2FKDA

Crystal structure of the c-terminal domain of bacteriophage 186 repressor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
110
structure length
110
Chain Sequence
SDAKRIEGFTLSEEILKSDKQLSVDAQFFTKPLTDGMAIRSEGKIYFVDKQASLSDGLWLVDIEGAISIRELTKLPGRKLHVAGGKVPFECGIDDIKTLGRVVGVYSEVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of cooperative regulation at an alternate genetic switch.
pubmed doi rcsb
source organism Enterobacteria phage 186
molecule tags Transcription regulator
molecule keywords Repressor protein CI
total genus 16
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2006-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16452 Phage_CI_C Bacteriophage CI repressor C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 2fkdA00
3K2ZA 2HO0A 1JHFA 1KN9A 1AY9A 1JHCA 3IIQA 1JHHA 2FKDA 1KCAA 4N31A 3JSOA 4K8WA 1JHEA 3JSPA 3BDNA 1T7DA 1B12A 2HNFA 4ME8A 2FJRA 3S04A 4NV4A 1UMUA 1F39A 1I4VA
chains in the Genus database with same CATH superfamily
3K2ZA 2HO0A 1JHFA 1KN9A 1AY9A 1JHCA 3IIQA 1JHHA 2FKDA 1KCAA 4N31A 3JSOA 4K8WA 1JHEA 3JSPA 3BDNA 1T7DA 1B12A 2HNFA 4ME8A 2FJRA 3S04A 4NV4A 1UMUA 1F39A 1I4VA
chains in the Genus database with same CATH topology
3K2ZA 2HO0A 1JHFA 1KN9A 1AY9A 1JHCA 3IIQA 1JHHA 2FKDA 1KCAA 4N31A 3JSOA 4K8WA 1JHEA 3JSPA 3BDNA 1T7DA 1B12A 2HNFA 4ME8A 2FJRA 3S04A 4NV4A 1UMUA 1F39A 1I4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K2Z A;  2HO0 A;  1JHF A;  1KN9 A;  1AY9 A;  1JHC A;  3IIQ A;  1JHH A;  2FKD A;  1KCA A;  4N31 A;  3JSO A;  4K8W A;  1JHE A;  3JSP A;  3BDN A;  1T7D A;  1B12 A;  2HNF A;  4ME8 A;  2FJR A;  3S04 A;  4NV4 A;  1UMU A;  1F39 A;  1I4V A; 
#chains in the Genus database with same CATH topology
 3K2Z A;  2HO0 A;  1JHF A;  1KN9 A;  1AY9 A;  1JHC A;  3IIQ A;  1JHH A;  2FKD A;  1KCA A;  4N31 A;  3JSO A;  4K8W A;  1JHE A;  3JSP A;  3BDN A;  1T7D A;  1B12 A;  2HNF A;  4ME8 A;  2FJR A;  3S04 A;  4NV4 A;  1UMU A;  1F39 A;  1I4V A; 
#chains in the Genus database with same CATH homology
 3K2Z A;  2HO0 A;  1JHF A;  1KN9 A;  1AY9 A;  1JHC A;  3IIQ A;  1JHH A;  2FKD A;  1KCA A;  4N31 A;  3JSO A;  4K8W A;  1JHE A;  3JSP A;  3BDN A;  1T7D A;  1B12 A;  2HNF A;  4ME8 A;  2FJR A;  3S04 A;  4NV4 A;  1UMU A;  1F39 A;  1I4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...