA 3UNXA 3K5PA 4IUDS 3THXA 4A3SA 3IDFA 2YMLA 1H4QA 1DLJA 1US8B 2A3RA 2ZB8A 1X2BA 1GXSB 4UATA 4PANA 1W5BA 3ZWYA 1VHQA 2OGWA 1T0IA 1THTA 4JSRA 3P71T 1JG2A 3OESA 4CRWB 4POAA 3O8OB 3RV3A 4DG8A 3RUHA 3CY6A 1Q6ZA 2RAFA 1GN8A 1IG0A 3ZIUA 4EI7A 1AN0A 4JMPA 1TYCA 3B2QA 1L5HA 1NIPA 4BN5A 1L7PA 3G0OA 1JTVA 1YA4A 4JZYA 5FH9A 3PLNA 3MCAA 4D9EA 2C7PA 1Q22A 2HWXA 4RKYA 2MSEB 5AJHA 3O75A 5EXEA 2Q7OE 4AY2A 2CB0A 4J4HA 1P0PA 1Y7IA 1WDKA 1U7PA 3H9GA 5P8WA 3O8LA 1L5NA 2OLJA 4FHDA 4GP7A 1XZCA 1P5FA 4UCFA 4F0JA 4TMZA 3ZE7A 3D3EA 3JRXA 3WGHA 1ESZA 2ZYSA 4MW9A 3U1BA 2PKCA 5DHAA 1RP7A 1IWPB 4QFDA 2ZKLA 1Q57A 3BQMB 3KEGA 3VNSA 5EUBA 3MTIA 2QRKA 1JQEA 2V7BA 3FDIA 3OBBA 4D5EA 2GN6A 4BUCA 3NDRA 1ULZA 4FWTA 4P4GA 3CLVA 2VATA 3K20A 3RV4A 1RWKA 1FU4A 1QGAA 3FVTA 2Q2WA 2P0YA 1GA6A 2AKAB 1W49A 1Y7PA 4HH1A 4M49A 3U0VA 4PBTA 5ALOA 4G85A 3EOAI 4JU9A 2JHFA 2GK4A 2NP7A 2FAXA 2R68A 3ENVA 2C2HA 5BVHB 5KWIA 2VNHA 1ISPA 1VZ2A 1DG3A 1KP2A 2D1QA 3PS9A 5AI5A 5LQAA 4CT5A 1G64A 1V37A 1TJ5A 2B8WA 4EJMA 2PYIA 2VCEA 3ZJ5A 2OCAA 5B6IA 3C4JA 2BFEA 2I65A 2DKFA 3GEBA 3PQ3A 1G55A 5H0IA 3RVBA 4EZEA 1IZ8A 3PFFA 4OHPA 3U4DA 3PGKA 2ZTHA 2WB2A 3FD8A 3R3WA 4JOCA 3I64A 2HMSA 3QX8A 3M7IA 4MEAA 4ZQHA 2AMLA 1LRJA 2GNOA 5J9FA 2EJVA 1JHYA 3PJEA 4IR7A 2VTBB 3M70A 4C04A 2XDYA 3PRJA 1QQBA 4BUJA 1ZGBA 1DV2A 4WKGA 1M2KA 4J6FA 1MRSA 1G8AA 3GDGA 1WF3A 4AQDA 2VC2B 5CT4A 1A9PA 2Y68A 3THXB 1BSVA 4PAQA 4CDGA 3CVWA 2R1VA 4H1TA 2CKDA 2JFQA 4CHTA 1Z88A 1P33A 3VKWA 2HZ7A 1VBMA 1DDOA 2DKNA 2F1KA 3EZ2A 5B1IA 3C1AA 4ZYXA 1OX5A 2GM3A 2UU9B 1NR1A 4AXBA 4PNEA 5AQEA 2ODEA 4Z53A 5FBWB 1OX6A 2FCRA 2Z9BA 4US2R 1L5HB 5ALGA 2AEMA 3K1JA 1RBYA 1E59A 2BGRA 4GVPA 2C92A 2XUJA 3JYOA 3FUVA 4D96A 2IFTA 4F6RA 5CJ2A 4E30A 1QO7A 4CLXA 1A98A 1GYQA 4ITRC 4R2LA 2FN3A 3JD4A 4JH0A 5KC9A 2LGJA 1KJJA 2EJUA 2QXUA 4FC6A 2JS7A 3DCJA 4QPCA 2WTMA 3UK0A 3FOZA 1NX9A 1P8AA 4I08A 1NM5A 4LV5B 4CLDA 1FRQA 3WQHA 1QG6A 2ATXA 1HFKA 3CRQA 2PL9A 4AJ9A 4XPZA 3F71A 4Z1MD 4MW4A 2ZB2A 3KXIA 4AM8A 2P2ZA 3PENA 3U3XA 4BRWA 4LMBA 3RE1A 1T9AA 4N8DA 3RS0A 3Q9NA 1XZQA 1RXIA 5KOHA 2B82A 3K2EA 4BAZA 4E21A 3GUVA 1TUBA 1UDBA 2G8LA 1J2TA 3B7WA 4WZZA 4MKIA 1UXKA 5FIUA 4AWXA 1CJCA 5EN4A 2G9VA 4UMFA 4R7ZA 3IIJA 5J23A 2XMRA 4RGYA 1EDZA 4JDUA 2RGNA 3QITA 2B83A 4W5RA 1QG0A 3VOSA 1XKQA 2YJ3A 2ZJ6A 1MX9A 2BFEB 1DCKA 1QCZA 3SIRA 1Q0SA 5JS7A 4J3NA 1YS1X 4MWSA 1V2GA 4RZ2A 8OHMA 4ER0A 1IOVA 2IHBA 2ODQA 1U2ZA 2VQDA 1EYZA 5IAAA 1F0KA 1H93A 2X19A 3QG1A 4H3HB 1FW8A 4M89A 4M0UA 3W6ZA 1TIBA 1QX3A 4BLOA 2OORC 1SBTA 4JB3A 2HIGA 4CGYA 4KFUA 5NLLA 2WLTA 5LD2C 5KJEA 4U6NA 3WK6A 4R2KA 1A1SA 2R1VB 4KUHA 3RQIA 1L5WA 1TM7E 1UC4B 4M0EA 1MO4A 4URXR 3DFKA 1IJKA 3PE6A 3QVSA 1PEDA 1Q1ZA 3JQGA 1E9SA 1M34E 5IARA 1SC3A 2BJVA 2Y4NA 1P5JA 4X1OA 4GXQA 4CFYA 3KYBA 1RM5A 4ER5A 1AS2A 3HDGA 5IAJA 3SXJA 3ZDFA 3PR2B 4LWQA 2V5UA 3A11A 2IDMA 1VHWA 2OCYC 2R6CA 3GT7A 4N0PA 1LLFA 4NCHA 5FBKA 3ZWOA 4F6RB 1OZ0A 2PIDA 3CRW1 4WKNA 5CD9A 4WEOA 2CNLA 3WHKA 4O5AA 4MSUA 1J4AA 3V32A 1P4RA 1X39A 5DGDA 3NGXA 2W70A 3WIOA 1MJHA 1I6WA 4I4TA 4WBXC 3ZCTA 3I2KA 4B7AA 1GT6A 4EGSA 4UHKA 1TZCA 4JITA 3UMYA 2DQSA 3DD1A 2XTAA 3AHIA 4RPHA 3TAHA 2QLFA 1L5VA 3ZZ1A 3RSFA 5M7EA 2QZ9A 1YB1A 3PRYA 3DT6A 1GY8A 1TQ4A 3LW7A 3MWYW 4JR0A 4U7TB 4X91A 3UG7A 5KOHB 1Z15A 3HFGA 4WCDA 1C7IA 5ED0A 1TUBB 2ZJYA 2JHCA 4WK6A 5HG0A 4JQZA 3NCTA 1VHTA 2ZYHA 2PX8A 4TV9A 3R76A 5HA5A 1OI3A 3L8DA 1JR6A 4YI3A 2EF0A 3BBLA 3P2OA 1OXVA 1WPGA 3QEBZ 2ORED 1LQ2A 2QL7A 2QRUA 5B4UA 3MHPA 2PJDA 2AFRA 2VP6A 1KGSA 1E96A 3V2IA 4BNHA 2NYAA 4PX5A 2AJCA 1JKJA 3CNBA 4EARA 2JAXA 2Q1WA 3WSVA 1K3UB 3J81A 4EW2A 3D4BA 4KWCA 2GAJA 3FMFA 3PXGA 1L4MA 4JYMA 2Y1EA 2ACKA 4YBZA 4D44A 1CS4C 1ATIA 2RHDA 2A9QA 3NHBA 1KI3A 1KSFX 4RXTA 3IEVA 2IPOA 1EWYA 4X00A 3BICA 3SX4A 2JI9A 3WGIA 5IJ9A 1U28A 3DVLA 2GCOA 3P9QA 2OZKA 4UASA 4DMGA 8GPBA 3U6BA 3AF5A 5AVRA 1MO5A 2VL7A 3W8DA 3JQGB 4B2YA 1HC7A 1NA5A 4RYLA 5AVSA 1C9EA 1UAGA 1JF8A 2DTEA 2WUDA 4L50A 2WUVA 1SUAA 2JW5A 2PVSA 4I9NA 5FNZA 4CDMA 3N2GA 4IDHA 3ITKA 5BSEA 1N3YA 4YONB 2OCPA 2XUZA 1AUPA 4BXOA 4LZOA 1Y4UA 4LOLA 1AD2A 4JVOA 1TM5E 1N34B 1O08A 4CMGA 3GCGA 3ZH2A 4JGIA 1U9JA 3KZVA 4JLKA 2I1WA 3QEMA 3K9NA 2D0DA 1QLHA 2AFVA 5JSZA 3TG2A 3GT3A 4ITUA 4Q3AA 1R88A 5DTJA 2ZUTA 1R6UA 4R98A 4I4TB 3SZ3A 3IVGA 1SFRA 4YI5A 3QXGA 3MUOA 5CVDA 1E94E 1EXDA 1UDWA 3TZHA 2VJOA 2MU1A 4FDUA 3ASYA 3C6BA 4BLTA 3KSBC 2BONA 4F9TA 1LLDA 3GJYA 1GPNA 2GGSA 3E3NA 5EXPA 1QZXA 3AILA 1HETA 1GQYA 4S1NA 4QOSA 2MJLA 2RHBA 4EGJA 1BKYA 2CFCA 1U2PA 4UHBA 3SHWA 3J80A 4K8OA 4BV8A 3SBEA 4UE2A 5TS3A 4XWYA 1QOZA 1V8OA 4HNGA 1BW9A 3VNBA 1G0OA 4UUAA 1BA2A 3G0IA 2EFGA 1LD3A 5F76A 1GTL1 4TV9B 2WWGA 3IOMA 3QOXA 4REOA 3OQHA 1ST2A 4OU4A 1RLMA 3KXPA 2J9FA 3B3JA 3QRWA 4N39A 3ZWQA 3ZU3A 1SHUX 5HRUA 1M83A 2J9YB 2GF9A 3NBQA 3TSOA 3CISA 2BMDA 1L9KA 4JJEA 2V7UA 1ADGA 1NBEA 2CUNA 2IYPA 1FSPA 3UXYA 5HOQA 1GUAA 1U4OA 4EYOA 1XKTA 1LBIA 1Z3IX 3NHRA 3CUKA 3OMLA 3QKTA 4ZOQI 4UU8A 3AIMA 4BO1A 1Q83A 3I01M 3KE9A 1X3SA 2QAGC 1UBHS 3GC6A 1ULAA 3BD7A 1ODKA 4S2EA 2YV1A 1EEXB 4F4FA 5IJ9B 3JTEA 4QXPA 2AZDA 5FL7D 2GLTA 1WNTA 3L7KA 1UP4A 3M9WA 4HWOA 5DX8A 4ILKA 4Y2JA 3WGKA 5HM6A 2UXDB 1N2ZA 4B3DA 3KOZA 4O2BF 4AJJA 3QWFA 5E3JA 4JVNA 3KWJA 3BT7A 1W96A 2P1ZA 2ZWPA 1JZTA 4TQAA 3ULKA 3D4IA 5FBVB 2QW1A 3T5AA 4RTNA 3L7NA 2BKVA 3OQ6A 3O0TA 4WT7A 2WAYA 3SHQA 3TLGA 4FCTA 5IT5A 5KU1A 4BXOB 2DERA 5B58T 2Z5VA 4KIJA 2X8LA 2O06A 3PNLA 5B3AA 3ZGXA 2R7MA 5K3BA 5FXMA 3ZLTA 1YRBA 3QEMB 3FVQA 5CDTA 5JSZB 4ZWNA 4WV3A 4LXXA 3NFYA 4V0NA 1UXHA 2UXBB 1AQYA 4HB4A 2IYZA 2BGLA 4ND7A 4LBVA 3ZI0A 4CTMA 5HFAA 4OVKA 4UHFA 3EGDA 1X9HA 1N6RA 3SXPA 3PJRA 1OX4A 3T4UA 4J16A 3MD9A 2YXBA 1GKLA 1IIRA 3JQBA 3VHRA 4MWEA 4EYGA 4P92A 1JHOA 2R5NA 1CZOA 1Z2PX 2WHQA 3MGKA 5FJJA 5AYVA 121PA 2B30A 4E03A 4LBYA 3D7SA 3UY4A 1E69A 3U4MA 1ZI9A 3P0RA 3SG0A 1T10A 2ARKA 3ZBUA 2LUOA 3KEMA 3ESDA 4L2IA 5IK2A 3KU1A 5LP6F 5D7NA 1FQOA 5HJ2A 1HFWA 1LSSA 2J9FB 2OXFA 4XR4A 4C1BA 1R16A 2NU7A 4IRXA 1MXFA 4E1BA 1NPTO 3VC3A 2V4MA 3AXSA 3M34A 5ETJA 2DXIA 3U3DA 4GIBA 2ZYAA 2R8OA 3OFJA 3X3HA 4KDFA 3A4TA 5F5LA 4ETIA 4QOFA 2PKQO 4R8SA 4WJLA 1Z18A 4KIWA 3SYRA 4Y2PA 2X8AA 2C4NA 3UMCA 4H08A 3OHPA 1CS0A 4TS9A 1TPYA 5DF1A 4D9FA 1KWKA 4FFPA 4J0DA 5HP4A 3TQIA 4JK3A 1P3JA 1VB5A 5EJMA 2X2EA 1ZJJA 4I1SA 1QH1A 4YGXB 2GPBA 4IJMA 4BNDA 1SKMA 1QCDA 2ICAA 4BNXA 4CLRA 3I5UA 1KEUA 4DR7B 4DQ0A 2G04A 2GTIA 5LYJA 1BQEA 3EVZA 1ZD2P 2VDMB 5ESDA 2PTGA 1IWOA 3N2LA 2B6HA 3GJ7A 2V7XA 3PDUA 1C4OA 4OYRA 3AO0B 2Z57A 5KSOA 1YT5A 2H1VA 4RAQA 3LO5A 2OE2A 1K6IA 2WUFA 3JWIA 1P7VA 3TKYA 5BNZA 1BDHA 2GZ2A 3ROFA 5E1BA 4A4DA 1ETUA 4D1YA 2PH7A 3AJ8A 4ZTBA 4XEUA 1AO3A 2Q5JA 1PR2A 4JQYA 1QWOA 1VHDA 3GAAA 1PDWA 2VBGA 3ESZA 5HVNA 1IY8A 1BHSA 2G40A 2IPLA 2YC2C 2C4MA 4DQXA 2EKLA 4FT2A 2WF5A 4N0MA 4CTOA 1NLYA 3QLVA 4H7JA 4EHIA 4PN3A 1J5EB 4L22A 4ZN6A 5C8DA 5KZMB 2GRAA 3SS7X 3K1AA 4ZVNA 4ZKDA 3EGDB 4PNHA 2WEKA 4JJ8A 3DUFA 1OX4B 3UBMA 4CVNA 4EB3A 4Z7QB 2HBZA 1GU1A 2G4LA 3H6HA 5EKDA 5GM2A 3UWPA 3B36A 3UXHA 4RHXA 2HEIA 2VAXA 3CF0A 1RYBA 5EE1A 2IODA 1C1XA 1E1MA 3TQTA 5F73A 5H83A 2L19A 3PRKE 4Q1VA 4RS3A 1NRXA 2AF3C 1UAAA 4HLQB 4GFDA 2GEKA 5JDCA 4B09A 2PBZA 4L2IB 2G76A 1YDEA 3D7NA 3HTXA 1JVBA 1PF7E 2GSDA 2NU7B 1KYQA 3GUZA 4IHQA 4XD7D 5AOAA 4B6QA 4RUKA 4EY3A 3WICA 5ALDA 3V7NA 1DSSG 1UPBA 4GGOA 1KSGA 1IBRA 1XU4A 3IS3A 4WZ6A 1JV2B 3VPDA 1JIKA 2J1LA 4M87A 1CR0A 4XSHA 4EYSA 1DQYA 4DG5A 2X0IA 2H9YA 3OPXA 4DADA 2Y92A 3BSSA 5CH8A 4CCYA 4R71A 4YRMA 4TTQA 2V45A 2ZAOA 2BC9A 1BVHA 1OKKD 3LQQA 3IPAA 1CS0B 5HCNA 4GU5A 2AG8A 4HVTA 3ZE8A 4C7VA 5JIBA 1HM5A 2ZRJA 3NBMA 4EDHA 2QBYA 1DAPA 4RDXA 1QH1B 3C97A 1WMSA 3IIKA 4CLRB 1NF2A 2CK3A 3DG9A 4FZ5A 2RGXA 3QBJA 5EQFA 1GCAA 4IWYA 2UZ0A 4XA8A 5LYJB 1QGOA 1W0KD 2P0EA 5LDDC 3IAEA 3CNOA 3LVBA 5C5EA 4QZVA 1QXSA 1Z0SA 1YJAA 2F1RA 3G2IA 2IPXA 3ODPA 1KEWA 3I34X 3ZWNA 1D09A 1FLVA 4MXDA 5DX1A 4XFJA 2VPTA 4EP1A 4V1CI 1Q84A 2AHOA 2UYGA 2FQWA 2I2CA 3HVKA 5D87A 4F8JA 1KS2A 5EIFA 3MFQA 2UAGA 4ECAA 2SKCA 5BYAA 3H2IA 3QXHA 1E3JA 2OHJA 3SAJA 2AOVA 5EIOA 2CXOA 3WRVA 5IUJC 4DR6B 5E8JA 3RVLA 1Z6ZA 3H8SA 4H2DA 4GHWA 1M6HA 4OJQA 1LTHR 5A7FA 2VK4A 3FTNA 4JBIA 4Q9JA 3Q8LA 3RIEA 1I7DA 1E32A 1X6VA 3EDQA 2GDJA 2RKOA 1Y1PA 3EVFA 2ECQA 3K9QO 3K1AB 1YQEA 4L4SA 2VJYA 4LY0A 4Y2RA 2UDPA 2N47A 2PO5A 3DUFB 4P8RA 4MV6A 2FMFA 2Z2ZA 4FHCA 2QG4A 1GNQA 1HT0A 1Y9ZA 2FMHA 1XE3A 1DCTA 4LV6A 4BKQA 4C0XA 1IEVA 1C1XB 2A1UA 2E4WA 3G9ZA 4UPDA 5F3RA 3SKVA 2QVGA 5IZCC 1G9TA 1NHGA 4HQRA 4N03A 4X93A 5FAXA 3RUPA 4B31A 5EJ5A 3SVLA 2VDWA 2NVBA 4I7EA 2XT0A 1L1RA 4PM4A 4XB1A 1HTWA 1MX1A 4HPXB 4ALKA 4ROTA 5HS6A 1AKTA 1U7UA 5J5AA 3GRYA 3VOBA 4CMHA 5EPUA 1C9NA 4A6DA 1N2JA 1ZS9A 1YJCA 4KMRA 1M0TA 1NBMD 2C84A 5C1IA 1U94A 4BO2A 4PZPA 1TUIA 3BSWA 5H3CA 1Y98A 2PLNA 1Q0UA 2I2DA 3GFRA 2F59A 3LGAA 1J23A 1RFLA 1Z5OA 3Q98A 4G1CA 4NOJA 4CCYB 2HC9A 1U9ZA 4NBUA 3FNFA 1E8MA 4DCUA 5DRTA 3O8NA 3I01A 5GVRA 1FQWA 4OKNA 5BYBA 3UOWA 3K9GA 3GLHE 1NBME 1Z0KA 3PB3A 2QBYB 1QTRA 4RK5A 1XDZA 3QX7A 1M2VA 1AY0A 2CB9A 5C5CA 5C8YF 4YMLA 3FHOA 2F9LA 3I52A 3LC1O 3OH8A 2HCJB 2W6JA 1P60A 1JXQA 3B3AA 3B48A 3OCVA 4Z9AA 4Q3BA 2YZ7A 4F45A 4PC2A 2XVZA 4N4AA 3CZ5A 4NPCA 4HEHA 2BSAA 4MW5A 3SSNA 2GN8A 1YCFA 1G5FA 3OQIA 5LN1A 2ZVDA 1ZJ4A 1XTSA 4MUXA 4PO3X 3DMDA 1IM2A 4HWTA 4JI4B 1SKAA 2PKYX 2B4AA 2X13A 1A76A 2FWJA 4AUKA 3ZCSA 3DCIA 4BYGA 1LPMA 1ZIDA 1H2ZA 3IHKA 2A86A 2H8GA 3LQKA 3OWXA 4MV5A 4JR1A 4MWDA 3S55A 4LRUA 3IMCA 3RGWS 4MWCA 4Q01A 4ZI7F 3HZZA 2DQ4A 4GZLA 3UJCA 3C14C 5HILA 3UMRA 5LCXA 3I5YA 4N76A 1PJ3A 1UBSB 1U8FO 4MUFA 1L8LA 1WUTA 2RB4A 4OREX 2ZM6B 1X9GA 5E4TA 1MAHA 2BPOA 2Y1WA 2FFRA 2YWEA 3A7DA 4RNDB 2B7CA 5BUCA 2I62A 1W2GA 5JHHB 3GGGA 3HR8A 2BHRA 4KHPB 1BZYA 2IYUA 5DIFA 4BX9A 4EKYA 1KDTA 4DN6A 1ULHA 2A1UB 2OL4A 3GI1A 4M9CA 3ZDQA 4HUQA 3EWSA 4OIFA 5JNUA 3A6HA 3RVJA 1KO4A 1DC8A 2POQX 1GNSA 2J5KA 2WWFA 3INGA 1Y5MA 1GTG1 1NNLA 1E8NA 2VDWB 3ZNQA 4AJKA 3N86A 1FA9A 3U4QA 1TECE 3J81k 2R7AA 1XDDA 5IM5A 1YFZA 5AXBA 3QVJA 5J2TF 5ELXA 3L0YA 3PITA 1SCBA 1DT3A 2BE9A 5L3RA 1DU4A 3JAWA 4P6VF 2G9NA 4YAKA 2K7FA 3P9ZA 1WVMA 1WUJS 3V7WA 3VVCA 4ER6A 3IELA 4PLYA 2X0FA 1JDSA 1ESMA 3FM9A 5AVOA 5ALXA 1LRLA 3CBQA 2Q5CA 1PR6A 3QWBA 2OLKA 5A3SA 3EW9A 2IX9A 3JVVA 1S2GA 5EINA 3WMXA 1UR5A 4E46A 3RVMA 2JFWA 3VSCA 1L3BA 4U2DA 4WNIA 1IN7A 2PANA 3N6XA 3I3SR 1NU8A 1IUOA 3BQNB 1SQSA 3HSSA 2D2FA 2N46A 1M2VB 2NV0A 3FPHA 4TKVA 4KZPA 4CU5A 3QPDA 1EVEA 2IOFK 4FXPA 3RRNA 4YCLA 2GD0A 2I4MA 4IVRA 4AZ3A 3D43A 1YXMA 4EY6A 2Y0DA 2CZQA 4TMXA 2Q49A 5A2QA 5DX0A 5JHGB 5L51A 1SUIA 4L4UA 1FTSA 3CRRA 3HSKA 3T1NA 2GUWA 4B71A 4CFSA 3OQIB 4Y30A 4RXMA 1JDBC 3RFTA 3SICE 2D2EA 5K0GA 3UH0A 4OQPA 3HBFA 5AH0A 5H02A 4F04A 2XQFA 3BHMA 5C4MA 3R9KA 1XCJA 3VO2A 3MN1A 2J0VA 4OGFA 4UZSA 3LRPA 4ZYLA 3X0DA 4OGWA 2WA1A 2WJIA 1CZUA 1NW4A 3DF9A 1OAAA 5KOIA 1UODA 4OAOA 4L8WB 3MRSA 3GCWA 3L1VA 3WP1B 3RBXA 2NYUA 4M9SA 1R9GA 3FWHA 2NO6A 2H9IA 4EG3A 1M0EA 1M2GA 2XBUA 2A78A 2OBLA 3TB4A 1J9EA 3SQLA 5LU9A 3NWEA 2C42A 1E5VA 5FR1A 3FTCA 1SZJG 4CLEA 4O25A 1Y1LA 3FR8A 1PEAA 2EXXA 3KFVA 1I6LA 4L74A 4Q4DA 5HBRA 4OFZA 5B4VA 1RM3A 5F9HA 4FMPA 2ZTMA 4HUQB 1NRIA 3FX2A 3AP1A 3G6KA 3ND9A 3U13A 3L8FA 4BAUA 1O54A 5BN4A 4PG6A 4CF5A 4ITVA 4JBGA 3U4QB 3IOBA 5EOVA 3E81A 4F5YA 3GVXA 4MW7A 3OKFA 3GA5A 2H1CA 1W47A 3PKZA 3FNEA 1K7XB 4TKLA 3QPCA 1LNQA 3ESAA 3JAWB 4BE4A 3HZHA 3LNCA 3R1IA 3CV3A 3FSEA 5EJ7A 1AUXA 1S9HA 4E2ZA 4D80A 4W9NA 4URYR 2PFKA 3V8PA 4DV6B 1LPOA 3PF8A 3PE3A 4Y6OA 3RGGA 1KP3A 4EZBA 1QS0A 5A7HA 3FTFA 2OO5C 5C8ZA 5TB5A 4FW8A 3GUCA 1INLA 4PFKA 3ZXIA 4QPNA 5JAOA 3MWKA 5IUNC 4JJ4A 1WV1A 3A1NA 2GM9A 5CD1A 3BXEA 4D57A 4I1PA 3L8HA 1JH8A 1J0EA 1T5TA 3D8NA 4XW2A 4YCAA 4RKRA 1JBEA 2B2CA 2QG6A 2XCOA 4TKVB 2G8NA 4F12A 1NIJA 5EP4A 5H7XA 4OB6A 5KC8A 2WIKA 4M98A 3MTJA 4AZ3B 1KOJA 2X0NA 2YDYA 4M7RA 4B3MB 4AZTA 3A1TA 3T1HB 3D3NA 4OYLA 5IM4A 2D3TA 3IL2A 1U8YA 1MIOA 3O38A 3V80A 4X61A 4GM0A 3W6OA 4KIGA 4B5LA 3LGSA 1W4BA 4DIUA 3EUWA 2UZAA 5KWSA 1WPQA 1B0AA 1TK9A 2I1LA 1I2ZA 2Q41A 4RCYA 2W4MA 2QVLA 2CMDA 2J07A 1OFGA 3PHGA 3OCJA 3KTDA 5IPFA 1KAGA 1PAUA 1E98A 2RCYA 5E7IA 2JLSA 5JYCA 3V1NA 5LQMA 1N0UA 4LCEA 1N1DA 4W7IA 4LVOA 2FX3A 2VHTA 3WYDA 4EF6A 1I94B 4FYYA 1UZAA 1PT9A 4S1WA 4D9CA 2NSJA 3ORRA 1W5AA 1C0PA 4Q02A 3I1JA 2I4IA 4XJVA 1RBZA 4FEYA 3UK6A 2ODTX 2O5RA 2H6EA 2P5SA 1PX0A 1AF4A 1V45E 3A10A 3LWBA 2HNKA 2G4CA 4BS9A 3W6UA 1VKRA 1MG5A 5FPTA 1QQ6A 1K6XA 2PRJA 4ZOEA 5BN4B 4C4OA 4LQDA 5KTKA 3HO6A 4O4LF 2JF0A 3U80A 3DZJA 4U6SA 4ZZ2A 5A5VA 2ZIFA 2E49A 4MVJF 1ZXXA 3SOZA 2HD4A 1QFZA 2HJSA 2XAUA 2HK9A 3C6ZA 3S2UA 4XD2A 5MN4A 1GKIA 5CK5A 4HNHA 4GX5A 1FRFS 3R20A 3HP4A 2VQEB 1VCMA 1QS0B 2LDXA 4GUDA 4IZIA 1NR5A 4LX0A 5ERYA 1DG9A 1H3EA 3TZ6A 3TS1A 2HHAA 1YBHA 2FPWA 2A9PA 1NGSA 2RBEA 1EQAA 1UC8A 2ASVA 1Z4QA 4JIGA 4MI6A 2AXPA 2ZRNA 5BT9A 2DFVA 4ZXPA 1SELA 1ENPA 4NYIQ 5L4LA 4XIJA 1YQXA 4WXYB 5K45A 3AY3A 3HCDA 4OXXA 4A2QA 2E4XA 4NCIA 1JDJA 3VPSA 4MDFA 5JH7F 1TF2A 3DMTC 3B3GA 4EF4A 4JU8A 1ARZA 3GRRA 4FWIB 2BZ0A 2P7IA 5JTTA 1BVYF 1MIOB 3NS7A 4G4IA 1CUHA 3PUHA 1P2FA 4ZIRA 4A92A 1BEZA 1B4DA 3NASA 3TIVA 3OO0A 3TLYA 1UEXC 4MINA 5LWHA 2YJZA 1KQNA 5A62A 1HF3A 4OH1A 1C0EA 3E5MA 4LFBB 2GEDA 2OBYA 2QLMA 3NJ8A 2FSHA 2IHKA 1ONNA 2VHEA 3MG9A 2POCA 1L8OA 2QR3A 2W48A 3AYXB 4LJ8A 4X54A 4ZOLF 4URHA 5JBQA 4ZREA 3DMNA 1T0UA 3BULA 2XKJE 5K6TA 2N3ZA 1ENZA 3SDZA 3QYJA 3HUDA 2W8BA 2BDTA 4O4IA 1EFPA 2NZXA 2R1ZA 4TTAA 5T8KC 3NWJA 3WGNA 2J5XA 2VF8A 3N0TA 1PP4A 3T5PA 2I6TA 4IIGA 3TDKA 1BXZA 1CG6A 2Q4BA 2DFDA 1U7WA 1XD9A 5KIAA 1JEJA 3LQYA 1G0NA 4XDYA 5GADl 1SOVA 2O7NA 2OILA 3IT3A 2COEA 3RSZA 3KT0A 3IQZA 9ATCA 4ER3A 3U26A 1B6RA 4YRDA 2OTCA 5ALKA 1J09A 1D4OA 2A0KA 1AMOA 1KI6A 2QMQA 3GN1A 4PLVA 1V7QA 2DAPA 2Y6UA 4JVLA 4FIZA 1G66A 2FR0A 4QC2A 4WA7A 3DLIA 5AMXA 3S7ZA 2CBGA 3SBDA 4X1YA 1QZTA 1ZMBA 1M1YE 3FKSA 1AZTA 5JJLA 1GTVA 4XASA 5HIAA 4F2GA 3UA4A 1V11A 3ANNA 3UUGA 4JC0A 1VJCA 2ST1A 3C85A 1PG2A 2XOEA 4UW9A 4K1LA 4MIOA 4YPFA 4GPAA 4QYSA 1VCNA 4PHGA 4KRXA 4HGZA 2I8CA 3OQBA 2X3YA 2WWIA 2FFBA 1WMDA 2Q8QA 3FSJX 2ZI5A 3HKCA 3M5DA 3ZU6A 4C7OB 3OOSA 3UJ8A 1EFLA 2BEUA 2Y3IA 1XWIA 3PGVA 4DC1A 2XRYA 1JR2A 3HJFA 3TD6A 1XDBA 2P27A 5FWXA 4Q1FA 2LCFA 3AX6A 3DAPA 3HDHA 5A1TA 5JISA 1QVZA 3GJ4A 4GX2A 1HBJA 1FBTA 1KC3A 2C07A 2H4YA 3MYRA 3VSEA 1WZEA 2FU5C 4DMMA 1UAYA 3KEQA 5DNCA 2RJOA 3MGBA 4ZIRB 3KQPA 3FFAA 4H0NA 5DOVA 1NOJA 5ALMA 3UJBA 4XGQA 4D9HA 1ECLA 3QPAA 2Q6KA 1N2OA 2GEJA 1CF9A 1XTIA 1IRIA 4XVUA 4DGSA 4ZKEA 1PZFA 3OOJA 3K72B 5AVTA 1I30A 1Z6GA 1R6DA 1P0CA 3DT8A 1E7MA 1U7DA 4WL0A 2ZM5A 3O4FA 3DB2A 4A1FA 5K0BA 4WGFA 3IPYA 2GM5A 3MWJA 2FUKA 3ZHTA 4PE5B 2H1WA 1YB7A 2WDPA 3HXKA 1WL8A 4TTSA 4QFCA 1KI9A 3H2JA 3SR4A 4IH4A 4JQCA 1QYCA 4MNTA 4R31A 4XGNA 2AOXA 5JS1A 2W8BB 3FFBA 4KWHA 4O4IB 4BEBA 1DRUA 1EFPB 1ZD5A 3AEZA 1GG8A 2ZLBA 3VU3A 2XLBA 3ZWPA 1CUEA 4TTIA 4CL3A 2D1TA 1ZKDA 1MUUA 3W6NA 1ZVQA 3NHSA 1U2DC 4IG4A 3KSAC 4I3HA 3P52A 1IEXA 3EZ7A 2FLVA 3QIVA 2AJTA 3FYHA 2WSLA 5BPHA 2GLXA 3A9WA 4GMFA 4BY9E 5FO1A 1QYRA 3OUZA 4OPMA 4FQ8A 5CIWA 2R6R1 1KI6B 1BTOA 2KLHA 3BSFA 3D0OA 3BMQA 2YMMA 3GNLA 4ZT3A 2NG1A 3PT9A 5LZ5A 3V4OA 5B3JC 3T5BA 1G5QA 5DASA 4M4SA 2XUHA 2NZVG 3LLCA 4X1YB 4L27A 4RTQA 5DMXA 1A2QA 4QODA 8ATCA 3UWOA 2QL6A 4RPIA 2PNJA 1V11B 3FYUA 4UKDA 1P0IA 2LE0A 4D42A 2PFGA 3AETA 3IP7A 2ZBRA 1NNI1 3NOQA 2CWDA 1LZKA 1QH8A 1TT7A 2FDRA 4RCVA 4WTOA 1B6GA 3VC1A 4XLTA 4YV1A 2VAPA 3TW6A 1OA1A 5KHLB 3BCSA 3HKCB 1B43A 2HBQA 4JP1A 3OX3A 4OGGA 5K20A 4WBNA 1FLDA 2F64A 2BEUB 3FBTA 1A71A 2OB2A 2RGRA 2B4TO 1F7VA 5JD3A 1ZAYA 5A04A 3V4RA 5FWXB 3V2UA 2D1YA 1JDPA 3NT2A 3FOCA 1U1GA 1MOZA 3OCYA 3Q0TA 4Z4FA 2J9GA 4BNKA 2E48A 1GZHB 2R1TA 2EF1A 2Y6VA 3EULA 3ZVKA 4K9NA 1FY2A 1GILA 1R0ZA 3HNOA 4JVMA 4PV7A 3IP8A 3MB5A 2VJMB 2Y1LA 3O82A 4WGGA 3HZRA 4CUJA 3K2QA 3A4VA 3KKPA 4BNUA 3MPOA 1NNEA 1XEXA 2PZJA 5DFAA 4P3YA 1MJFA 1Y1TA 3OICA 1FBNA 4BJ3A 4BQSA 1A8QA 1HTTA 1QO9A 2MR5A 4K9OA 2JLVA 4Q3OA 4JI2B 3BHIA 3RK0A 1ND6A 6ABPA 3L49A 2PX4A 1LC3A 4V2IA 5ALYA 1Z25A 3CKMA 3EA0A 4C0AC 4LF5B 1DRWA 3ZUGA 3ER6A 3N0VA 1J2RA 3B12A 3LUPA 1VPWA 5SY9A 2IYAA 1GITA 1U1EA 3ZEAA 2OO3A 4S1OA 3DV0A 1FTYA 3PQ2A 4GRAA 1XRRA 3RHZA 3DE2X 1ENOA 3F1KA 3E82A 1Y3AA 1I8TA 4YTEA 3W4JA 2DHEA 2IYNA 4ZYWA 1MHTA 2XY4A 1QDUA 3NJ4A 1BXKA 4L7VA 2WW8A 3L4BC 1MX5A 1B41A 2BCEA 3H4TA 4W5WA 1NMQA 2DBVO 2Q4EA 3JWJA 5IBRA 4Y2SA 5JANA 1MT0A 3EG9A 1CY2A 4D02A 1PL0A 1ZJ6A 3OTQA 4BZQA 2FFQA 4J2OA 2QMUA 4M0MA 5CM9C 1YD7A 1QWSA 4ZA2A 4BMNA 1ZSNA 1ETHA 1PS8A 1G7CA 1OCEA 2NUBA 4D26A 2OC9A 3BMQB 5JFOA 5EE9A 1C2TA 1E5LA 2WVJA 4IZ6A 2HA6A 3VR6H 3TF5A 3PQ8A 4YR7A 4ZODA 3GCXA 4B4WA 4OAQA 2HXYA 4PXAA 1E20A 2YOFA 1Z0DA 3F3YA 3KJFA 5IK2D 3FYUB 3OC6A 1KFKB 2CWWA 4MR9A 3CMMA 4IICA 2GPSA 4DJTA 3AETB 2JJ8A 2F1JA 2VKTA 3LX4A 2BOVA 2CHVA 3DD5A 1QH8B 4GLOA 3REFA 1H9CA 2P79A 4E2YA 5JXHA 3MMNA 1GGHA 1NL3A 1O9HA 1JDVA 1S89A 1I0LA 4H6PA 1DHTA 1QONA 4OGKA 3RS2A 2UXCB 1HPLA 3QGMA 2DJIA 3GK3A 4DRYA 1A8HA 5G02A 3FLBA 3WK9A 1G8GA 3DMRA 3EDRA 5CIQA 4BTLA 3GPCA 1Z4KA 3EMDA 2GR9A 4DG9A 1NXXA 2R1TB 1FRVA 4QUAA 2P5YA 1U1IA 3KT3A 1UMKA 1MQSA 3QWIA 1UF9A 3D6HA 1U0OC 3SYNA 4ENUA 5BVGA 2FOXA 3GJ5A 3K15A 3M1IA 2Z5GA 3LDUA 4JBYA 4MKZA 4UMVA 4AJ4A 1A3CA 3D8RA 1LCIA 2XH8A 3EZGA 5K8IA 5AESA 1XPJA 3OEYA 1VMDA 4BNYA 4Z4GA 2PO7A 1N2SA 2VVTA 2VF4X 1AB6A 5K05A 2V1XA 1YQGA 4YJDA 2C7OA 1SIBE 1RWNA 2NVOA 1SC9A 2UVQA 3K32A 5TF0A 1YE3A 2YN0A 3QTBA 2P9BA 4RHYA 3RUIA 5ITSA 1REQA 3GX1A 4YEDA 5JTUA 1OVGA 2H31A 2VP2A 1WP4A 2I6SA 4CQLA 1H6DA 3T4EA 3FUXA 4MICA 3DV0B 1QF9A 3ND5A 4ISBA 1K6JA 1P7WA 4MIKA 1EMDA 4FKZA 3TAUA 2JFZA 3VGPA 1E2DA 2X8BA 2QT1A 3K2BA 3R9IA 3K16A 3L6DA 4UHEA 3L82B 1GUZA 4ICIA 5AR1A 1OV4A 4WRRA 4XQGA 3WWPA 2HI0A 4G01B 4C2BA 3NH9A 3LRXA 3P9CA 3EG9B 4OQ4A 1B14A 5CB8A 5KEIA 1KI8A 4LKRA 3ACCA 4PIMA 4MB0A 1Z82A 5C1OA 1U3FA 3GFTA 4MK4A 3DUWA 1SNYA 1QHXA 2VS1A 4TV8A 3KXLA 3L7YA 2GQ0A 3TXYA 1UXOA 2I7DA 1N2BA 4OTZA 2P77A 5JBIA 4BU1A 1J6UA 2X9GA 4JI6B 4Q9KA 1EAYA 5FWNA 4FFBA 2RC6A 2XOKA 5LXTA 1PL6A 1M6NA 1T26A 4GMGA 1I1NA 2VI5A 4YO8A 3GJSA 5FCDA 3W3AA 3T12A 1ZOLA 1QGYA 1P5HA 2RHMA 3GD7A 4MEJA 4MR9B 4MW6A 4YDSA 2P6RA 1XEAA 4U8HA 1Z36A 5AI8A 2ZSKA 3PXCX 3F97A 1PN3A 3FAKA 4R1TA 4KO2S 1ZWKA 4BBJA 3VSBA 1S1MA 2LP4Y 2OSBA 2WUGA 1VE1A 2CHFA 3GFQA 1AV6A 3DONA 4KK4A 5FA8A 1XZIA 4BFCA 4I1YA 1ZN7A 3KQWA 1CY0A 4YJHA 1T2AA 4XWKA 1O95A 3LTEA 1P0FA 1RYFA 4M0LA 1ZCFA 2NV2B 2PCJA 3TBFA 4AC9A 1V4VA 2I7XA 4DBVO 1L5OA 1L6RA 1JPVA 1OYOA 4OQDA 3NH6A 2X9LA 4KAJA 2A0XA 2P4SA 3OM8A 3RJZA 4HDQB 2WHPA 2HK6A 2DBQA 4IHJA 4I3GA 4LWZA 5BVGB 3NBFA 1B42A 5CM8B 2E55A 2YOGA 3OURA 1ANKA 3P0JA 4FMCB 3JQDA 1G8PA 3E58A 3PD0A 2UZIR 4HB2A 4EUFA 3QW2A 4CCSA 5ICGA 2FI1A 4WASA 4F6CA 4YAJA 1H2BA 2QB5A 1PQYA 3O3CA 4YRFA 3RVQA 2EZUA 4YR9A 1SPXA 1P1CA 1RM4A 3A1VA 1Z6QA 3F6PA 1OPRA 2PZLA 2ZIWB 3PSAA 5BR7A 3EIWA 3HCNA 1REQB 5A0TA 2FRDA 1NN0A 2WYIA 5JWHA 4CQLB 4B3SB 1NMXA 4UOZA 2QN6A 3AFOA 1ZOOA 2ZIXA 3KLOA 2JIOA 4WFQA 1FS4A 4BIIA 2CMHA 1E7RA 4BVHA 4NECA 5JNTA 4B87A 3ICEA 4RO0A 1A4IA 1I3CA 3L6BA 5D2CA 2FN4A 1QP7A 5A5DA 4RTSA 1H9AA 5L3SB 3DAHA 2LTAA 2W6PA 4UREA 3H5AA 4R1PA 4II7A 4UAVA 3V00A 3N28A 1XWFA 1JT2A 2ETVA 1WHSA 3M81A 3MQFA 4IL5A 4OQXA 4TV8B 3OQJA 4WDRA 5BQXA 3ZVNA 1ZK3A 2RCNA 2YNMC 2I2XB 1CY6A 3PA8A 5E7JA 1IQUA 2CUKA 3IEIA 1NJSA 4FFBB 2FZVA 5LXTB 2VHCA 4LZJA 4TL8A 3EAGA 1N1GA 3Q9UA 4AG5A 421PA 1RLIA 2B34A 3S0JA 4HRVA 1CRQA 1UH5A 5T64A 1ISSA 3H13A 4FT4A 4HQ0A 5BWOA 3DLTA 3AL2A 1FSGA 4Q34A 3TYXA 3EEIA 5ECGC 2V9PA 1HLGA 2DQYA 2WMYA 1GZ3A 2QRVA 4F38A 2BJHA 2PX0A 1R18A 1ODFA 1TQ6A 5FFNA 2I78A 3WMWA 3F9IA 1W93A 2OHVA 4FMDB 3NT5A 4YJHB 5GOZA 4GX1A 4RETA 5DSXA 1PV1A 3SIPA 1F8UA 1KI7A 4PYMA 3QWAA 5I7FA 3UENA 1BDMA 5I5GA 3EEFA 2VYNA 2FA9A 3MTDA 4NH0A 2WHPB 1YOVA 4D79A 3CLSD 4IHJB 3TM5A 1GHTA 1I10A 4IP0A 1SG9A 3VVBA 5HFJA 5C3MA 1H6CA 3P8ZA 2UUPA 1A7UA 3NHPA 2W6JD 3UCFA 4C3ZA 5AI6A 1IN4A 1NWHA 2YXPX 2QNBA 3C4VA 4R8VA 3B3QA 3U09A 4N41A 3OEWA 4X44A 2DB3A 4PAOA 1YIOA 2H0AA 3FOBA 4UCWA 1D9ZA 5HDQA 1F20A 1KDOA 1PWYE 2B37A 3ONEA 1T0JB 3S2EA 3SGLA 1ILEA 1KEPA 5IWAB 1VGQA 4JYCA 3PFKA 3B1KA 3ZV6A 5FBRB 1UMBA 5EJEA 3BJIC 1VL0A 4KV9A 1FF9A 1UWVA 5CJJA 1CSEE 4Z54A 2P11A 1QYDA 2HIAA 1EFTA 1LA2A 4CM7A 5EQJB 2ZIXB 4XRRA 4NV3A 4L15A 1GVHA 1VKZA 2Z04A 4NK5A 1AKRA 2G7ZA 3MXOA 5CFMA 521PA 4MUKA 3AT1A 1Y3DE 4DLRA 4MKHA 5EZYA 4JQSA 3L4JA 2BM1A 4IOJA 2OXEA 5BSFA 2PS0A 5IJAA 4AY4A 5KHOC 1HEUA 1SBIA 4W6ZA 4BO7A 1GZSA 1O03A 2ES4A 3FN4A 5K09A 1N33B 3QW4B 4LXTA 1WHSB 3QTTA 2IS2A 1YU9A 4TN5A 1TKCA 3O9ZA 3L04A 1QORA 3LTNC 3C3AA 4INOA 2WT4A 1E6KA 1NQUA 3KQTA 4CCAA 3HJCA 4M38A 1NONA 1ZN8A 2VJPA 4UEWA 3TJZA 4BQFA 1E7WA 1DUVG 3PFIA 4LRTB 5JMWA 1ATZA 2AWOA 4JC4A 3VO8A 5DYYA 1B3BA 1UKEA 3CZCA 2H8KA 2KYRA 2ZW9A 4JUCA 1PD0A 5LJIA 5JPDA 2DPGA 3CIOA 2FZ5A 4OI4A 4K6CA 1P2SA 3LIIA 3O94A 3DL0A 4JLDA 1M7GA 1AGRA 2R3SA 3KO8A 4D25A 3RS7A 2WF6A 1CW2B 5CURA 4YRIA 1FRNA 1UPCA 1YQQA 2ZAGA 3EH2A 1CC1S 3H18A 2PR7A 4X6YA 3GLIA 3IULA 1T5OA 4RYDA 1XF1A 2V3VA 3AVPA 5BR8B 3KE8A 1G8MA 5JFTA 2GSWA 4YVFA 1BHO1 4DF3A 1YH3A 4JXJA 3DOCA 4DUGA 4U39A 1OC2A 2ZG6A 4NAUA 1G8SA 2F9MA 2VNIA 6LDHA 3G5AA 1YFJA 3MBOA 1VYUA 4EJSC 5EAIA 2OCBA 5AVXA 3PVZA 4B17A 1EIWA 4L6IA 3HACA 1I7PA 1XFDA 3NI2A 4OMCA 4Z99A 2H4JA 2TMDA 4AW9A 1SVKA 3JSXA 2XDAA 2OAQ1 3DOHA 1UMBB 3HO8A 3RTGA 2ZRDA 1BO6A 5CDSA 5IBCA 4FCVA 1X80A 4Y9TA 1Q1GA 2IVFA 2GD6A 4DDHA 4BFSA 3Q1LA 1EXNA 1A2KC 1LPSA 4ZQBA 1Q11A 1NSYA 5E95A 3HPQA 3RRJA 5EGSA 3NMUF 4I1RA 5EZSA 4ND4A 3G5UA 1ZXBA 2IL1A 5EZYB 1V8PA 3SDSA 1OREA 2I55A 2WHXA 4AN1A 1JU4A 2B4QA 1NT2A 3I9V1 2B2XA 1P80A 3B6KA 2HQOA 3KP1A 3RYTC 3S7TA 4JOSA 5DBOA 5U1PA 4DLYA 1KH2A 1AN9A 1JVNA 1XVUA 1NKTA 2GZ3A 1O7JA 4OF4A 4PLCA 4WBNB 2Y9MB 2DFTA 2FE4A 1VL5A 3DV2A 4P0PB 1ZSYA 1FU8A 4QAQA 4D46A 2BTQA 2CLKB 2NO4A 3DFZA 1JU3A 5REQA 3WB9A 5ES4B 4PTZA 4JB0A 4LXHA 1NBHA 5FO0A 2LBPA 4HC4A 2B4KA 4KKXB 3QU9A 5FPSA 3M3DA 2XXBA 4HMPA 4DQKA 3OFSA 4BPBA 2J9XB 2ZR9A 4OH7A 4C7MA 5B7GA 2TRSB 3G85A 4UBKA 2G9UA 5SV2A 2OYSA 2CE7A 2YR0A 3GH3A 4D9GA 3O47A 1RYEA 1SULA 3LX5A 4FBMA 4KV7A 5T4FA 2J6CA 1EM8A 3LXUX 3OTHA 1KY3A 3EXFA 3O1JC 3K70B 4IDPA 1YC5A 2XQVA 1M6WA 2OM6A 3SJ7A 4EMBA 2BFWA 3GLIB 2HT1A 1XPRA 1CUSA 2YS6A 4XYMA 4ZV7A 3EZLA 1GFZA 3COZA 4D41A 5A71A 3DE5X 2Q8NA 5IXJA 1T8YA 1EDEA 1PJQA 1GT91 2HSDA 1ZKMA 1J25A 4RAOA 3AFGA 3BBPA 3HXPA 2PX6A 4G23A 1CY4A 1BKDR 3MT9A 3O26A 4HH0A 1SBCA 4MH0R 5J4LA 3MWGA 2OYCA 3UC9A 3ZLJA 1S2OA 1NPDA 1H6AA 4MUJA 4YV7A 1K8YB 1VXOA 3BXHA 4DR3B 4BEJA 2MR6A 4L78A 2Y1CA 1XYYA 5A06A 1KXZA 1RHJA 2LVBA 2MSWA 3H5WA 5DULA 1FDWA 3FYCA 1O5OA 4IIJA 5DGIA 3VTAA 3BWYA 1X80B 3RLFA 4IDEA 4BNTA 4W5QA 1WAMA 3N05A 1NJ6A 1QSGA 3ETNA 1ML4A 2W90A 721PA 2P9TA 4G4SP 3CZMA 3HJRA 1ZH8A 5I9SA 2NU6A 3A36A 3EDMA 3EZ9A 3ZLBA 4HZIA 3OQOA 4AZSA 3HDYA 4KBYA 3VR4H 2NLOA 4R81A 1P0MA 3MCVA 4E7OA 1OFUX 3BB4A 5AKEA 3RB8A 1B16A 3ZK8A 1HL7A 3F6RA 4R3UC 4EW6A 5KSYA 1W73A 2O8CA 3WIVA 1QH9A 1RAIA 2V59A 3CX7A 3KAJA 2VFAA 5JE8A 1O6GA 5JASA 5EHXA 3LA6A 3D8BA 3V34A 4WESA 3HCWA 5JAQA 3NIWA 4RJJA 1KQOA 1E4EA 1OROA 2B25A 2BTQB 2C2MA 3IKVA 1YS9A 4LGVA 5HS4A 2F3QA 1F9AA 1PR9A 5REQB 3LFHA 5IXYA 3EQ6A 5EIWA 1WXHA 5FHQA 1TGYA 3O8BA 5H80A 2PJRA 3L18A 3HXMA 1G2IA 3OZFA 4Z49A 3IQDB 1ZRSA 3ROZA 1I3OA 3J7AC 3QBTA 1PS9A 2R5WA 4L72A 3RVOA 3D0KA 3I4FA 3FKJA 2RKWA 4JCOA 1JFRA 2KI5A 4HAYA 4RLHA 3VX4A 4BDSA 3KQLA 1EM8B 3B5IA 4J7UA 3EXFB 5DN6A 1PJ2A 2CVZA 2V96A 4DKXA 4F11A 4BP8A 1S9DA 3NM5A 2C0QA 3GNQA 4Z4QA 3WTBA 3L9XA 4NATA 4BO8A 2QTGA 4ERNA 5ICMA 1P29A 1BDIA 3OCZA 4F86A 1OIVA 3RIGA 1RI1A 3L77A 3HADA 4LDAA 3GJRA 4X63A 4ZQFA 3EUFA 5GONA 1WD5A 3HYLA 3PQ6A 5ENVA 2PL3A 1II8A 2YS7A 4QQNA 4ER7A 2O59A 3W9UA 1ECBA 4UNSA 2NADA 3NUQA 3OCUA 4XAQA 4ENVA 3AUJB 3KJHA 1XMIA 2OP0A 1JBQA 2YN4A 1ABFA 5ER9A 2I67A 4U9IS 2P5TB 5I8PA 2PZAA 1G5PA 4XYLA 1Y8AA 2C4WA 3DXFA 2GJ9A 2Q1UA 4IIJB 4ONEA 4UEJA 3Q7PA 4N0DA 2WM8A 4QREA 5C31A 5BUQA 2PJUA 5TGTA 1CVRA 1N92A 3T7SA 1WULS 2UYQA 1U3UA 2YWXA 3E7XA 2CZCA 3GQBA 4YA6A 2H2HA 1NNSA 1BKSB 1X7ZA 3V1UA 3HXQA 3ILYA 1QHHA 2XCRB 1AJEA 1W5TA 2NU6B 3QE2A 1PT6A 1U3GA 4RFLA 3U4AA 4E0BA 1W36B 2I91A 5MFPA 1SIUA 3N8GA 1T9GS 4I4IA 4RA9A 1RACA 1C1DA 4OUDA 3P9IA 4U0JA 3IB6A 3ZVLA 3PNKA 1CY7A 2IBTA 4PYJA 1ZAKA 1YUNA 3I2YX 4BKOA 2O8CB 2DC1A 3ILXA 1JHMA 3BMCA 3MK31 2ET6A 3NHYA 3L46A 3QE3A 4YP0A 5C52B 4NABA 4R2MA 1JE1A 4MTCA 3RC8A 1UJ2A 4M1SA 2O2SA 5IC6A 5KYXB 1EVIA 1JSZA 2B1JA 2OYRA 3MA0A 1E4EB 1V9SA 3Q41A 3A2NA 2OQIA 5DBGA 3ZWMA 2CLIB 3FHTA 2L82A 2DPHA 1KAHA 2ZSHA 3EGIA 3GMSA 3KPWA 4NBVA 3DEYX 3DHNA 4B40A 1Z39A 1M2OB 3FKSD 1IY9A 4UD6A 1KARA 1QU2A 1TEVA 3L4EA 3AESA 4PQEA 2F8TA 4ZRMA 4WK2B 4UTOA 4AMZA 1N0IA 1ZFNA 3DFUA 2G70A 2MT9A 1MB3A 1ORVA 4Q9NA 3ROQA 3VI3B 4BZWA 5F23A 4QQRA 4IPTA 3IBFA 5I4BA 1MJNA 3L7MA 2DBYA 4R1SA 4RZIA 1EGMB 4U2BA 2AK2A 1GCIA 2VHWA 4DEXA 5CAEA 1UK6A 2Z56A 3UHFA 3GFOA 3JTMA 4MQUA 1R37A 2M2IA 2OBBA 2JPDA 2XE7A 4HOYA 3M5CA 1YRWA 4IDDA 4BX3A 4Q4AA 4FD3A 1N8TA 1N9GA 1IATA 1GTZA 1WDWB 2C8VA 3JQQA 3TRDA 3DOIA 4D6YA 5GONB 4KAAA 1J9GA 1II8B 2D0OB 5CH3A 5BSUA 1AK9A 3IEXA 2FZCA 2JGKA 3BIOA 4K0RA 4UUOA 3I2GA 1KJZA 2F48A 4YCMA 4B2PA 3H3JA 2RHOA 1NTRA 5TQ0B 4E5DA 3EZXA 5G3ZA 3WDSA 4Q48A 1P31A 4C4RA 1BC5A 3EA5A 2WJ3A 1NULA 3SC4A 3WFJA 2ZE8A 1OW3B 4C6HA 3GQBB 1FVHA 1MGPA 2D4AA 2GA9A 4D3XA 1RW4A 1O4VA 1W94A 4GWKA 2Q2VA 4YRRA 1X7ZB 3P7MA 4G97A 1F4VA 4P7JA 4DVGA 4F97A 2ZUEA 1QHHB 2J7KA 4B80A 3U37A 4UHDA 5SYAA 1NR7A 4YAGA 4HX9A 1O9BA 3ZV7A 4RA9B 1F3OA 1C1DB 2RH8A 4OUDB 4CWAA 5SZJA 1QOQB 1XCLA 4MA5A 1T2EA 5JMOA 4YCDA 1AA6A 1Y4AE 1Q1BA 1IHXA 4DMCA 1IHYA 5FTMA 3BMCB 5BSKA 5A4MS 1M6YA 4ZANA 1P62B 2A2ZA 3AZQA 3OFKA 5LB4A 3DVAA 1BDBA 1N7GA 1PDOA 5DCWA 1SWWA 1YJ5A 3CSDA 2PLRA 1SG0A 1VG8A 2DWCA 1YTUA 4J75A 1XTBA 3IKJA 4P2BA 2QLNA 4HAOA 1N3BA 2H54A 2OBXA 5SZKB 3FZNA 5ILOA 4MQLA 5KCZA 1ML3A 4BTVA 1UM9A 1CQIA 3TXAA 1I3NA 4ZCTA 3QE9Y 3KS9A 1DKQA 4HQFA 3TQHA 5BP7A 3KUKA 2BGTA 3AESB 2E4ZA 5G0UA 3TM4A 2PUTA 3I32A 3B6IA 5AK3A 4R0MA 4RANA 2LZ0A 3A25A 3ZE6A 1SKYB 1U7HA 5KVVA 3G8BA 1CUBA 1SOUA 1I5EA 1T3GA 2AWNA 3GW8A 3TSCA 1RQ2A 2FDXA 3A6GA 1G7SA 4HYEA 5CAEB 3MAJA 1DFHA 4B3XA 2VQSA 1OBOA 3FFWA 4BN0A 1MNAA 4JJZA 5CYGA 2QUBA 2ZWAA 1SCDA 1T1JA 1VP3A 2ZJ7A 4Q4AB 3EEQA 1N9GB 2VSOA 2Q50A 2VCYA 4S1PA 2OORA 3W5CA 3ISVA 2Q28A 2XT9A 1Y5RA 2WR8A 2UZ3A 3H9CA 4LBWA 3UMGA 2XE6A 2WVHA 2FPXA 4GKKB 4QTYA 4DJJA 2QTNA 2XDQA 3E5RA 3H3XA 3QKSA 4L6CA 1YL5A 2KE5A 1JVSA 4WFKA 1P9WA 3P9PA 3LP8A 2H18A 2PS1A 4UCXA 4YJ2F 4LJ7A 4YQZA 3L4KA 4Y9RA 3QYAA 1U2GC 2NZWA 1DIRA 5JSFA 2W2MA 4UTZA 1DRJA 3O4GA 2C2XA 4R8MA 3FB4A 4X7MA 1YA6A 1JH9A 4C7OA 1C1HA 3LP6A 3RSOA 3TIFA 4DANA 1P3DA 4JP2A 2AQIA 4HWGA 1M66A 4GX0A 4OM7A 5EJ2A 1W4LA 4AJ1A 5HCUA 4GC9A 3ZC3A 2X3FA 2VXBA 3WKDA 3DVAB 2QXTA 1GQOA 1Q7RA 3ZH9B 4DC9A 4JBLA 1NQOA 3II6X 3DWGA 1XMJA 4RMIA 3RFXA 1TCAA 5I7RA 3S2IA 1LC0A 3AEQA 3BFXA 5HHTA 2ZQ5A 5IVKA 1XR3A 1M8KA 1SBNE 5CMLA 4EPVA 1XU9A 5GMOA 3HWWA 5BWBA 1QJCA 1FYFA 4IKOA 3T54A 4ZVTA 1UM9B 1CQIB 2VHXA 2YICA 1C3EA 3LDAA 4HEQA 1WZNA 1WMFA 4L75A 2G0AA 3I9MA 4JEUA 1PSDA 2DQKA 1XBTA 3GAFA 4LZLA 2VZEA 4NDZA 2NZ8A 2Z95A 2R97A 3AJRA 1DXYA 4TYMA 1N3IA 4P32A 1IQ0A 2JBWA 3DHEA 1GG9A 3CF2A 3EXHA 3RVSA 1Z75A 2A4KA 3C3JA 4G5FA 1IYZA 2HRCA 2HYDA 2O2XA 2WKRA 2H1FA 1F60A 3PXDA 4DPKA 3EZNA 1KPHA 3R7FA 3VZPA 5IDVA 4H7EA 5FUYA 1O0BA 1IWBB 1E0DA 3HYRA 3EEOA 2BI4A 2WSSA 3A28A 3GEPA 1E2EA 4ESOA 2FDCA 1G98A 1KH3A 1FP1D 2XB4A 1I4LD 2Y93A 2B78A 2HLHA 1S2MA 2DQZA 5F52A 5LD2B 4UPVA 3P1JA 3HCRA 4K1XA 3UJ9A 4BFUA 2FPGB 2MSNA 1EP2B 1Y8ZA 4KNYA 1P2DA 2EX0A 1NBOA 4MDYA 3C4QA 3N07A 4LJYA 1NXPA 3LC2O 5A4KA 4GRDA 3QY9A 3VMFA 1FNNA 1L4NA 2IQ5A 1TJPB 2XDQB 3QKSB 3RHSA 3E1KA 1E2FA 2WTNA 4LDQA 3SF0A 2CEAA 1FDVA 1PLKA 1MRNA 1OYWA 1ZLXA 3DM5A 4M8IA 1BCSA 2W83A 3VFDA 1XKXA 1XVLA 2OHXA 3Q87B 1EDBA 3IIMA 3L7LA 1G9SA 1KS9A 4FFNA 4DKJA 2PCLA 3DWIA 5THQA 4L7QA 2EBWA 1JJIA 3URKA 3IKTA 1ACMA 3LOPA 1TOAA 3WL8A 3PSHA 5CEEA 1L9XA 3OLQA 5IP5A 3CGWA 4U1RA 4E6PA 4DUZB 2F9FA 4E4RA 4N3NA 1Z7YA 1Q7GA 2R8RA 1DOZA 1Q50A 3F7TA 3DL7A 3LIPA 1XHFA 4NDNE 4PIPA 3AF1A 4RSRA 4E5MA 1DXOA 1ZXLA 1NLUA 3ZR4B 4ENWA 3AP3A 4DCTA 1DV1A 5L6LB 1GADO 1NVGA 4LZNA 4U0KA 3GVPA 4H35A 4F8YA 3TECE 3ANSA 4LC1A 5AI4A 1K2WA 1Q21A 3K3PA 4TROA 5CFPA 4Q47A 1CDDA 4YRBA 4LHVA 4HL6A 1W46A 2H11A 3PQEA 1TM2A 1IY0A 5U4QA 4DV4B 1L3CA 3EVAA 2FWNA 1ZA1A 3AEQB 3TZBA 5M29A 5KINB 5J1SB 1N5IA 1XVIA 2JI7A 1T0PA 2J3JA 1ZU4A 3HHPA 1NM5C 3GLKA 2P9YA 3MTAA 4LNHA 3UEOA 3AUUA 3OQ1A 4OIMA 3NG1A 2XOKD 2IC5A 2WE7A 3RRZA 1XCPA 1T15A 2JEOA 4DJFC 1CK4A 3W3AD 4WN3A 1BH2A 4CTNA 4K87A 1T9KA 3TSYA 2Z5LA 4BGEA 3EXHB 3PDIB 2WIBA 3ZWCA 1EFKA 2VNAA 4QDTA 3A4NA 4ETMA 3GRFA 3LQFA 5JJBA 3AVTA 5ALVA 2GEUA 2IEYA 2PMDA 3RS9A 3IXQA 2LCQA 3ZJ4A 5FPPA 5JCXA 4XB2A 4AS1A 4G86A 1SB8A 1JEOA 2AE2A 3GAMA 4K9MA 3EY4A 1T13A 2RGNC 4JROA 4L9RA 4WBSA 3WIEA 2HTEA 3WQQA 1O95D 3PUYA 3H7AA 4XLLA 1QKIA 2FHSA 4U7PB 4EBFA 3IJRA 1RXWA 3NCHA 4Z3DA 1Q44A 3RIXA 3HVJA 1TIKA 1R12A 4NDAA 4RLFA 3C8ZA 3IAS1 1MO2A 5HFNA 2QU8A 1Z5WA 4U00A 2XUQA 3TOCA 1B00A 3WAJA 1WQ1R 5EC8A 1U0SY 3DZCA 1AGXA 1HE8B 1A5BB 2A3NA 2PV0A 1U6KA 3OIWA 3ZOKA 4M99A 4UAUA 4QJBA 3C3YA 5C9ZA 1CZNA 1S6YA 4ZMBA 3ITEA 3GLTA 1Q3KA 2QUKA 2H5EA 3FOEC 2AS0A 1BCSB 1YB5A 1HG0A 1YE5A 3OJXA 4HPJB 1KHTA 5LZ7A 2AZ4A 1I6KA 2X41A 5LZ9A 1YFKA 1MAAA 1NUAA 2V9CA 4NJOA 4BKMA 3NOOA 3D4NA 4BB6A 1WQ3A 2GYVA 4J1TC 4U2CA 4UNIA 2XCLA 1B0ZA 3E84A 5JWOA 2RGGA 2ACVA 1P1IA 3PC6A 1J8YF 1FFEA 2VF5X 4ZEWA 4G5SA 3RWBA 4ENRA 4R2XA 4U7WA 1BX3A 3QNUA 1NUQA 2ECOA 2NZ2A 5BNIA 1ZBQA 5IX8A 2I3GA 1RPNA 5EHIA 3VJLA 5ALFA 4DBZA 3R5JA 4LIPD 3QU2A 1F3LA 1WZIA 1JKXA 1UXGA 1ZVMA 4TS4A 2Y0CA 1DBVO 3IAM1 4RJKA 1QP8A 4G1EB 1C8LA 4V3CA 5J4HA 4PX9A 3MLBA 1XELA 2NOAA 3ZWBA 2XCQA 4ZCQA 4YUWA 1IY2A 4O5OA 4RHUA 1WW2A 1AU9A 3KAPA 1XTQA 4BLWA 1EK0A 3IYLW 3F5FA 4QTUB 4DYDA 3CSSA 1WR8A 1T2UA 4MUHA 3WQRA 5E4FA 1HV8A 4QGHA 4R01A 3HA7A 2FPMA 2EKBA 2YTZA 4ZDWA 5B1YA 1RPZA 1Y1SA 4F3TA 3CX6A 1DQNA 4QBGB 1KF0A 2YJTD 3FMIA 5FORA 5HE8A 4S2UA 4PS1A 3NTUA 5KSWB 2GPWA 5FPQA 3ER9A 4E5PA 4DY6A 2I1VB 1ZUWA 3F47A 2HU8A 4DOMA 3N2NA 4UVHA 4H27A 5AXDA 4CM6A 4Y9UA 3KOMA 2P68A 3PE4A 3UFXA 3LHKA 1V3UA 2OWEA 1QLWA 1RJDA 3GDWA 1JSRA 3KPYA 4JA2A 4LGYA 1SWVA 4KN5A 4MYDA 1HLPA 3K8ZA 2R8XA 4Q1AA 2VYND 3MTGA 3HI4A 4KLZA 3DAOA 3MIIA 4OUKX 5F33A 3T9EA 1FTWA 4KRGA 1ZW1A 2QAIA