2FK8A

Crystal structure of hma (mmaa4) from mycobacterium tuberculosis complexed with s-adenosylmethionine
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
281
structure length
281
Chain Sequence
b'IQAHYDVSDDFFALFQDPTRTYSCAYFEPPELTLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKNQHARCEQVLASIDTNRSRQVLLQGWEDFAEPVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRMTVQSSVSYHPYEMAARGKKLSFETARFIKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHYFTDEMLDCSLVTYLKPGAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methoxy mycolic acid synthase 4
publication title Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 103
structure length 281
sequence length 281
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2fk8A00
2A14A 3LDUA 3AXTA 3GIWA 3NJRA 3G5TA 3LHDA 4ER0A 1R74A 5EEHA 2QY6A 3EVZA 3MB5A 4LWOA 3NVKI 3LGAA 5HIKA 2LD4A 1NV9A 1JQEA 2QE6A 2PX8A 2XVMA 1Z3CA 5EHGA 5KS2A 5T64A 5LQRA 2P8JA 4LWPA 5DRYA 3GXOA 2GA9A 3KPYA 3UJ6A 5DM2A 3Q7EA 3CJTA 1BHJA 4M36A 3JWHA 5DXJA 1TW3A 1SKMA 2ZSUA 3P8ZA 3G2MA 2V74B 3B3FA 4R8SA 4RTKA 1M0EA 1X1AA 1QYRA 4K6MA 4QTUB 1N7IA 1JQDA 2YR0A 2JHAA 3E23A 3BGDA 3RODA 5LQKA 3CGGA 4P7KA 4FR0A 3T7SA 5CVVA 1VL5A 5FA5A 2EX4A 3TQSA 3ELWA 4DZRA 5K0LA 3MHTA 3GNLA 4MHTA 4X61A 3FPFA 3K0BA 3P2IA 3I53A 3HM2A 3CKKA 1L9KA 1WY7A 3M6XA 4EK9A 4HTFB 4POOA 2ZVJA 3P9CA 1T43A 3FPEA 4X1OA 4NECA 2YUIA 3OZSA 3LBYA 1RJFA 2ZLBA 1MHTA 3BKXA 3A26A 1SUSA 5DTQA 1EQAA 5DM0A 2OKCA 5T67A 3PX3A 2B25A 2VS1A 3B3GA 3C6KA 1G8AA 2ZWAA 5HZMA 1VP9A 4ISCA 4PYIA 3OE4A 2AZTA 3GDHA 3SXJA 3EEYA 4OBXA 3TM5A 3LDFA 5DPMA 5EZSA 3SMQA 3IYLW 3V8VA 4C03A 2AN5A 4C06A 1N2XA 3LPMA 3JWJA 4MIKA 2HNKA 3FTCA 3O7WA 4AZVA 4RTLA 2ZZMA 1D2HA 1G60A 5C0OE 4DA4A 2P41A 3SR4A 3K6RA 3U81A 3JWIA 1H1DA 2P3QA 3AXSA 2YTZA 3FZGA 3HA7A 4CTKA 3HCDA 2IGTA 2FRXA 3M6UA 1NW7A 2NXNA 1B42A 1VBFA 2FYTA 3I5UA 5FQOA 2JHPA 2UYHA 3P2EA 4FGZA 4HG2A 3GCZA 3OU6A 1NBHA 1RI3A 1ZGAA 5K0JA 8MHTA 5DSTA 3FUUA 3KR0A 3UFBA 4RTPA 3AWIA 1YFLA 2O05A 5CCXA 5CCBA 1R8XA 3KQWA 2PVCA 1R8YA 1SQGA 2AOUA 4KWCA 1RJEA 1RI2A 3EVAA 4GC9A 2ZZNA 2G8NA 3C0KA 3LKDA 4KW7A 4Z2YA 5EG5A 5BW5A 2AOXA 5LQUA 2XYVA 2HR1A 4OX9Y 2CL5A 2AOWA 2YX1A 1QANA 1XCJA 3JWGA 3AY0A 2FCAA 4LECA 4RX1A 5DX1A 3TFWA 3GU3A 4PIMA 3KR2A 3EGVA 4RTJA 5EHIA 2O57A 1INLA 5E8RA 5DX8A 4FP9A 5EMLA 5H02A 5E9WA 1SG9A 3DOUA 4GOND 2BH2A 1HMYA 1M6YA 3UBTA 3D2LA 3HEMA 1ZQ9A 3EVFA 4Y2HA 3B5IA 4MQ4A 1NE2A 1UWVA 5CVJA 3WSTA 5JR3A 3C6MA 3FRIA 4PYLA 4IWNA 1NW8A 3HNRA 3CJRA 4DF3A 1D2GA 3FPJA 1ZKDA 3G8AA 2EJTA 3NWBA 4HGZA 4PIPA 2ZTHA 3GRVA 4XUCA 4XUEA 5E1DA 3GRZA 5K0FA 3V97A 4AZSA 1UFKA 2YXLA 4MWZA 5E9QA 2O07A 3MTEA 4O29A 4R8RA 1Q0TA 1EJ6A 4PYOA 1QZZA 2ZIEA 3HA5A 4OQEA 4GOLD 4MTLA 3DUWA 2H00A 4E2ZA 2O06A 3TRKA 2F8LA 3EGIA 5E1MA 5G02A 3P9IA 5ICFA 2C7PA 5BXYA 2H11A 3TOSA 1O9GA 1P91A 3R0QA 5EQJB 1ZHFA 3SSOA 4PGHA 1YUBA 4KDRA 5EZQA 4R6XA 2ADMA 1XCLA 5DTRA 1FP1D 1BKYA 3I9FA 2EFJA 3DMHA 1L3BA 3PS9A 4EKGA 1X19A 1VP3A 3LCCA 4ER6A 3LKZA 3A4TA 4PCLA 4QVKA 2AOTA 5DM1A 9MHTA 4X41A 3BZBA 2YXEA 5EPEA 5HILA 2PT9A 1KYWA 1VE3A 2CWWA 3A7DA 5GP1A 4ATNA 4DMGA 1YFJA 2UZ4A 5K05A 1PJZA 2JG3A 1M6EX 2NXCA 4YV0A 3S68A 4QVGA 2Z6AA 3NVMB 1JQ3A 3DR5A 3B89A 4EQZA 3BXOA 2C7QA 3PFGA 2HMYB 3A7EA 4PONA 3GRRA 1KIAA 3QOXA 1G55A 2H1RA 7MHTA 5FTWA 2WA1A 2AVDA 1VLMA 2ZULA 2QRVA 1KPGA 3DP7A 5HIJA 2NP7A 5EKXA 5CD1A 4YMHA 3KKZA 3M4XA 2DPMA 4GC5A 1YZHA 3RW9A 3TKAA 3KPJA 3OCJA 4RVFA 1NKVA 5E2AA 4UOEA 2ZCJA 4BLWA 3KHKA 1QAOA 4PWYA 3LECA 5FA8A 1JSZA 2PLWA 2P40A 2CMHA 10MHA 5HIMA 5K0EA 2YVLA 3HP7A 5EKUA 3PB3A 4DCMA 3CC8A 3UJ7A 5LR6A 1X1BA 4E70A 3BKWA 4L7VA 5D1NA 3ERCA 3P2KA 1O9HA 3VSEA 3KQOA 1EJ0A 3HCAA 5K01A 3HA3A 4HH4A 4BP1A 3CVOA 3KR9A 1IM8A 1EAMA 3G8BA 2PX5A 4C05A 2OZVA 3IEIA 1XJ5A 5U4XA 2XBMA 2IP2A 5BW4A 1G6Q1 3KQPA 3OU2A 5EIWA 4GOMD 3O31A 5K0NA 1NW5A 5F2NA 3HCEA 4EVIA 4BY9E 3CJQA 2JJQA 4ZTBA 4C4AA 1NW6A 3LL7A 5T6BA 3MTIA 4FT4A 3MCZA 2K4MA 3DXZA 1I4WA 5HOQA 5LQJA 2I7CA 3DMGA 5DXAA 1YF3A 5CM2Z 4P7FA 1JG1A 5GM2A 4AZWA 3KU1A 4E31A 5LQCA 4WVLA 2R6ZA 3EGEA 3G5LA 4QPNA 5EEGA 4RTRA 1KP9A 2NXJA 2Q41A 3UJDA 4AZTA 5EMJA 1X1DA 4M7RA 4M37A 4M38A 5K0GA 5DTMA 3KQYA 3HVJA 4GBED 3LX6A 4HRAA 2YQZA 2GB4A 1BC5A 3QOWA 4QQNA 4V0QA 2ZW9A 5FUBA 4E32A 1FP2A 5GM1A 4F85A 2JH8A 4HSGA 4QTTB 2OYRA 2I6GA 3NW9A 2B9EA 2CKDA 5DWQA 3UA4A 3EMBA 5K8VA 4C07A 1BOOA 3E7PA 3HCCA 4BLVA 1XDUA 3DXYA 3TMAA 4QDJA 3KPUA 2NXEA 1Y8CA 4YV1A 3FPHA 2N47A 1QAMA 2JH9A 3BWCA 2E5WA 4RV9A 2AN4A 1NBIA 4H0NA 5HIIA 4C08A 4CKBA 2PKWA 5KQSA 3GGDA 3P97A 4E2YA 1SVUA 4KDCA 3DMFA 2OB2A 3E8SA 3NDJA 1RI4A 3EVBA 3BWBA 4CXMA 3DH0A 1O54A 2ZBRA 4CKCA 2ZFUA 4E33A 2UYOA 4KRGA 3VC2A 1AQJA 5E8JA 3SX0A 1JG4A 3EVEA 2OO3A 5D1HA 4DQ0A 3KPVA 3LCVB 3THSA 3HVIA 5K0CA 1G38A 3EVGA 3M70A 3A25A 5EGSA 4RTNA 3EEOA 3HVKA 1RI5A 5ICEA 5MHTA 5C1IA 2B2CA 5DT2A 4CTJA 3OFKA 3FUTA 2AR0A 5BP7A 3M6WA 3Q87B 3NWEA 3UA3A 5FULA 2OB1A 5KQRA 4U7TB 3SVZA 2IBTA 5P8WA 2OXTA 3O4FA 5EVJA 3ELUA 3MQ2A 1RJGA 5B1SA 2IDKA 4GUAA 5FQNA 4YV2A 2KW5A 3FUXA 3FUVA 4RWZA 4P7GA 2C7OA 4GF5A 1NV8A 1P39A 1G8SA 2PGXA 4WXHA 3UJCA 1PRYA 1L3IA 2AOVA 2BZGA 4RVHA 5DLYA 2BM9A 1R00A 5JUWA 1EIZA 4DKJA 2P3OA 1JTFA 1JG3A 1F38A 3HCFA 4HC4A 5ICCA 2BM8A 2G71A 1SQFA 1YB2A 4GEKA 3CBGA 5LQNA 3ER9A 4GOOD 4Y30A 4DCGA 3G89A 3R9XB 2QYOA 3SSNA 4CKEA 1TPYA 1L1EA 2GPYA 4RSRA 3BT7A 3PLAE 2G72A 2IFTA 3KPWA 2ORED 3GWZA 1XDZA 2P3LA 1EG2A 4XCXA 5DRTA 4PYJA 1P1BA 2IH2A 2P7IA 4U7PB 2R3SA 1FBNA 4JXJA 2O0LA 4F86A 2OPBA 2ONYA 5GIOE 4KIGA 4AX8A 5IKMA 1KXZA 4OQDA 3LBFA 3KQTA 4LG1A 2G1PA 3M6VA 3PVCA 3MERA 3FPGA 5CIYA 1UIRA 1TW2A 3TLJA 4F84A 2PJDA 2EG5A 3LDGA 3AJDA 3GRUA 2PXAA 2UYQA 2VDVE 4ER5A 4FSDA 1DCTA 1AQIA 3R24A 1F3LA 4PYNA 4FT2A 3GJYA 4IV8A 3HVHA 4E30A 3EVDA 5EMMA 3RIEA 3TPZA 3ER8A 5CVDA 2AN3A 3ORHA 2NNWB 2I9KA 3F4KA 3KQQA 3X0DA 5F2OA 1XXLA 1VPTA 2IH4A 3BGIA 2XVAA 2ZBPA 3FYDA 4ER3A 2YXDA 4KIFA 5HFJA 4RVDA 4IKPA 4RVGA 1KHHA 1ORIA 2PX2A 2HTEA 5GWXA 1SUIA 4X60A 5F2KA 4E2WA 5ICGA 4E2XA 3PTAA 1R18A 2ZIGA 4RTMA 2GH1A 3G2PA 1XTPA 3G7UA 1Q0SA 2IIPA 2AOUB 4OA8A 3SSMA 3T7TA 4X63A 3UJ8A 1HNNA 4YUYA 1KPIA 5KYGA 3OFJA 2ERCA 3DTNA 5LSAA 1IXKA 4PYKA 1AV6A 5GOZA 1L3CA 3DLCA 3NDIA 2UYCA 3UWPA 3FTFA 3B7PA 3CCFA 4FSXA 4OA5A 1WXXA 3UJBA 1V39A 1JTEA 2AS0A 2DULA 3BWMA 4BLUA 2BR3A 2XYQA 3LSTA 5FWAA 1FJXA 2NP6A 4P7JA 4PINA 4A6EA 5CVEA 2QM3A 2V7EA 1JG2A 5C9ZA 1ORHA 3PFHA 3R6TA 1WXWA 2ONZA 3L8DA 2WK1A 3ID6C 2CMGA 1WZNA 3P9NA 3TR6A 4YUXA 3NMUF 4R6WA 3SGLA 1YZ3A 2BR4A 4HGYA 4C04A 3OE5A 3OU7A 1N7JA 2B78A 4EMSA 2FPOA 4RTQA 1RI1A 2OY0A 3EPPA 1AF7A 3I58A 3KR1A 3T0IA 5GIPE 3G2OA 3I64A 1NW3A 3C3YA 5DSXA 5KVAA 1KYZA 2GLUA 2FK7A 5HEKA 3UZUA 2JHCA 2NYUA 3PX2A 5DX0A 2IH5A 2PSSA 2HV9A 2B3TA 1OR8A 1XVAA 2IBSA 2G70A 3B3JA 4RTSA 1P1CA 2XYRA 4HTFA 5E9JA 1KPHA 1RJDA 2C7RA 2VP3A 5LQAA 1WS6A 3HCBA 4AUKA 5E1OA 1IY9A 5FHQA 5DM4A 3REOA 3BUSA 1X1CA 4EKIA 2GAFA 4PCAA 5K09A 5E2BA 3PT9A 2VDUE 3EVCA 4CWAA 2IPXA 2AVNA 2IDJA 3NTVA 3BGVA 4G56A 1JSXA 1ZGJA 5FADA 4B17A 3VYWA 2I62A 2PT6A 2ZBQA 2ZZKA 4QDKA 5K03A 2AOTB 5E1BA 2PWYA 2PWPA 3A27A 3TKYA 4YMGA 5FWDA 1D2CA 3P9KA 4RTOA 1DUSA 5M5BA 1U2ZA 3LCUA 2FHPA 2Y1XA 1KR5A 2PXCA 3G2QA 3BWYA 1NT2A 2P7HA 4V0RA 3THRA 3ANXA 2P35A 2PXXA 3IV6A 4YUZA 3FTEA 2HWKA 3GO4A 1WG8A 3G88A 3GRYA 4KVZA 1VIDA 2VDWA 3FUWA 5CUQA 5EC8A 4ER7A 2PV0A 2Z6QA 1DL5A 4DM3A 3MAGA 3TM4A 3OZTA 3OPNA 3KQSA 2Y1WA 3OZRA 1I9GA 5K0BA 2BR5A 2QRVB 4PNEA 2PX4A 3C3PA 3E05A 4YUWA 3IHTA 5GINE 3T7RA 2EJUA 4P58A 3DXXA 4YUVA 5CVUA 5IH3A 2VZ9A 1FPQA 3KQVA 4OBWA 3QV2A 2FK8A 2GS9A 3M33A 3R3HA 1ZG3A 4PYQA 1JR4A 5EIFA 3SM3A 1XDSA 5FHRA 3FYCA 2ESRA 4FS8A 4A6DA 3MGGA 2ZIFA 1R6AA 3P71T 5EMKA 4BP3A 3HTXA 1I1NA 4R05A 4QQKA 3DULA 4RYLA 3ELDA 1QAQA 3ELYA 5EOVA 2PBFA 3FTDA 4PYMA 3VC1A 2ZWVA 4QPPA 2OBFA 2WA2A 3H2BA 3ME5A 4FZVA 3UJAA 2PY6A 4GQBA 2P1DA 4IV0A 4XUDA 5ERGB 3UJ9A 1VQ1A 3DLIA 3MCTA 5FCDA 3KQMA 3FRHA 4PGGA 2Z6UA 3EMDA 1MJFA
chains in the Genus database with same CATH superfamily
3Q3EA 2XBUA 1OA0A 2Q3CA 4E5KA 1TJPB 3U56A 2JIZA 3MB5A 2AXQA 2UVPB 3RYIB 3K1AB 1KFBB 3QVSA 3USES 5HIKA 1CZKA 5IZCC 5E7JA 2KX7A 9ABPA 1G59A 4BFSA 2P8JA 4I8IA 4C88A 3BRWA 1FDWA 3T95A 5AYVA 3EQZA 1G2IA 3UJ6A 2QMUA 3HY6A 4CGYA 4TQ9A 5U9CA 4RK6A 4IHJF 4TWZA 1XQVA 2B99A 3AILA 3QF4B 4DAOA 1KU0A 3KTOA 4IDFA 4U2FA 1UBFA 3H4TA 3GQBA 1YR2A 1JDBB 2Q4DA 4TKVA 2ALJA 5FKJA 4TOIA 3EXEA 2TECE 3T41A 4QJ4A 4AC9A 1E2BA 3UG7A 4D0GA 3CQ9A 4H6VA 3LDAA 1E2UA 1PGJA 1RAIA 2XZLA 1E5DA 3I2YX 4DDVA 4EK9A 1EFUA 4E07A 1G63A 5ILOA 1C8BA 3P9CA 3UPTA 2J3QA 1T43A 1BHO1 2OHXA 4BEBA 3JAKB 1Y1SA 121PA 3PE3A 4LXYA 2I6QA 4D92A 4A0SA 4RETA 1RJFA 1ECCA 1VBNA 4KFSA 4F5EA 5B6JA 1PCXA 2ZLBA 1FPMA 2WVJA 3K7EA 3PEFA 3PRJA 2ROQA 1W36B 1Z8HA 3Q6NA 5H3HA 4KACA 1NY6A 1T0BA 1U1EA 3OQPA 2VNKA 2A35A 3AH8A 4KG7A 4KN6A 4KQIA 4ARZB 1VP9A 5A6VA 3JQGB 2QD4A 5JCZA 1XN1A 4L15A 5CT4A 4EKEA 5CH5A 2CMDA 2H2DA 1I0LA 4KP7A 3VHQA 2ZZMA 3QEAZ 5F35A 5CFPA 1ISFA 3IIIA 2F59A 1WW8A 4WFQA 5FDFA 3IP3A 3SR4A 5LNK1 1W4CA 2P3QA 2ZTSA 3HA7A 5TGDA 5EFZA 2NTVA 3KJIA 3CLRC 1IATA 4JQSA 3W8EA 3DEZA 1IY1A 4NFYA 4R9SA 3ANYB 3T3PB 3BK1A 3ADDA 3HJBA 4WX2B 3UT0A 5AOBA 2FYTA 1AC5A 1U0SY 3BIFA 1TKRA 2W48A 4YCAA 1RJWA 1MNQA 5EPOA 1FX0A 4DBLE 3GCZA 3Q3HA 3EC7A 4RKEA 3WRYA 6ABPA 1EFAA 1V1MB 2H18A 3GPIA 5AKZA 2ZPTX 2JLUA 2ZUFA 4Y0AA 1GGFA 1RQGA 3TSOA 3NV9A 2G9VA 3VTFA 2GJAA 3TFOA 1MG5A 2WF6A 4NJOA 1C0PA 2FEPA 4NSNA 1J4AA 4URYR 2EEPA 2J5XA 2VTEA 4CU5A 4NBSA 4IDPA 1GFSA 3QOYA 4PBSA 2B35A 4TS1A 2IKSA 1BG6A 3QG1A 1DCFA 1CZOA 4IFEA 3KCQA 4YB8A 3WMGA 2YDYA 3B6MA 3H4IA 4JR1A 4D81A 1KAMA 2BAGA 4C4TA 4Q4HA 1Z6GA 2D13A 2H29A 4FN4A 2V6FA 4N5DA 2ZJBA 3SQMA 4EOGA 4HWPA 2VCHA 3VR4H 1E6CA 3PHBE 4YWHA 2A8YA 3EZYA 1NAIA 1L4GA 1R6XA 3FSGD 5H59A 1N3YA 2R9VA 1R4NA 4P4SA 2ZM5A 1YUMA 4W82A 1PQPA 2ZIXA 3OURA 5EQTA 2PNJA 5IT4A 4KO4S 3CPSA 2EJTA 3NWBA 4LYAA 4PIPA 2HMVA 3KKLA 4I4TF 3Q8MA 1CUBA 1IVNA 3F5QA 3H0CA 4TQUS 5JPDA 5ALQA 3MM4A 1U1DA 3ESRA 5DASA 2PWZA 2XCRB 1W47A 1ZJYA 3BFXA 3C3DA 2DLDA 5ECYA 5EN4A 4LWZA 4Z4EA 1R0XA 1YVUA 1RM0A 2B7BA 1SA0A 2ZJ2A 3HY4A 1ULSA 4RF3A 1IVYA 3ZXXA 5DN6D 2P2NA 3U3MA 2W6ZA 3P9IA 1DBPA 2JHGA 4JJZA 1TF7A 3V8NA 2D1YA 1RP1A 2PLAA 3B85A 3OQHA 4LBWA 4D3ZA 5E6UA 2ZVQX 1UL1X 5EQJB 3LLCA 3LHKA 4MS4B 1TKAA 1FQKA 3KSBC 4EI8A 2I8AA 1ZC4A 4FDUA 3RU2A 2ARKA 3PR1A 2VH2A 3QLJA 1L3BA 2FJPA 1L5SA 3B20A 4IUDS 4RQTA 3OLQA 1G291 2VF2A 4KTVE 1BD3A 2QIPA 2BEVB 1GQYA 3BQ9A 5ESXA 5AW5A 4ID9A 4QXMA 3BF7A 4D4KA 3LBAA 4JCCA 3FFAA 3RB8A 2B34A 1TDJA 4HLUC 4K6GA 1NWHA 2PWBA 3DE6X 3OJXA 4ZRDA 1WQ4A 1I32A 3HV0A 2HHAA 1DE0A 4ND4A 1OFUX 3SJUA 4MQUA 1R0RE 2HBYA 3WISA 2WPDD 3IAAA 2NU9B 3GFSA 1YOVA 1FFBA 1FDVA 4JMLA 2DB3A 2CY0A 3SC3A 1KWGA 4I0WB 5FTWA 3I9KA 2O2SA 2VPIA 3DR3A 1QORA 1USVA 1CF2O 3B78A 3KB6A 5CEJA 4U0KA 2WTBA 2QT9A 2GHIA 1Y5LA 2JFGA 3O0DA 5JCJD 5B12A 5C1PA 1P19A 1RAEA 1AXEA 1NXWA 2J0UB 4B3HA 2BMDA 1FTQA 4NZMA 1QAOA 1E7MA 1CC1S 1TADA 2J1LA 1V9SA 5ABPA 1KWKA 2PLWA 3DOFA 3H8SA 1VJ0A 4DBLC 5A9SA 3TLMA 5EKUA 3S7ZA 4UXHA 3EX7C 3MINA 4UARA 3L3BA 4MQFA 3UJ7A 2QQ0A 2WP0A 4NE9A 2NU8A 2SKCA 4LJ7A 4CM8A 1QIFA 1CY0A 1V6AA 4DLLA 4F96A 4Q3BA 2GPNA 2ZRFA 2BTQB 2O3JA 1WF6A 3BCUA 4P83A 3UB4A 3V8EA 3ZY2A 4DSUA 1UFOA 3UATA 2ZDGA 5JECA 4Q7MB 1N3BA 4X1IB 1LPNA 4DJDC 4U6QA 3BH7A 1J2JA 2VAVA 2VUTA 3K30A 3KXPA 2QX9A 3EXIB 5FOVA 4Q1VA 5CD9A 5HRAA 4LF9B 4RM2A 5A2GA 3ZY4A 4Z4GA 2C9OA 1RD4A 2PZFA 1YL5A 3SIXA 4BRSA 2GVNA 1YZNA 5EMHA 3I04M 1A7KA 3W90A 1A5AB 3IPXA 2HL6A 3V5NA 2VDWB 4BIIA 1HNWB 2IC5A 2LW7A 4P7FA 1K6IA 2I3DA 3ISJA 4U2DA 4AZWA 2BFFB 2Q9AA 5JAUA 2HHCA 5EEGA 1B74A 2X76A 4JH0A 5M29A 5IBPA 1DKMA 4MX8A 2G40A 4QOFA 3N8NA 3UUWA 3N70A 4HWOA 2GPWA 2ZW9A 2XCOA 2IZ5A 2J41A 3RT9A 2Y0EA 5J4HA 2ATEA 3JQAD 3VA7A 1GLGA 1II8B 3DONA 4IJWA 3QIVA 2PFGA 3EMBA 2PSEA 3HVUA 4FEGA 3AYZB 2BM0A 5TPWB 2B36A 3E7PA 3UW3A 4UUQA 2AW3A 4CLOA 2V9ZA 2VI5A 3DXYA 1IHDA 3MS4A 1U0HC 3RJ5A 3FVRA 4ZYYA 3RNLA 3BWCA 2E5WA 4IQFA 1RRVA 3O4VA 1NBIA 1GVNB 4CKBA 2BUAA 4PU0A 1YTUA 2II6A 4IDAA 2SCUB 1P74A 4DLVA 4CBVA 3BWBA 4HB4A 1IJFA 1YS9A 1O54A 2BP7B 2PEYA 3OJOA 1ONNA 2YWBA 4QUAA 5AKIA 1XN4A 1XZIA 2VDKB 5F5XA 1UDXA 5HCNA 3M3PA 1RWMA 3H9QA 1I5EA 2P6PA 4KRYA 2HGZA 4CCYA 1Q7TA 3U6KA 4NAVA 5D1HA 4EVQA 2ODNA 3L1HA 1O7JA 3QA9A 4YH1A 2Q4TA 4IZOA 4LDNA 2HF2A 5A71A 1DJOA 1K7YA 4NYJR 4QFMA 2QSUA 5U1PA 3X1YA 1GIAA 4N82A 3U60B 4ND8A 4KPYA 2DYKA 4GGMX 3IHWA 1OIWA 4ZV7A 1F12A 1PT6A 1SZCA 3GOQA 1FDUA 3P19A 3PVSA 1TM3E 3EEFA 4WLNA 2JLSA 4BTVA 3N76A 1L7DA 2AFHB 1YDWA 1U11A 2C82A 1Y3AA 2KW5A 2QY9A 3NBFA 1BDMA 2ZEJA 4FLEA 4ZO4A 5JVDA 2C1EA 2Q3JA 2E82A 2LXNA 4JODA 3L43A 1HV8A 3D0OA 2RKOA 4RLQA 1FW8A 4B7XA 2OHHA 1RWVA 3MLEA 4RVOA 1C8LA 1U8FO 3HCFA 4NEHB 2O8DA 1AA9A 1M3SA 1A9XB 1RRPA 2IEDA 5UKDA 1HWYA 3PTZA 4PZYA 3BT7A 2XKAA 4DWJA 2IH2A 1XDZA 1Z9BA 2X8BA 4DR7B 2VPQA 4GYYA 3OQMA 2R79A 4OFZA 2J3HA 4IIJB 4PLWA 5BNFA 4AX8A 5IKMA 4MV1A 2XB4A 3LBFA 1IWOA 3M6VA 4IEFB 3QKWA 3V7YA 3JXEA 1KMHB 1ZN7A 4QT0A 3TNFA 5FYQA 2EOAA 4QQ8A 1RABA 3OBBA 3KKQA 4DCCA 2GCNA 3F5SA 5H9WA 1FUUA 2BF4A 3HCPA 2F3TA 3ZDYB 4ER5A 5DHUA 1AQIA 3KSUA 4N5IX 4QUEA 1P3JA 3I0ZA 5TQ0A 2AH5A 4BJ5A 1BA3A 2Q9BA 2X9NA 5IANA 1BCSB 1ZUNB 1QVVA 3GC6A 1JRLA 3G2KA 4XJXA 1TOAA 5HIAA 1HZJA 5CVDA 4EPTA 1GAEO 2NNWB 4J90A 2RK6A 2YYZA 5JOQA 4S1PA 5HHTA 4EG0A 5I4BA 4F2WA 1HRKA 2KSQA 4JI5B 3TLGB 1YE8A 3I6BA 4F7WA 2PGOA 1RVDA 2X40A 4KIFA 5DI9A 1NUAA 3SC6A 5BQFA 1F6BA 2ZKLA 2DR2A 4E51A 1VHJA 2NV6A 1QF9A 1ZW6A 4K0RA 3I39X 3I45A 5AI9A 2QTHA 1SBQA 1O6FA 3E0XA 3D2BA 3ICVA 1NJ8A 3RF7A 3STVA 2JL1A 2AG8A 1O96B 1GYPA 1TA9A 2GCOA 2OECA 2VPXA 1EE2A 3NHPA 1RRFA 4KWIA 2O7NA 2HX1A 2PRZA 2JLZA 5TMEA 1PWYE 4FKMA 1O1YA 2C2OA 1M7BA 2BZ1A 5J4YA 2NZ8A 3EGCA 4EY5A 5DGXA 1DUIA 1PFKA 1YACA 1XC7A 2GLXA 4F0JA 2IYVA 3SP1A 4CM3A 2JAWA 3ZV4A 1YV9A 4D0RA 1ORHA 4XWTA 4JQZA 4QJ5A 4TUYB 2ZRLA 5LIPA 3TR6A 5BY2A 4Q37A 2FLVA 2JFBA 1T29A 3G02A 1YZ3A 2UUPA 5KDDA 5FBQB 2QV0A 3PPWA 4X91A 3W77A 2E89A 4UTXA 2GBFA 2OESA 2O8DB 3FNIA 4H1TA 4K46A 1WW3A 5GIPE 3CVYA 1WUTA 2IS6A 3KSAC 4HZIA 1ST2A 4D3DA 2Z5VA 4MRSA 5DSXA 5C34B 2W8BB 4PG4A 3G0HA 2ORWA 4QPCA 4TV8F 4CCWA 3COPA 3QHPA 3HO1A 1CYEA 3CR3C 4BQPA 4EMBA 3ETJA 5CDSA 1USKA 4P2GA 3CUSA 4RGBA 4Q01A 3RUDA 1REQB 3TGPA 2QM8A 3A2MA 3QKTA 4YJGA 1PEDA 5JWOA 4RTSA 1CJVC 1Q5PA 4MYRA 5EHNA 1CE8B 4PZPA 2QTNA 1IQUA 1IY9A 1O57A 2HPVA 1CJKC 1UM9B 4MEAA 3RSLA 3HFGA 4HDMA 1BXKA 3ZNQA 3N59A 2JG3A 1Z22A 3JS5A 2GKOA 2HAEA 3T7IA 5CNKA 3H8WA 4Y2PA 5CH8A 4BGDA 5HPYB 4K05A 2BI4A 3IKTA 4ZTZB 4QARA 1PYGA 1ADJA 1W2HA 2VWQA 1BH2A 1A9OA 1QX4A 5E1BA 2QP3A 3A14A 1BVYF 2EP5A 3A27A 2CMFA 3WRVA 2W98A 1DMRA 4DGSA 2ZXUA 1EM8A 4M9ZA 4QOIA 5J2UA 3H3JA 4WDQA 4QJ3A 1O0BA 3FDZA 5DLDA 1SBNE 3AB3A 1BROA 4KK4A 5DTJA 5I01A 1ZY2A 2QN9A 3J7TA 3LUHA 3WIDA 2Y1CA 3HJFA 2FHPA 3L1VA 1Y8QA 4FBGA 3ZCPA 4H6XA 5FBWB 4ENQA 3F3KA 4I55B 2O0MA 2P35A 2XNCA 4ZJYA 1G5FA 3IJ5A 3P96A 2WF7A 3NC1C 1T2DA 1GQ2A 3LC7O 1SOVA 3DL4A 1CUYA 1MIOA 1FFDA 2VXCA 3N8IA 4BNFA 3V55A 3ISVA 3OM9A 1PV1A 1KIMA 2QL9A 4S3MA 4XGIA 4YRAA 2N0SA 3LUDA 5L7TA 4PHTA 1LUAA 3H16A 4AP9A 1TA0A 3DPUA 4M1YA 4R1UA 1QDLB 2CHFA 1NVTA 2J9RA 3A1DA 4LDAA 4NDAA 1PV4A 3LUJA 1SD2A 2AJTA 1O95C 1WP4A 4INZA 4MJLA 5AK6A 2J3LA 1U0EA 2ZQZA 1L6IA 4Q47A 2JDID 1UJ5A 1XZBA 3ZQKA 1XDSA 3QUQA 1U9IA 3OQIB 3PI7A 2ZJ0A 4RY8A 3WP1B 4B4VA 4B4OA 2XR1A 3AR7A 2G9UA 3C5EA 5DKFA 4ZT2A 5ER6A 1L4KA 1M83A 2PA3A 2QW0X 3CF6R 2CBZA 3AFHA 3ELYA 2JJ8A 3NQ41 1RQNA 1XJCA 4M0DA 1EBFA 4WMLA 4X54A 5E9AA 2Z1DA 1M75A 5EXSA 3TZLA 3VO8A 4F4UA 1E2FA 1Y42X 1R7RA 2EC5A 3AFIA 3PTLA 4RNCA 3A6ZA 3JCZA 4GE0A 3UJ9A 3VZBA 2W6QA 4JLKA 2ICAA 3RM3A 1OY1A 3WL7A 5EWJB 2OOKA 1GXSA 3L6EA 5D3KA 4UREA 4YQEA 4CHGA 2IY7A 4JI2B 2VJMB 4QOSA 4WLFA 2ZJYA 1XD8A 4QC2A 3V8PA 4EHDA 3TTUA 3QFCA 4E4RA 4UOZA 2XTJA 4F60A 2ZSBA 2IP4A 3QA3E 3SEAA 2XVMA 1W0CA 1Z3CA 3ADOA 3P0EA 3VMFA 2G36A 1MFPA 3C6XA 3M1YA 1HOTA 1OLXA 1PEAA 2QPLA 3EGDA 4JJKA 2FN4A 2PZAA 5AWFC 3I2JA 5KYUA 1KOLA 1E1DA 1GGMA 4MGHA 4F04A 4RIGA 2I7TA 1E58A 2RI0A 3D4BA 4K6MA 2QD3A 3DBOB 4PCUA 4WLEA 4ZC1A 4HUTA 3B1ZA 4HWTA 2PGLA 3WRXA 1EXDA 3FCAA 3GEBA 3T7SA 3H3XA 2XD9A 3RUCA 2EX4A 2QVZX 4A23A 4BFTA 4NTZA 5JNUA 3UMMA 3MHTA 1N5RA 2QYHA 4I99A 1IG0A 3OKAA 2E2WA 4GU5A 3HM2A 3WDSA 2E5FA 2Z8ZA 3CN7A 4PPYA 3CFYA 2FEKA 1F8FA 2C3UA 4KGZA 2W4IA 2YBEA 3B1VA 2Z1NA 1PR2A 4AJIA 4GNKA 5HNKA 3OZSA 4ZZ2A 2WSMA 1PW7A 3BKXA 4WACA 2QE7A 3VU0A 3C97A 4RMNA 2PAFA 3WBKA 3WP0A 4ENTA 2BL4A 2Z4RA 5JYCA 4CW7A 4I1OA 2O8EB 1G8AA 1NONA 2IF2A 2C5AA 1IYZA 3H13A 4P3XA 4DJ5X 3ADBA 2VDMB 1YL6A 2ACVA 1EUDA 2R7AA 4HF7A 3PJEA 2Q3HA 2IYZA 3GLUA 3QE4A 4HX2A 3RPEA 1DXQA 3R77A 4QTZA 2FWMX 2OCLA 5CNJA 4YVFA 4D4JA 3RAFC 3RLFA 3E3OA 2AB0A 4CN9A 1K1EA 5L45A 1FYDA 1K7EB 2BFNA 4NARA 5K2MA 5F98A 1C3VA 3PYMA 1M6NA 3AG6A 3F4BA 2VKQA 4NK4A 1EZ1A 1E4YA 3ON5A 4KWTA 2W6MA 4L2IA 1L9XA 4FONA 1Q91A 2W6IA 421PA 3VX4A 4C29A 2VXYA 4LE2A 4ZHSA 2BHLA 2OCKA 2NUAB 2J7PD 2OORA 1BXRA 3QE3A 4FCVA 1R8YA 1SQGA 2QRNA 4POAA 5DBGA 3H4VA 1T3HA 4ZKDA 2IEZA 4W6QA 1R0ZA 2CXRA 3STWA 1L5QA 5B3AA 4YRMA 2QVLA 4KDEA 4LBZA 2JGDA 5EG5A 4FYHA 2AOXA 3ZHSA 4CQMA 2H3EA 1IQPA 2YWJA 5JSZA 2FCAA 1S2LA 3FPSA 4O2BA 1LX6A 2VJAA 3B6IA 1LU9A 4REOA 1RS0A 4X84A 3ANSA 4OXQA 5AQEA 1YL7A 4NJEB 1EFRD 2A3RA 1TVKA 4H1UA 1UJ6A 1NN1A 1ZVVA 1WLSA 3CUWA 2P77A 4FYXA 1CK4A 4A5OA 1R88A 3VHXB 2MCFA 3LWDA 4PGMA 2OCBA 4PYLA 3FRJA 4YLGA 4CDGA 4DF3A 4X62B 3QW4B 4C7OB 2C7GA 4HGZA 3T7AA 3TMYA 1KBOA 1EDEA 4D6PA 1T8WA 1JEJA 3CR7A 5E1DA 5IEJA 3FPLA 3UH0A 3V97A 2W0MA 4R1SA 4EHJA 1I4OA 3L18A 1L5OA 1RZRA 4ND1A 2IX3A 4C01A 1RXYA 2AGVA 5EE9A 2NO6A 4Z9FA 4DQUA 1M72A 1PG5A 1XZFA 1D1SA 3K9WA 3Q72A 3ZK9A 2HYIC 1U3WA 5E1MA 4A36A 4C78A 4O3MA 2WF9A 2AFIE 2JGMA 2FOXA 1QB7A 1FSZA 1MH1A 5MFPA 2B9VA 1P91A 2R8YA 4Z6KA 1PL7A 3JQ9C 1US8B 1LQUA 2IW1A 4H7KA 4JIMA 3K8QA 4OM7A 3AM1A 2ZBFA 3DL7A 4B35A 3CIFA 1S5PA 2FWIA 2BFWA 4TTVA 4X1KB 3JASA 3ORRA 3H11A 2JD0A 4NV0A 5T8KC 5BWLA 2H4WA 2IHKA 4KMSA 4G1MB 4ER6A 3LCCA 4D41A 1VE1A 2GK4A 3A4TA 3ONEA 3SN6A 3HKBB 3IOYA 5LC1A 5K6AA 3F7NA 3HB4X 4R8MA 3ZXSA 1MD9A 5KNDH 5K5EA 3NYIA 4W5QA 2QBYA 1KIFA 1LI5A 1N2ZA 3JZFA 4FFNA 2XHZA 3NNSA 1G8MA 4H3HB 4PFQA 4TLLB 3RVQA 2NVOA 2PGAA 4YWJA 3WK5A 2VK2A 3GX1A 3CUEF 3KOUA 3COVA 1ZMTA 1NULA 3I6MA 4UVDA 3DAFA 1U2QA 2ZU6A 3KYCB 5EUQB 5JH7F 2Z3VA 1J5PA 4MAMA 1VKOA 4RHFA 1SUPA 5AW7A 4K8OA 1OX5A 4UPEA 3MD9A 4YO8A 3ZDQA 1JIKA 4EVRA 1V9CA 1N33B 2P75A 2PM8A 2WVGA 2ZXFA 2J3IA 3ANNA 1WCYA 1YZQA 4TTRA 1M1NB 3H6HA 1LCIA 4BNHA 1KJIA 2BEKA 2FR8A 1PSWA 3ZU5A 721PA 1E89A 3E7XA 5JNTA 5JZBA 4X7RA 4Q21A 1NZDA 2HFJA 5SV2A 3GZNA 2YVLA 4B7ZA 4BRZA 4M46A 5J4LA 4UU8A 2FSIA 1X1BA 2B82A 4L3OA 2DHRA 2P6OA 2PKEA 3NDRA 2ERXA 3QLEA 1XTQA 4AYXA 2QL7A 3BRQA 4H0FA 4Z99A 1OLOA 2I6SA 3ZCSA 1VTKA 2ET6A 2K7ZA 3H5OA 1LVGA 2GWRA 2XUFA 4LXHA 1UDAA 3PNPA 2A9RA 3FHOA 1LK5A 4JSTA 1ZCAA 4CG0A 1E7QA 4XWWA 1MOQA 2FZLA 3DEHA 1EJBA 4MWTA 4ZQBA 3L4BA 3VGJA 1BMFD 3PCTA 4R2MA 3A9RA 4B45A 3G82C 2BEWA 3KQPA 5KWJA 4OKSA 1H65A 3CM0A 3DC7A 4E08A 3NFYA 2ZAYA 3AFGA 1NW6A 2Q2WA 3GVPA 3LY9A 2ZUCA 4MW1A 4EG5A 4JJAA 1SRQA 5AOAA 5L4NA 4TN1A 1N3IA 2QL5A 4B4WA 2ZUWA 1C7ZA 4TRMA 4NFLA 4YBRA 3OQVA 1D1QA 4FQ5A 4NVRA 1V11B 5GM2A 3DBIA 3GGJA 3KU1A 1GHTA 3GN1A 3IB6A 4J6FA 3G2NA 4C4YA 5AVTA 3GLHE 4BQRA 3B2QA 4BNDB 4NBRA 4WY2A 1O4WA 2HZ7A 2H8GA 3RIXA 1BC5A 4F85A 2YJ6A 4M0UA 3Q9NA 2WSLA 2AF4C 1JZTA 2FRVA 5EQDA 3TR5A 1XK6A 4L4ZA 2QTWB 4N0EA 5HZHA 2NVBA 1H93A 3IQGX 4C0JA 1PL0A 4FMDB 3R4CA 5EE0A 1CY8A 1TM2A 4TQAA 2I55A 3ZLVA 3KHTA 2ZYDA 1YQWA 2ZK7A 5EXEA 3DWEX 1PQUA 4RZQA 1GN8A 2FWBA 4E15A 1F7VA 1B8NA 1Q1ZA 4A4DA 4BVGA 2XBLA 3LUPA 5ALMA 2XAAA 3TX2A 3ZWCA 2E6UX 3H9GA 4Y67A 2FJUA 1E99A 1ZM3A 5DHTA 1V7PC 3I3SR 3N3AC 3FNRA 1C41A 4D9GA 4R16A 1I7QB 4E33A 2YFYA 4NKRA 3HL0A 3BE6A 4LE0A 3UAGA 3VC2A 3TW4A 2DBZA 1CUVA 3MUFA 1J42A 1QKJA 3U4DA 2A9QA 3EVGA 1CRLA 3NRJA 2P4SA 3UCFA 4D9BA 5DNEA 2FWAA 1IK6A 1YBMA 1YCFA 4IV5A 1DWPA 4B0OA 1ZL2A 4L74A 4O5OA 3M6WA 2C77A 3PDWA 3RWOA 2D4HA 3L0YA 1UAGA 4PTLA 4ZOLF 3T5MA 2O7SA 3V2UA 3VNQA 4DHEA 3F7TA 5PNTA 3C8DA 4MV8A 4U7JA 4G5YA 3ZD8A 3IEMA 1C3LA 4QU8A 2XMDA 4IVRA 2OR3A 3BB3A 4H7IA 2HJRA 2VQEB 4Q12A 2GCGA 2SECE 3HXLA 4MV0A 1WO8A 3WV4A 3TIFA 1P4SA 4PCVA 1QP7A 1TCVA 1XZHA 4YMLA 5KOHB 4N54A 1KO7A 1JHXA 4B48A 2CLDX 3DMTA 1JG3A 3AQ4A 1JSRA 1U7ZA 2W2TA 3PYXA 4DV7B 3WGUA 4QXQA 4GOOD 3TAUA 3WIOA 2OE2A 4CKEA 4C7MA 1E77A 2GPYA 3ASUA 4DLKA 3SBDA 4G0OA 3MMZA 1NXXA 2YQ5A 4GSKA 3V33A 2P7IA 3I37X 3VDXA 3AMVA 3D6MA 3IRUA 3KP1A 3VAYA 4GVLA 1SXQA 2VLBA 2XECA 3UFXB 4B87A 2IW3A 5HSGA 4BNWA 1PV2A 4FILA 2JCVA 1Y6JA 3F8TA 2YXNA 3KWLA 3L93A 2VJKA 1Y81A 4TV9F 3ROXA 1TJ4A 4S35A 5DWVA 2YDXA 4UEQA 1PT9A 1ZNXA 2VPWA 3BH6A 3KUKA 4G8DA 5TF0A 1S6YA 1UBOS 1Y8ZA 1R9MA 2AMVA 1YZFA 3T12A 3CWZA 3IEUA 2FZKA 2GSDA 4J2TA 4F97A 3R6GA 2XCTB 3JQAB 3Q2KA 2ACKA 5CYFA 3W3AA 1YC5A 5L9AA 3FMPB 2G6BA 5F12A 2F7SA 3C4JA 1RR6A 1WXFA 4N6GA 1ZVQA 2BFOA 4ZCLA 4YXWA 3VPCA 3FOWA 2PX2A 1NF3A 1R27A 2Z5FA 3PKZA 2PWAA 4O4HB 2J09A 3DAGA 4E4YA 1AUOA 2Z0MA 3GH3A 3ONFA 5FWXA 3G2PA 1FYFA 1N57A 5LZ5A 4RH0A 5T4BA 1JSLA 2ETXA 2FX3A 3A2KA 4JI1B 4IS3A 4Q15A 4Q7LA 3EXHB 4TLMB 5LSAA 3A6KA 1OIVA 4LNHA 3TQIA 1XJWA 5DBHX 3O82A 4ZT5A 1RCUA 4MCHA 3U3XA 1NI3A 2F00A 2FLKA 4HQNA 4YLEA 1E3DA 1EUCB 2OAEA 2C3MA 1XSEA 4ASUD 4N3AA 3FWNA 3A06A 3CSSA 4FHFA 4N0MA 4OHUA 3E5NA 4BE4A 4EB6A 1T5TA 1DJLA 3EIEA 1JFLA 5CH3A 2XQGA 3AFMA 4BLSA 4BNUA 4K9PA 3ZGVA 1OU4A 3K09C 3WFJA 1DAMA 3KJNA 4UEWA 1LQ2A 3HQ4O 2CMGA 2NUPA 3GXBA 1G6HA 1G5IA 3G9TA 5A9TA 1NVMB 4RA9B 3I9MA 3ZU6A 5DLQC 2C99A 1U6IA 1OAKA 1JKFA 3OE5A 1ZMBA 4R1MA 4R3WA 4QSHA 4D8UA 5BORA 4RTQA 1U9CA 3GUUA 1RADA 3UQYS 2G9RA 3OICA 1FVXA 1WPQA 4BCDA 1W75A 4CODB 2J4DA 4LA4A 1SCUB 2EZ4A 3NHKA 3QX8A 1WUHS 2G4VA 3HDHA 1YH3A 3DHYA 3UB2A 3F71A 3GB9A 1FNMA 4B8YA 1ACJA 5D6NA 3DFFA 4AROA 2HV9A 4K26A 2H4YA 4L50A 5FLXA 1Q92A 1D0SA 2R6R1 2ZPAA 4N7MA 3TCNA 3TD2A 2AHRA 3VU9A 3D8BA 4DYVA 2I7XA 3P5SA 4MSUA 1NBME 3JYNA 4U9IS 4BZZA 3EDMA 1PR4A 4PSCA 4F72A 3WAGA 3GLVA 1Z4PX 2QUJA 1ZD8A 4UE2A 3LT1A 3IKMB 2GAFA 2IV3A 2QPAA 3P9ZA 3RSZA 1IEQA 3NTVA 3CO0S 2GM4A 3EH1A 1LQTA 1JSXA 4HFMA 3VKFA 1CVIA 1IE3A 3WG9A 2I2DA 1F14A 4QDKA 5TF4A 3CA8A 4KEAA 4ARIA 1C7QA 2P62A 5AUOB 1KKUA 1JR3D 5IK2A 3PX7A 2G67A 2JFYA 2AR9A 2IU4A 4PC6A 4F21A 1D2EA 2ZT8A 3P9KA 3RFVA 5BRAA 2W2KA 5JAPA 5M5BA 1TT5B 3IIMA 1EA7A 1U2ZA 2PRYA 1XZPA 3C8ZA 4GRDA 4LZNA 4E5YA 2PXCA 3QKUA 5FUQA 1FFYA 2QMHA 2FW1A 1NT2A 5T4EA 2WOJA 1U9ZA 4U8GA 4BFLA 2IVZA 1DBSA 3IV6A 4B2YA 2PGNA 3SHWA 5H3LA 4NNOA 1AT1A 1RWNA 3GRYA 1BE0A 4HNHA 4A7PA 3QX7A 2YXPX 2J6IA 3H8VA 1PVOA 4LZAA 3W4JA 4C4SA 2AC7A 3I6YA 1UPFA 1XKQA 2BR5A 4UU1A 3PRHA 1T3LA 3DZ8A 4FJ2A 4DRYA 3EH2A 3B51X 2BH9A 3HXMA 3A36A 3NBUA 4QECA 1QRAA 4YQFA 3R1IA 3R23A 2C07A 2C8VA 4WFIA 3ICQB 3QITA 5ELXA 2Q8PA 4FFBA 4QUDA 1J8VA 1QH8B 4MUYA 5LU9A 3SVTA 2AX3A 3Q9UA 2YWDA 4HR7A 3T7CA 5IYZB 1TYCA 1ARZA 3DBVO 3VH2A 3TPFA 4EUEA 4KYIB 4HH0A 1E3WB 1Z17A 3IXLA 2PBFA 1U7XA 2C5BA 3H2BA 2PRIA 4I5DA 1T0PA 4BIMA 4MMZB 3TD6A 3MSCA 3NTLA 5FEMA 2CB0A 2NSJA 4E1BA 4DILA 3ZCVA 4NCAA 5FCDA 2Q49A 3PGLA 4KIWA 2FOIA 3MA0A 1F6DA 4TMZA 4D6YA 2J6BA 1LLCA 2H0QA 1MJFA 3K0SA 2V6BA 3NJRA 3NHMA 3O3MB 3NHYA 1PUIA 3FZNA 3NR2A 4ZAFA 1OI7A 1DV2A 2QE6A 1DC8A 2R2GA 3JVUA 4NBKA 3LNCA 2WPNA 3WK6A 2XUZA 3FTNA 4EG7A 3LT2A 5YASA 4TSKA 4YAGA 1MX1A 1XMJA 4G86A 1DG1G 3TQQA 2JRLA 5CA0F 4R2WA 3MTBA 4C5CA 2VDNB 1UZUA 2QGFA 3CSDA 4U7WA 3W5JA 3LHFA 5GJVC 3WLIA 5J47A 3DJYA 3F3YA 3H2YA 3ZBTA 1QSGA 3ZKWA 4I50F 3ZNOA 1BJRE 1Z29A 3E23A 4N9QA 3LBNA 3IT1A 1E2HA 4MVJA 4DMCA 3DDZX 3P2MA 4D97A 4X61A 2AKYA 1MJHA 3CU5A 1QIKA 2C3OA 3U2QA 2XMCA 3FI0A 4RIEA 4ND5A 4P86A 2GJ4A 1BDJA 2PS9A 3GP8A 4R7TA 2ZM6B 1XLVA 2YUIA 5C5IA 2ZRKA 3ZZMA 2FN9A 3HUUA 3JQDA 3MEQA 4UHDA 4ZXFA 3HLYA 1MHTA 4LF4B 3OD1A 5DM0A 5KVSA 1MVOA 1U5BB 5C2JB 1IY0A 4A8JB 1C7JA 3FWZA 1MJGA 4QDXA 4R1OA 3TL6A 3LK7A 4AJKA 3SXJA 1UZNA 1XLUA 2C04A 1H2EA 3PC4A 4WJLA 5EZSA 5JZSA 4UFPA 3B52X 3CCCA 1PQYA 2AN5A 2F3SA 1GPKA 2BCGY 2AEEA 2ZXEA 2QOEA 3O7WA 3EF3A 3RUAA 3SNKA 1N77A 2F8TA 1XNGA 3PHCA 5LKAA 2R84A 4KXMA 3TQRA 4CF5A 4ESOA 3FYUC 4TS3A 3KUXA 4JLDA 1Y9DA 1OHHD 2QUIA 3M6UA 4Y2JA 3RC9A 3ZHVA 3RHZA 2E1PA 2Z9BA 1P2SA 2R8RA 4P53A 1JKIA 2QWXA 4EPWA 4B3IA 1V5EA 2VHTA 4JWKA 4PQYA 3UMBA 4DSAA 2IEGA 1RI3A 2XQVA 5K0JA 2IUYA 1J09A 1W4AA 3FUUA 1VL1A 1PJ2A 1YVEI 3ZE1B 1XDDA 3A9UA 1ISMA 1X8JA 1NP6A 1GKUB 1FVFA 4XM0A 5DNAA 3N2ZB 3S1AA 2XE6A 3LP5A 4N5NA 4BMDA 4M8LA 1A5BB 4NU0A 1XZQA 1UMBA 4XQ0A 3C87A 5J1SB 3RBVA 2WAOA 1UPTA 1LV8A 3ECAA 5GGYA 3QBJA 2XB9A 4C89A 4EL0A 5LU8A 2YX1A 5DX1A 1T5BA 3EWAA 4KVAA 4MXDA 4CM4A 4PIMA 2IU3A 4TM8A 3GD5A 1ZUWA 1ICIA 4BDSA 4QATA 4LX8A 4D43A 1JZSA 4H1WA 5H7XA 2L19A 5BUCA 8LDHA 2IYPA 2D62A 2GUGA 2EKPA 1T6BY 1HZZA 3ROGA 2V7TA 1CRQA 1F7UA 3PRKE 4N8DA 4U9UA 4MQ4A 3TTVA 3WLQA 2X7HA 4REQB 4ZAXA 5CVJA 2EBWA 3QHQA 2E4UA 3EAQA 4N1AA 4E7OA 4EITA 3C6MA 1HRDA 2P6NA 1ZI6A 3DAYA 3FRIA 4Z1MA 2X22A 3RRZA 3KK0A 3DDNA 5DGIA 3VO1A 3HU2A 1CFZA 4XUCA 5JRDS 2ZTHA 3PNMA 4OMCA 2X6QA 3SZMA 2ODEA 5A4AA 1NSFA 4MUNA 4KSCA 4PRLA 4R8RA 1NNSA 1Z7BA 4P82A 2HQOA 4QHYA 3R74A 4CMIA 4YT2A 1AV7A 2WYUA 1N7GA 1XZAA 3QWFA 1FLVA 2VSOA 4HLUA 5TEWA 2ZBDA 2O06A 3X2EA 5JSUA 4GX5A 1O3YA 5G02A 4BNVA 2R00C 2XTMA 1E2NA 4TKVB 3ABQB 1ZHFA 3MOIA 1XMIA 1YUBA 2OP0A 2VUHB 3PDJA 5IULC 1R3UA 2PO7A 2QLBA 5BOSA 3A0RB 2Q4OA 3EY4A 3HZOA 1QNFA 3I2GA 2QVXX 1LS6A 3LVFO 3M2PA 3QKIA 4NZPA 4Y0VA 4ENUA 1PJAA 3DMHA 4H4EA 1XAIA 1BCRB 3T94A 1EP1B 2WW8A 1EVLA 4GPAA 1SFRA 2V7UA 4HVTA 4Z5XA 2WZBA 3S7TA 5LZ9A 3QOFA 5LN1A 2WWYA 5K3BA 3ZZNA 5HILA 4MUIA 1E59A 2CWWA 5GP1A 4DMGA 5L7YA 4Y18A 2PKCA 4EDFA 4PPFA 1TX4B 5K05A 1HSOA 2HIAA 2G88A 5CNMA 2YZNA 1GTJ1 4R9RA 3KQLA 1ZGZA 4UTOA 5THQA 3T3DA 2B8TA 5JAIA 3KJFA 1PWEA 1LPPA 4FDAA 4DSOA 1AGYA 2OL4A 3AC0A 2JHFA 3E4DA 4LZZA 3H6GA 1EESA 1V7QA 5BRNA 3LZDA 1VG8A 1KEPA 4AJ1A 5BPHA 3EPLA 1M2EA 1RZ3A 1CS4C 2WKRA 2ZULA 3OOYA 5A4IS 4M86A 2ZB7A 5CA0A 3D8RA 4ZD6A 1QJ4A 2D06A 2NZ2A 1AA6A 3IMGA 4O1MA 4YY3B 4PO9A 5CD1A 3M4XA 2HJGA 3OWXA 4OHCA 3NAZA 2F64A 4Q9JA 3QE0A 4YBZA 4M3NA 4RVFA 4UDYX 1P7CA 3P0JA 4BQFA 2EGUA 4FB5A 5DTEA 2O1EA 2YV2A 3G5AA 1U0FA 4HHEA 3PIDA 1M8FA 2P40A 5B55A 2UZ0A 3RARA 1V6SA 1XKLA 3H04A 3UICA 3R9WA 3WLJA 1KE2A 1O94D 3FNBA 5D1NA 3HJAA 1ORVA 4AWAA 3ERCA 3HVRA 3F47A 1HX7A 3Q1LA 4O4JA 1GRVA 3BG5A 3MG9A 3Q9LA 1D1PA 2O7RA 4LJYA 4IIBA 3SMVA 5A5VA 4D25A 4KQ1A 3H9JA 2X6TA 1MAUA 3IEIA 2BGNA 3SKVA 1WY5A 2PO5A 1DX9A 5BW4A 2P2ZA 3SBXA 1EHIA 4NATA 5F7OA 3VUFA 3BJZA 2SHKA 3OUZA 4IIHA 2EFHB 3DL0A 1N3LA 4R01A 5F2NA 4Q4HB 3IUQA 1UPXA 4ZTBA 4C4AA 1UDCA 1V37A 2FMTA 2CHQA 2ZSHA 4LCBA 3ZWVA 2MYPA 3TF5A 1ZUHA 1YB1A 2AC4A 3NJ8A 4TMTA 1FMTA 3VZQA 2ECFA 3FLEA 4P4SB 1JIXA 3OSZA 4WBNB 3NAQA 1KAQA 3EZ7A 4WRRA 4CIXA 3O6VA 2VPZA 3GAMA 4ITUA 3F3SA 3GJXC 2XWBF 1DSSG 2G8LA 4PBTA 3IO5A 3AM5A 4M7RA 5CAEB 2VYCA 4ZHQF 4ZODA 3KZVA 2QTVA 4V1CA 3CMMA 3O5AA 4XCQA 3RFXA 1GDHA 1ULHA 1CUSA 1H6DA 1ID8A 2GETA 2H5EA 3RTGA 3IAM6 2RH4A 3O8DA 4C07A 3AIIA 5DP2A 3U3JA 2BTEA 1ND5A 4CMAA 1N1MA 2FW7A 2AI1A 2FGJA 3NU1A 4TMWA 4NDNE 3TMAA 4H3VA 5E6UB 4DMHA 2FDRA 3C6ZA 1KMCA 3E48A 2QI9F 4L8LA 2QT1A 1JHDA 4K6HA 4MUAA 4R84A 2XRZA 1O5TA 1NMYA 1U6JA 1KZYC 2FPXA 2VXBA 3FHCB 5BYKA 1RLUA 1U8ZA 4LAFA 1E1QD 3OOEA 3PR3A 1QTRA 5BXQC 4CXMA 4FS3A 3AEUA 1J21A 1JDBC 1NBOA 4IG9A 1XWWA 5HDQA 3F78A 5ALWA 1C7FA 4KRGA 1BDHA 3H9UA 4AY6A 4CI0B 1Z5PA 1M1XB 3LCVB 3GELA 3ZWMA 3ZDDA 1JDSA 5CCDA 2YNMC 2D2EA 4RTNA 3HI4A 1J6UA 1PL6A 3BZUA 3MCWA 1UFQA 3PGA1 3FUTA 2OGZA 2QJFA 4NNJA 2WJHA 4NQZA 3G49A 1CU1A 1CS0A 1XR3A 5AXBA 1CQPA 1CPYA 1V8PA 4FYYA 4G97A 4ZU3A 4D96A 3SVLA 1GGNA 1EK6A 1PJTA 2XT6A 1GPAA 1AZLA 3LT4A 2FLWA 1UXOA 4JX8A 4RA9A 4UCQA 1KYYA 1L5GB 4MWSA 3F73A 2AOVA 4ZCQA 3LDHA 2CK3D 3A6LA 2YINC 5IDVA 1NVFA 2RSLA 2ZRHA 2Q21A 2RHRA 1A97A 4RCZA 4Y9RA 3CVVA 3RVPA 4M54A 3MJSA 4FQ8A 4R69A 3JR3A 3QU7A 2P4UA 1OBCA 1XRQA 2HXSA 3I5MA 4FXOA 4PG5A 1YB2A 3GCGA 2YVQA 5IC5A 3EK2A 5A9SB 3V1LA 1FIUA 1M1ZA 4G0QA 2ORED 4DQVA 1T1RA 3GQVA 2R4TA 1M54A 3F9CA 1P1IA 2NQ8A 2NU8B 3D4LA 1ISGA 3JTMA 2BGUA 4C6SA 3V32A 3VR3A 2IPMA 4YI5A 4AN0A 1SRRA 4EB0A 2PE5A 1YFKA 5AQ1A 1BX3A 3MERA 1AGRA 1J06A 2H57A 1CUGA 2POCA 4IIEA 4PAQA 2EFGA 4IICA 1E1KA 2XMQA 4S0ZA 4IL5A 5U4QA 3NEPX 1C3JA 1Y82A 2GESA 2V4MA 2QG9A 4UTVA 1XZNA 3AJEA 3FLMA 3OQ1A 4RELA 1VFPA 3WLRA 1A8PA 2PBLA 1XRRA 1UKEA 2IK8A 4NFHA 1NTRA 4WESB 4Q18A 4LGYA 4V03A 5TJHA 3VPFA 2C3YA 4QBKA 3V80A 5LP6B 1YS2X 1KEVA 1ILEA 3CKMA 4OVKA 5BVHA 5FOQA 3TZ6A 1XP8A 3VO9A 3C3EA 3FNFA 3ORYA 3ZDFA 5BUZA 1JQJC 4RVDA 1KDTA 3D3KA 2HTEA 4OGWA 3HRIA 4ND3A 1E0AA 1FS4A 1LX7A 4GLOA 2X8JB 4QJIA 1M8KA 2WP8J 4H08A 4LHZA 3OIUA 4X93A 4AIRA 1YHYA 2E4ZA 2HWXA 2PKQO 4F9GA 4G1FA 1XLTC 3KKEA 4Q5IA 3SJ7A 4L02A 5KQPA 3PI6A 4D82A 4DMUB 2YN4A 2Y92A 2FEWB 4MNTA 3M5WA 5JZMA 5JSYA 1TGYA 3NDIA 1HFKA 1FJGB 1YS4A 2GZAA 1ULBA 5IAKA 3CCFA 4MKHA 3I2KA 4CLOB 4KIJA 1RMYA 3CF4G 1MEOA 4I3FA 3P0RA 1N2GA 4Z9XA 4BO6A 1JG2A 3X2SA 3BIXA 3CLUC 5C9ZA 3LQ1A 2I1QA 3PFHA 1R10A 4HGQA 2NSYA 4KUGA 4M89A 4NV3A 4X00A 1YK0A 4RYDA 2DBYA 1CDDA 3AWDA 3IS3A 3SGLA 3W2TA 2BR4A 3QVVA 1HXHA 2FQ1A 3PNKA 4GMKA 4LCJA 5B37A 4QFCA 2PPVA 2HFKA 3OU7A 1N7JA 2IITA 5GZ3A 2HXGA 2L82A 3BULA 3EPPA 4GZMA 1DBRA 2C8LA 3G2OA 3RK4A 1R6VA 3IESA 2N3ZA 4GKJB 5D6OA 2A5DA 4E46A 4HPJB 4UCXA 4G5FA 3O1JC 2VRNA 3LBIA 2RCYA 2XNJA 3ETHA 1Q44A 1KYIA 5JU6A 3BHIA 3QWIA 1IHXA 1R1DA 1O97C 2WJJA 1HDOA 1H5NA 3W78A 2ZR7A 3OWHA 4UD2A 1IMJA 5AW8A 1CF4A 2PD4A 3A1FA 2FZGA 3VTAA 3OG9A 3DDCA 5L3ZA 1XI2A 1Q57A 3DD1A 4BFCA 1NGSA 4R71A 4N01A 2IYLD 1U65A 3DEKA 2GEUA 1FXSA 3T9BA 1J2RA 4DS3A 2VQ3A 3C6YA 1IB0A 1EB8A 2I62A 3E18A 3KEOA 5ERXA 3TBHA 1O95A 2GILA 4PAOA 3AB8A 2IYTA 3GLFB 1FNDA 1NG9A 2GZHA 1BEUB 1D2CA 1E5LA 1DKRA 2AFHE 4A73A 3AB7A 3ENWA 3ZCRA 4CM9A 2NADA 3D2CA 1TEHA 5AT1A 2WTMA 3LCUA 3ROPA 3L84A 1I7PA 5IF3A 3K9LA 2BCJQ 2PSFA 2Z2XA 4L3WA 3DV2A 3O4RA 3THRA 3CRW1 1VOTA 5WRFA 3SBEA 1NR5A 2O2YA 2OBBA 4JT9A 2PIDA 3PGXA 5JW6A 1QCDA 4JLVA 3QELA 4IVQA 3WWPA 1YDFA 1WCIB 4DCTA 4IILA 4G07A 2ZE6A 4OQQA 3LUCA 4BP8A 3AHCA 3GJ3A 3JU3A 4BQIA 5JADA 2QRVB 3L82B 3PQ4A 5H9VA 4MRMB 5TQ0B 1KOFA 2GFQA 3T7RA 1OXBB 1BD4A 4YUVA 4BBJA 4M2LA 1PYOA 1GNQA 1CETA 1L4NA 1FXUA 1Y6QA 2XLBA 3M9WA 3NTOA 4BO7A 3OOHA 1NATA 2YV4A 4HAOA 2QN8A 1TECE 2IUEA 1K8QA 2OUIA 4IDDA 7ABPA 1GSHA 3U3ZA 5ESRA 2UUCB 3JQEA 4ZK2A 3SLKA 4C0HA 2YL2A 1CX9B 3BICA 4DCUA 3PDIB 5JY1A 1D0VA 3DULA 1QO0A 4I8DA 4RYLA 2HB6A 4X7MA 1U7OA 5FORA 5KMGA 4PC1A 1X0VA 5BUQA 4GQBA 2JGLA 1JIUA 4F45A 4XUDA 4HBGA 1W52X 2DC1A 2DMRA 4KQ6A 3DT8A 1IUNA 4M76B 4MRRA 2EARA 2VATA 1V8ZA 2OGTA 5AHXA 1M7GA 3HRHA 4ZYVA 4CRWB 3PD7A 4TZKA 1GZ5A 1MENA 2YN0A 1RE0A 4YHHB 4HWKA 4KV7A 1PZXA 4XSVA 5FTMA 3DUFB 1G8YA 5A06A 1NJSA 3K5PA 4UBIA 5AVWA 3HWSA 2UXDB 2HSEA 4MICA 2O48X 5BMVF 2GA8A 2KI5A 3KJGA 3K92A 2YHIA 2YFQA 1P77A 5DSZA 3AVOA 3FSJX 4PLYA 1XCPA 4NOJA 2FPMA 1C5KA 4KOEC 3B3FA 1W30A 3JRWA 4DPLA 4N39A 4QTUB 2JJ1D 5REQA 4BBZA 3GD7A 3ZWPA 3W4IA 4O8CA 3IVXA 2V9CA 5FWYB 1DAPA 3VOAA 2FEOA 3AEXA 4WNIA 1NZJA 1BIFA 1A2QA 2IDMA 3FX2A 3QVKA 2UYYA 4NE2A 4S1VA 1GCOA 1Q7BA 3N7UA 5BQPA 2K2WA 4OB7A 4RJTA 3F7OA 3QTLA 1NLFA 2CE2X 3DCYA 5TMBA 2HHJA 4OQYA 4M7WA 4Y98A 1W88B 4A6XA 5IHPA 1EZZA 1B6RA 3II6X 3OCZA 3RKSA 4NPCA 3OTOB 1I5RA 5D3ZA 1OW3B 1Z12A 3A6DA 2WVHA 4MKZA 4CHTA 1K98A 4LJRA 3CF4A 1RWPA 2C5HA 2ZRQA 3LPAA 4HDAA 4N47A 1DEHA 4MQ5A 2N42A 3RHSA 1PFYA 4RD1A 4DJJA 2IVFA 1G7SA 2AXPA 2JIQA 5AP9A 1TTHA 4JK3A 1NBAA 2ZAMA 3P9RA 3MBOA 4ZVNA 1ZMOA 1D2HA 4FLFA 1FBTA 1S8AA 1Y8QB 2P41A 3ABOB 2FPUA 3UK6A 3JWIA 2AYZA 2FPLA 5C7LO 2VBFA 4C87A 3QPVA 4DABA 1XZ8A 2M98A 5DP1A 4E94A 5LDDC 2HK9A 1MDBA 1E7WA 3LXXA 4JKOA 2VHQA 3BS4A 4ZIRA 3FSEA 3QFFA 1MIOB 1ZN9A 4CR7A 7ADHA 3SIRA 2AWNA 1HMPA 1KKLA 2JBHA 3VZSA 1L4UA 2VK4A 2GERA 3WYNA 1QRRA 4YLYA 3SEZA 1K75A 5KNCH 2P9QA 1W6RA 4G0XA 3C3JA 2XIQA 2ZSIA 4PX5A 3GUVA 4U7HA 2EIXA 4UHBA 4Q9HA 5HJEA 3AEZA 1JE0A 2IHJA 3TJRA 2BKLA 1G16A 3AJAA 2QTLA 3MJFA 4MGEA 4HZUA 3U7QA 1RI2A 1I3CA 2R8EA 1DX6A 4C6TA 5KWEA 5AMXA 2E4VA 1WUYA 3FKJA 3HDJA 2ORVA 1QDEA 4YJKA 3JWGA 5IT5A 1X2EA 4LECA 3VYSB 1CY1A 2WMDA 4Y1RB 5E4TA 3TEMA 3E35A 5LQSA 2FGKA 4K6FA 1F0PA 4HATA 2JGRA 1X9GA 3VU1A 5JVDF 3JQ9A 1IXYA 1N32B 2P6MA 4I5IA 4NMLA 4ZT4A 2FDCA 1X74A 4EIWA 3BHNA 5A9RA 5GONF 1Y7TA 4D4MA 2G09A 5FLEX 3K2QA 3CX4A 1GXSB 4DG9A 4IFIA 4ECEA 5JTTA 3F2VA 4JOCA 1Y1RA 4MYUA 5JS6A 5D84A 4DSZA 2WB4A 1FXWA 2QZ4A 4H3KB 2VH5R 1TJNA 1P33A 2A94A 1DLJA 3RE1A 3OX2A 4NS1A 4AJLA 2HRRA 3SZOA 1IZZA 1K0FA 1CUJA 3LKBA 4RU1A 5LB4A 3TNDA 3Q1KA 2XVXA 1NDUA 1CVRA 4DDTA 3UVEA 1OMOA 1ZHHA 4E5NA 2H2FA 1N92A 2XA1A 3FCYA 3I1JA 2RGXA 2UXBB 2C03A 3UUEA 4C0BA 3BDAA 3ZWAA 1KRHA 1OXSC 2ZANA 3DT9A 4R5MA 4B84A 3QVGA 5JSFA 1FP1D 4HVLA 1WPXA 1KDOA 1KSHA 1CY4A 3L06A 3AI3A 2DCUA 4JUDX 3IAXA 2G1UA 3EUFA 3E9QA 3ZLTA 4EBFA 1I9CA 1VP3A 2BM1A 1ST3A 3JARA 3LT5A 4GWGA 4QFBA 1BOFA 3HB0A 4WGFA 4B6PA 3AF4A 2AZXA 1YT5A 1E66A 1XQXA 2K2QB 2JJ2A 1KYWA 4U8HA 1FP7A 2XQFA 3RI3A 1Y4DE 1J9EA 2FW9A 1HH4A 5LYJF 2Z6AA 1TUEA 2XUDA 5LNK6 1TB4A 1LTQA 3W1VA 2B4QA 1JHOA 1EXNA 1CJTC 2PZJA 5JCPA 1B76A 1JAHA 2D5IA 3LRXA 4WSOA 2IT1A 3WK4A 6REQB 3ESAA 1H3NA 1WZIA 2HCJB 3OLCX 2DWPA 2FVXA 3S2IA 1VGVA 2D7DA 2WABA 5TIIA 3OFNA 4E5DA 1NRWA 3E9MA 1WRBA 4M9SA 4UASA 4P0PB 2M9MA 4JKYA 4YCSA 3DV9A 4D8TA 2J32A 4ZPJA 4UNRA 3ZIAD 4EF5A 2CXPA 4DMRA 2E49A 3ZTYA 3L0PA 1LK0A 4UBMA 4A5SA 4F4CA 3U6BA 4BLWA 4O4LA 1JX6A 1OXKB 2AKEA 3R6LA 1VJGA 4TT3A 2FWPA 1QP4A 4JGBA 5K0EA 1YKGA 1D4AA 4YJHB 2PN1A 5LR6A 4E70A 2GAIA 1SCBA 2FQXA 2MU1A 1BXRB 1IZYA 3HCAA 4Q1CA 2O0HA 4QGSA 2WSYB 3L7JA 2R2AA 3KR9A 1KR2A 1CQZA 4GT1A 2FF5A 3IT2A 3HXKA 4JDPA 4MZXA 3TKLA 2VHCA 3OAAD 4YP0A 3THYA 2P4HX 3KEMA 2QSZA 3RWBA 5JSZB 1GG5A 1G6Q1 3OU2A 4O2BB 1POXA 4K40A 2IGBA 1CQJA 2AFIA 1XZCA 3ASYA 5IARA 1RJ9A 1TVKB 3MELA 1KI3A 1QYCA 1A69A 1FNCA 5B7PA 4LNUA 1XHLA 3VR5D 3IHLA 2GN4A 4DB4A 1YAJA 3EN0A 3OY2A 3UG6A 3O92A 1UOQA 5J2UF 1Y9AA 3WBFA 4BX0A 2VBIA 4WKPA 4U5XA 4K81B 4YAIA 3PA6A 4Z4HA 3PGVA 3JALB 3X1KA 4Z3KA 1X87A 3NOXA 2NSLA 4NENA 2BGMA 2RD2A 2GB4A 1MO5A 3PNQA 2I3GA 3LYUA 3OQJA 3TBFA 2RAFA 2HJHA 1XKTA 2CKDA 2ZJ1A 3VZPA 2XGMA 1U3DA 4A8TA 1BOOA 1M6HA 3PEEA 3KKPA 1C1DA 1P5RA 4OV6B 1DT5A 2ZRNA 4HDCA 5HBRA 5GGXA 5IDXA 5KEIA 4IRMA 1W87A 3W6ZA 4JYBA 2Z1MA 2FHSA 3JASB 4JNKA 2Q1SA 3EZ9A 3TLXA 4DIBA 5LP1A 3DMFA 3RF6A 5D85A 4B6RA 2J07A 3AEYA 3IOMA 3U9TA 4AICA 2GSWA 4HN2A 5JIBA 3U09A 1Z5OA 2TYSB 2YRXA 3NBYC 5IFKA 4LMRA 3W05A 1AZWA 4KPUB 4HFNA 1U8TA 4KZKA 4U2EA 3RK1A 5I9NA 3CEMA 2EFYA 1JHVA 3TZKA 3GJ6A 5A4FS 1K89A 4E21A 3D8SA 5TVKA 1E1CA 2R68A 5CFZA 4I66A 4ZT3A 1GLVA 1U8YA 3S8YA 4JN6B 1ENPA 1C4OA 1P73A 4XVRA 3MJDA 4A1OA 4BXOA 1SUBA 1JDJA 1U9YA 4U7TB 4WZAB 1VMEA 2EYUA 4BMSA 3MT0A 4X65B 4Z7JA 4YAEA 1UJNA 2CNWD 4EP1A 3MQ2A 4WH0A 1RJGA 4KFTA 3ZTWA 3REQA 3TQHA 5J23A 1A1VA 2H2HA 1CIJA 3RLIA 3E9RA 1OWPA 1QKIA 5K20A 4TRNA 3IXQA 2YYSA 2WBLC 4L73A 2RC6A 4EHAA 3ZD7A 1WCXA 1QXSA 3PP8A 3U1TA 1WXQA 2YJTD 2FXIA 2EZ8A 4EYSA 4G5SA 2A9KA 5AKHA 2HY7A 1SMKA 3I12A 3MWFA 4EHLA 5L8VA 1FJ2A 5HUHA 4ZO8A 4MYSA 3UK7A 1HE8B 1SXPA 3MD0A 1AKUA 3RAEC 1W5AA 1AUXA 2WYOA 3GZNB 3KSDO 3IVCA 2I4OA 3D6NB 3HWWA 5KOYA 3K0FB 1HTWA 1ZOPA 1V5FA 3GLHA 4L51A 1FMJA 5GIOE 4C9BA 1H3EA 1G5TA 3T5DA 5KOIA 2FUG1 3L9XA 5AIAA 3Q2OA 4HN4B 4XTRA 2F55A 3HXTA 2CJWA 4BBPA 3TLJA 4E1VA 2EJBA 3MTQA 4F84A 2EG5A 2REXB 2PXAA 1A2BA 2GPTA 1F2TA 1FUEA 2BEWB 4US1R 2D00A 3IVGA 1S96A 1D1TA 2ID9A 5FOUA 4KAXA 3W6OA 3EVDA 3NEJA 5EMMA 3SDBA 2B7LA 1J9ZA 3ORHA 1VIYA 1ODKA 2OFFA 1SBYA 3AKYA 3SQXA 3AU9A 5K3AA 3W2FA 4OHOA 3WKDA 3VR3D 3BGIA 4TMKA 4OB8A 5K8UA 1FFCA 2XVAA 5HFJA 4LF5B 3DFKA 1WW2A 4NLLA 2BGKA 2HMSA 1OFHA 3P4XA 1R37A 1VC2A 2HCRA 4ESVA 1J2EA 1D5CA 3ANLA 4D74A 2V7QA 2AOUB 3GLIB 4YUYA 1I6MA 4S05A 4XRGA 3VR4D 1M9NA 5CB4B 4II3A 3DVAB 3CT4A 5KI6A 5IJ0A 1C8KA 3B7PA 2YS7A 3EA5A 3SR3A 5IHXA 2JJMA 1TRKA 2GTPA 1V39A 1C2YA 3RSHA 4XDYA 2PGIA 3STHA 1LB1B 1HLGA 3BWMA 3ZD6A 2FQYA 1TMYA 2NZVG 2XYQA 2HDWA 4MV6A 4UM9D 2VJBA 4WKNA 4BNTA 3UHFA 1G1AA 3TI9A 3U7IA 2J85A 4CPDA 4H27A 3Q8LA 3ACBA 1XTKA 3DE1X 3D8UA 3ZWQA 4YUXA 1S8NA 1HT1E 2VYNA 3WNDA 1NM5A 4IZIA 4KXYA 4JUFA 5EE1A 5FUYA 3RSCA 5KYWB 4LVUA 4C76A 3D02A 2A9VA 2JZNA 3NT5A 5EXPA 1RI1A 2BFBA 1KTVA 2V65A 1FU4A 3D7MA 3GBPA 4JLUA 1EFKA 1N5IA 4PSVA 3KFVA 4QREA 2GBLC 3EQ8A 3I9NA 4HMQA 1XTRA 1J2UA 2I1VB 1VJ5A 2WUWE 2YOFA 4LY6A 3AKCA 1E61A 3GJ4A 3PX2A 4ALNA 2JI8A 1RHJA 1JBEA 2PSSA 5K3EA 5A7HA 2IBSA 3D7RA 3IPRA 2FEXA 4DDKA 4YMWA 2RARA 1P1CA 4HTFA 4E1AA 2C7RA 5EKSA 1PR1A 1O6GA 2X2FA 1L4MA 4QUIA 2OAGA 3H5LA 3IKVA 3OFVA 5FHQA 4X85A 2BV3A 1HG1A 1LDYA 6GPBA 4X7PA 4OOEA 2QR2A 1C4XA 2W37A 3F6BX 4F2PA 4QUBA 3CLTD 1EU1A 2IPXA 4MPPA 1Q1BA 1LPBB 1NRIA 3VH4A 1CDEA 3X1MA 1DAKA 2NZWA 4G56A 4RZSA 5AOVA 1E1LA 3NONA 5F4BA 5FADA 2FEAA 3V9AA 3WMFA 2I80A 2OHGA 3DO5A 4JASB 2ZZKA 3AJ8A 3V1MA 4N7BA 3K5IA 2AOTB 1C0IA 3K0CC 4PANA 3VHLB 3PC2A 2R5FA 1CJSA 3TTSA 1JFRA 1JEQA 4EA7A 3N2KA 4FFDA 4IIYA 4JLNA 3A3KA 4XQCA 1XF1A 1GPYA 4TWBA 4LJ5A 3AP2A 3S99A 3NHFA 3AERB 2PUFA 4OHPA 2AFRA 2JD1A 5HWSA 3M3DA 1KH1A 4OSPA 2RHHA 1L5ZA 2FI1A 2RJOA 5IRCD 2AMLA 3B70A 3NKLA 1N9GA 1UXHA 1JA9A 4RKYA 2XKJE 5T4FA 3ZW9A 3UOGA 1I94B 1MO3A 4WCFB 1UMDA 1FC0A 3AFNA 1ZK4A 1A7JA 1MO4A 4W1PA 4MCJA 4BKPA 1ZR4A 3MAGA 2F62A 2WT4A 4ONEA 4PLTA 2BGWA 4RXTA 4BPRA 1GDDA 3LMKA 3NKFA 4PNEA 2WQ7A 2AXEA 3PU6A 4QU5A 4L07A 2KLBA 4KO1S 4P58A 1IN6A 3LPCA 3WJ7A 3MYRA 1SHLA 2D5BA 4UU7A 5IM4F 3ISTA 4KZPA 1FPQA 5CT8A 3EC1A 3QV2A 1MZPA 1YRBA 3BAZA 2BGGA 2IHZA 4KQWA 3U49A 1KTIA 2RMKA 1T15A 3MOSA 3QJYA 3IJEB 4A6DA 1Q17A 1O58A 2Q07A 4HCJA 3MGGA 4IOKA 4ZVRA 1FLDA 3IB3A 5AJVB 3VV2A 5KBYA 2CUTA 2H92A 4X20A 2A88A 4EG1A 2Y1EA 3DJFA 3ZVNA 2QG4A 1XNQB 5E4JA 3ELDA 4I1PA 2ZTLA 3VR5H 2YIMA 4WWHA 2OBFA 3GZTB 1OREA 3F96A 3L1KA 3TNJA 2QN6A 3FOEC 4IV0A 2VTKA 2ZIAA 3DLIA 3GNTA 1F3OA 2O5RA 3KVRA 3ZY3A 4B4DA 4RHXA 5JDCA 2JZOA 4N4AA 4PAWA 3RFUA 1FMFA 4YJ2B 4K88A 2NYVA 3CRQA 4W5NA 2V6JA 2DE0X 3I4FA 3GIWA 3ZZUA 2XRFA 4ER0A 3DKPA 1WKBA 4I9HA 4TMVA 3BM5A 4HB0A 1NBMA 4HQFA 3TRJA 5AK4A 3BILA 2LD4A 5EHGA 4EB6B 1CRWG 1R4MA 5DMHA 2CHEA 2YVAA 5I9LA 3KZ1E 4PZ0A 3S55A 1AHNA 2X2EA 4KQKA 1L5MA 4EEZA 3KPYA 4KIUA 4J43A 3D6AA 4Y2XA 2FUKA 4M1QA 1PNTA 1IQ0A 2XCLA 2B5OA 1GPMA 3FIUA 2V3WA 5DXJA 2IYUA 1KI6A 3D5TA 2V74B 3FVVA 1M0EA 4HRXA 1DKUA 3FA2A 5FL3A 3L8ZA 1VI2A 3BJMA 1LY1A 1Z26A 5CDHA 1G8FA 2WIAA 2HQSA 5K3SA 3ZQJA 3PCRB 2HRBA 1RXSA 1AKTA 4LDQA 3GNLA 4EENA 2GPBA 1Q7EA 5CT9A 3CV3A 1P1FA 3BTOA 2GBIA 1G3IA 1DLIA 4G85A 4MO2A 3EF1A 1T1JA 1PSDA 4OGGA 2VJDA 5ALGA 3D7NA 1RQXA 2X4IA 2GN0A 8ATCA 3A26A 1OASA 3ZTTA 4AJHA 4ARUA 4FZ5A 3UXHA 2Z2KA 5CXXA 5JAZA 4URZR 4WHMA 5HJ2A 1QR2A 1GZ7A 4OK3A 1Z8NA 4Z51A 5FPQA 1U3TA 2B5WA 3OT5A 1S2OA 5B6IA 4RE5A 1XVIA 1JYEA 3KT0A 1K8RA 1ZA2A 2FMXA 3BMOA 4ZRNA 5EZYA 1G6OA 3WSWA 2Y0DA 1AB6A 3LPMA 1ZIDA 3UJHA 3ZV3A 1QK3A 2QZSA 4PV7A 1DFIA 3MJVA 3GYBA 5KJEA 4D57A 4PZEA 3D1VA 5A5EA 4CTKA 1K5HA 2YTZA 5BR1A 4EJSB 5KAMA 1Z8DA 1I3MA 4JI0B 2BBOA 2ZYVX 3ELBA 3Q6MA 2VJCA 4DR5B 4YP5A 3RYCA 1MMFB 3AF1A 3IKLA 2FPPA 4NICA 3DWFA 1Q3KA 1AS2A 5HMLA 1VRCA 3RSOA 3OU6A 4YMUA 3SR0A 2Z57A 1MT0A 5D5HA 3OIWA 4HAZA 2GDJA 2H1CA 3SE0A 4YUAA 2O05A 5JT1A 1QOQB 1R8XA 4CF7A 2PVCA 3B1FA 4JITA 1T4DA 4DJAA 3L7LA 3EVAA 4HQ6A 3QFRA 5AKXA 4KW7A 4RPLA 4FFBB 3NHAA 1NXPA 5FBZA 1ZD4A 2CB9A 3D7SA 3IT3A 4L4YA 1QLHA 4FFRA 2XT0A 2OVFA 1JKMA 1Y4SA 3OX4A 4JLOA 1N1GA 1UBLS 1Q20A 4NBTA 4UULA 1DO0A 3KR2A 4UMEA 5AO9A 3I76A 3OHSX 2QX8A 4JAVC 3LZ6A 1H0HA 2CJFA 2XVYA 3AVXA 3QG5A 1NW4A 2WWXA 3NASA 5ALSA 5JS7A 1ULUA 1FUYB 1N5LA 1UODA 1ZIPA 3ROQA 3UM9A 4OD0A 4OUDA 2R65A 1ZRNA 2RH5A 3JSXA 4KQ9A 3RU9A 1ABFA 3F90A 5KCMA 1I0ZA 1M6VA 1UK7A 2DX7A 3BL5A 3INTA 1Z2AA 5SICE 2NAPA 1UFKA 1MOSA 1G5PA 4OJTA 3EXHC 3IBYA 2WJPA 3AI7A 3FOFC 3VR2D 5FOWA 2OSVA 2YW9A 3RC2A 1UOPA 2HRQA 3QKSA 1NSYA 4GOLD 4MS3B 1KQ3A 1G8HA 3FMFA 2WYIA 4MQBA 3ICCA 1JWBB 4DTIA 2ZRPA 1R64A 1JEEA 3ZKWB 3RYHB 3OLZA 4QNRA 4LV6A 1NVAA 5LOVB 2VRCD 3FCOA 3BF8A 3HDYA 3E9ZA 3ZCUA 4EY3A 1N4DA 4AUEA 1AURA 4QOHA 1BKYA 1H2RS 4DG8A 1DTWA 2UUOA 4X3PA 5ARBA 2XOKA 3GV0A 1X19A 3WMEA 4PCLA 3BXXA 4D2IA 4YX9A 4Z49A 1MW9X 1SBTA 1KYQA 2VR1A 4KQGA 4WBXC 5DGTA 9MHTA 4Q82A 1VHLA 1J8FA 4FYPA 2HK6A 2Q5QA 3I2FA 5KWVA 3DKVA 3CIOA 3NOOA 5F3WB 2PZKA 3H84A 4IF4A 1B8OA 2ECPA 3BMCB 3DR5A 4LQCA 4R98A 1W0KA 5I8WA 3HK2A 2C7QA 3OHPA 3RADC 1FRNA 3M49A 1SUDA 2W2MA 2B6HA 1DUVG 1PZEA 5FJIA 3TTYA 5B2FA 1Y6GA 1PJ4A 1MDFA 2IIBA 4IO1A 3PZBA 4WNAA 621PA 4DV2B 1WU8A 3PWZA 3JR7A 1MQ9A 2OQRA 2PRKA 4HXFB 4YRDA 5FA6A 2DLNA 3KOMA 1X3LA 5EXXA 4HNVA 4GC5A 3B2EA 3NRCA 4OLBA 4B6GA 2XEXA 3UK1A 5HOEA 2BJVA 1KO5A 4PWYA 1TEZA 3VOBA 1G20B 1UKBA 3P20A 5AR1A 3VR0A 4C4ZA 4AMYA 4DDHA 4FZRA 3S3TA 1P0FA 4Z7QB 4DDUA 4JUCA 3URMA 2A1TR 4LMBA 3M83A 1O9HA 1QLWA 3AUTA 3P9PA 4ALMA 3S1AB 1C29B 1J0CA 5CNIA 3Q15C 3BWDD 2KBEA 1B3BA 1L7EA 1UMBB 4URUR 5JPCA 4ZO7A 4XPIA 1Z0ZA 3T5GA 3WGLA 4YRCA 5E38A 2NO1A 4PXAA 2UZAA 2RHGB 2Y93A 4UBLA 1R4AA 3NALA 2V1UA 4YAKA 2N9UA 2R6JA 1KMIY 5KTTA 2MR5A 3L7AA 1AOXA 1AS3A 3HXQA 2J3KA 2YXBA 3R7SA 3FZEA 1WVIA 4TSFD 2V6GA 2RHMA 3BE5A 1W4RA 4JA2A 5LQJA 3DMGA 3BQNB 2YJZA 2O2DA 3M89A 1VE5A 1ZR2A 1UOEA 2HLDA 3QF4A 3VTZA 4BYGA 1OH7A 2QENA