2FKEA

Fk-506-binding protein: three-dimensional structure of the complex with the antagonist l-685,818
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FK-506-binding protein: three-dimensional structure of the complex with the antagonist L-685,818.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
molecule keywords FK506 BINDING PROTEIN
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2fkeA00
1FKSA 1YATA 3PRBA 4JFKA 3O5PA 5HTGA 4TW6A 4DIPA 4DRQA 3NTPA 4GGQA 3TCZA 4LAVA 5HW6A 1B6CA 2MNTA 2KI3A 4IPXA 5DIVA 5HKGA 1FJDA 2DG4A 2XP3A 4MGVA 4G2PA 5HUAA 3GPKA 4DRIA 1W26A 2XP5A 3UF8A 2PBCA 2PPOA 4FN2A 3UQAA 4JYSA 1QZ2A 4J4OA 2XP6A 4IQ2A 3KAFA 4LAXA 2KFWA 1JVWA 3O5JA 4GIVA 2ZQSA 3JYMA 4ODLA 4DRPA 1EQ3A 4W9PA 4JFJA 1FKIA 5HWCA 4ODNA 4ODMA 1FD9A 2OFNA 5D75A 3RGCA 1ZK6A 2VCDA 3O5DA 2ZQTA 2XP9A 3KCEA 2RUQA 4DRKA 5B8IC 2MLYA 3FAPA 3KABA 5DITA 5J6EA 5GPGA 2M1IA 4FAPA 1EYMA 2ZQVA 4J4NA 1Q1CA 1J4RA 4DROA 1D7IA 2K8IA 1JNTA 1J6YA 2RUCA 2Q5AA 3PA7A 3WH0A 1FKGA 1C9HA 1Y0OA 2F2DA 2F4EA 2KGJA 2F21A 2RQSA 3B7XA 3KZ7A 3O5KA 2XPBA 2FKEA 4U85A 5DIUA 1FKRA 2ZR5A 3UI4A 3H9RB 3IKDA 1FKHA 4W9QA 1PBKA 4ITZA 4ODQA 1F8AB 5HWBA 3O5IA 2PPPA 1QPLA 2LJ4A 2PV1A 2ITKA 2PV2A 1F40A 1A7XA 2XPAA 4TW8A 1FKBA 3KAIA 1M5YA 3UQIA 1HXVA 1FKKA 2N87A 2AWGA 3KADA 2FAPA 1U79A 2MLZA 2LPVA 1D7JA 4G50A 4JFLA 3VAWA 3O5MA 2IF4A 3UI5A 4BF8A 1NMWA 4IQCA 5BXJA 3NRKA 2KO7A 2KR7A 4U84A 3O5EA 4DZ2A 1N1AA 5HT1A 3JYJA 4TX0A 3JXVA 1FAPA 1FKLA 3KAHA 2ZR4A 3O5FA 4W9OA 4ODKA 1D7HA 3I6CA 2VN1A 5HW7A 3EY6A 2Y78A 4QIBA 1ROTA 1PINA 1QPFA 1Q6HA 4U86A 3TDBA 2M08A 3LUOA 4ODPA 1T11A 4QT2A 1L1PA 4JFMA 3UI6A 4C02B 2DG9A 2XP7A 3O5OA 4LAWA 4TYOA 1KT0A 1D6OA 1KT1A 2XP8A 3MDYB 3ODKA 2LKNA 2RSEA 3O5GA 4DRJA 1BKFA 3OOBA 2UZ5A 3O5QA 2ZQUA 4O2TA 2LGOA 3O5LA 1FKFA 4DRHA 2MPHA 2DG3A 1J4HA 3NI6A 3RFWA 1J4IA 4DH0A 4TNSA 4NNRA 2ZR6A 3CGNA 2MLXA 2M2AA 3TC5A 2PPNA 5I98A 1TCOC 1YW5A 1FKTA 2RURA 2L2SA 3CGMA 1ZCNA 2PV3A 2XP4A 3IKGA 3KAGA 2RUDA 3PRDA 4N19A 1ROUA 1Q6IA 4ODOA 4R0XA 2JZVA 1R9HA 2KE0A 4DRMA 3IK8A 2MF9A 4LAYA 1FKDA 1NSGA 3KACA 1JNSA 4JFIA 1P5QA 2D9FA 1BL4A 1NMVA 4DT4A 4DZ3A 4DRNA 1FKJA 1Q6UA 4ODRA 4QT3A 4TW7A 3O5RA 3IHZA 5HW8A 3UQBA 4MSPA
chains in the Genus database with same CATH superfamily
1NH6A 3PRBA 4JFKA 1ZBVA 5DF0A 5GPRA 3NTPA 1JNDA 3TCZA 1FJDA 4MGVA 1E44A 4ZS6A 3ARUA 2PN0A 2G41A 1O6IA 2XP6A 3KAFA 4WKFA 4JFJA 1JNEA 1FD9A 1ZK6A 2ZQTA 4MPKA 5J6EA 1IX5A 2M1IA 1GPFA 1J4RA 4DROA 1ZL1A 5GQBA 1FKRA 2RQSA 2F23A 2QF8A 3UI4A 3IKDA 2P4VA 1FKHA 1PBKA 3O5IA 2PPPA 4NSBA 2LJ4A 1HXVA 1U79A 2MLZA 3VAWA 4JFLA 3NRKA 2KO7A 4KR0B 3O5EA 2A3AA 3JXVA 1FKLA 2EULA 4QIBA 4AY1A 4WK9A 1Q6HA 4U86A 3TDBA 2DT2A 3WL1A 2XP7A 4LAWA 3ALFA 1ZBKA 3CHDA 2ZQUA 4O2TA 1LL4A 2DG3A 1J4IA 3CGNA 2MLXA 2O92A 1YW5A 2A3CA 3PRDA 3KAGA 3PRAA 4DRMA 3ARXA 3IK8A 4ZPVR 2G8ZA 3WKZA 1BL4A 1NMVA 4DT4A 1FKJA 4ODRA 4QT3A 4TW7A 5HW8A 3UQBA 1LG1A 3O5PA 5HTGA 3EIPA 4DRQA 3B9EA 1B6CA 2MNTA 2KI3A 2B5UB 4IPXA 5DIVA 2DG4A 3GPKA 4DRIA 2ESCA 3UF8A 4FN2A 5DO2A 1LJYA 2DSVA 3ARPA 3UQAA 1QZ2A 4J4OA 1NWSA 4IQ2A 1JVWA 3ARRA 3O5JA 4GIVA 4ODLA 1LL7A 4ZPWR 5D75A 1WNOA 3O5DA 4Z2IA 1E6NA 1HKIA 4DRKA 3KABA 2ZQVA 3WD2A 4MNLA 1UR8A 1Y0OA 3O5KA 5HW6A 2FKEA 1NWUA 5HWBA 4ODQA 4QZVB 4Z2GA 1QPLA 2ITKA 2PV2A 4TW8A 1FKBA 1LL6A 3KADA 4G50A 4XAKA 3O5MA 1X6NA 1SYTA 1W9PA 4DWSD 1NMWA 4IQCA 4KQZA 4DZ2A 3JYJA 1FAPA 1EIBA 1E6RA 3B9AA 3CHFA 3O5FA 4W9OA 4ODKA 3B9DA 4Z2JA 2VN1A 3CH9A 1HJWA 2Y78A 1FFRA 1LQ0A 3WIJA 1EDQA 2DPEA 3LUOA 1T11A 4QT2A 4Z2LA 3ARTA 3UI6A 4C02B 2DT3A 3WD3A 1K9TA 1RD6A 1KT1A 2RSEA 1GUVA 1FFQA 2UZ5A 3O5QA 3ARSA 4S3KA 3ARYA 1W9VA 1KFWA 1OGGA 1ZBCA 4DH0A 2A3BA 3QOKA 4TNSA 5I98A 1TCOC 1FKTA 4ZPTR 1X6LA 1ZCNA 4N19A 2RUDA 1Q6IA 1E15A 2KE0A 2MF9A 1FKDA 4URIA 1EHNA 4DRNA 3IHZA 3ARQA 3AS0A 4P8VA 1FKSA 1GOIA 1VF8A 4TW6A 1ZBWA 4GGQA 1GRJA 1OGBA 4G2PA 2XP5A 2PBCA 2B31A 1JCHB 1W1TA 3B8SA 4LAXA 2KFWA 1W9UA 2ZQSA 1EQ3A 4W9PA 3OA5A 1FKIA 2O9OA 3ARVA 4ODNA 4DWSA 4NZCA 3ALGA 4PTMA 4MTVA 2MLYA 3FAPA 5GPGA 1D7IA 2K8IA 1JNTA 3PA7A 3FXYA 1C9HA 2F4EA 3KZ7A 3B7XA 2KGJA 2F21A 1ITXA 2ETNA 3CHEA 1ZU8A 2ZR5A 4WIWA 3WD0A 4ITZA 1D2KA 1M5YA 2WM0A 3UQIA 2N87A 2AWGA 2FAPA 5DEZA 2OLHA 1D7JA 2DSZA 1W1VA 4WKHA 4DWSB 2IF4A 3UI5A 4BF8A 4Z2KA 1HKKA 4Q7NA 3WL0A 2WLZA 5HT1A 4TX0A 3G6MA 3AQUA 1LG2A 2ZR4A 3FY1A 1D7HA 3I6CA 3EY6A 4WJXA 1W1PA 3RM4A 1ROTA 1HJVA 3PR9A 1L1PA 4WKAA 3RMEA 4JFMA 1E6PA 2DG9A 3O5OA 4MNMA 1KT0A 1ZB5A 2PI6A 4DRJA 3O5GA 2AOSA 3RM9A 4P8WA 1HKJA 2LGOA 1FKFA 3ARWA 4DWSC 2MPHA 4IT4A 1J4HA 1NWRA 3RFWA 3WD4A 4NNRA 3TC5A 3AROA 2RURA 3CGMA 4DRPA 2XP4A 3RM8A 1ROUA 2YBUA 5JH8A 4R0XA 3G6LA 1XRVA 1WAWA 3KACA 4W5UA 3WD1A 2D9FA 3O5RA 1YATA 1WB0A 4DIPA 5HBFA 3BXWA 4LAVA 1E9LA 5HKGA 2XP3A 5HUAA 1TFVA 1W26A 3GTYX 2PPOA 1HKMA 3BMBA 3CHCA 4JYSA 3JYMA 1OWQA 2WK2A 3CZ8A 5HWCA 4ODMA 2OFNA 4MNKA 4P8UA 3RGCA 2VCDA 2DT1A 4S3JA 3AS3A 2XP9A 4LGXA 3KCEA 2RUQA 4IT6A 5B8IC 5DITA 4UDMA 4FAPA 1EYMA 4J4NA 1Q1CA 4MAVA 4R5EA 2IUZA 1J6YA 2RUCA 1H0GA 2Q5AA 3WH0A 1FKGA 2F2DA 5DIUA 2DT0A 3WQVA 4U85A 2XPBA 2A3EA 3H9RB 4Z2HA 4W9QA 3GU0A 4ML4A 1F8AB 4L3NA 4L72B 4HBOA 1F40A 2PV1A 1A7XA 2XPAA 1H0IA 3KAIA 3W4RA 1FKKA 2YBTA 2LPVA 2FDMA 1E6ZA 3AS2A 5BXJA 2KR7A 4Q22A 1N1AA 1HJXA 2WLYA 3KAHA 4HARA 5HW7A 1NWTA 1SR0A 4P8XA 1PINA 1QPFA 2M08A 4ODPA 1W1YA 1CTNA 1UR9A 4TYOA 1D6OA 2XP8A 3MDYB 3ODKA 2LKNA 3AS1A 4MNJA 1BKFA 3OOBA 1XHGA 3WQWA 3O5LA 2DSUA 4DRHA 3ARZA 3NI6A 2ZR6A 2M2AA 2PPNA 3IKGA 4U84A 2L2SA 2PV3A 2DSWA 4ODOA 2JZVA 1R9HA 4LAYA 1NSGA 1JNSA 4JFIA 1P5QA 4HBEA 4DZ3A 1Q6UA 4MSPA
chains in the Genus database with same CATH topology
1NH6A 3PRBA 4JFKA 1ZBVA 5DF0A 5GPRA 3NTPA 1JNDA 3TCZA 1FJDA 4MGVA 4ZS6A 3ARUA 2G41A 1O6IA 2XP6A 3KAFA 4WKFA 4JFJA 1JNEA 1FD9A 1ZK6A 2ZQTA 4MPKA 5J6EA 1IX5A 2M1IA 1GPFA 1J4RA 4DROA 1ZL1A 5GQBA 1FKRA 2RQSA 2QF8A 3UI4A 3IKDA 1FKHA 1PBKA 3O5IA 2PPPA 4NSBA 2LJ4A 1HXVA 1U79A 2MLZA 3VAWA 4JFLA 3NRKA 2KO7A 4KR0B 3O5EA 2A3AA 3JXVA 1FKLA 4QIBA 4AY1A 4WK9A 1Q6HA 4U86A 3TDBA 2DT2A 3WL1A 2XP7A 4LAWA 3ALFA 1ZBKA 3CHDA 2ZQUA 4O2TA 1LL4A 2DG3A 1J4IA 3CGNA 2MLXA 2O92A 1YW5A 2A3CA 3PRDA 3KAGA 3PRAA 4DRMA 3ARXA 3IK8A 4ZPVR 2G8ZA 3WKZA 1BL4A 1NMVA 4DT4A 1FKJA 4ODRA 4QT3A 4TW7A 5HW8A 3UQBA 1LG1A 3O5PA 5HTGA 4DRQA 3B9EA 1B6CA 2MNTA 2KI3A 4IPXA 5DIVA 2DG4A 3GPKA 4DRIA 2ESCA 3UF8A 4FN2A 5DO2A 1LJYA 2DSVA 3ARPA 3UQAA 1QZ2A 4J4OA 1NWSA 4IQ2A 1JVWA 3ARRA 3O5JA 4GIVA 4ODLA 1LL7A 4ZPWR 5D75A 1WNOA 3O5DA 4Z2IA 1E6NA 1HKIA 4DRKA 3KABA 2ZQVA 3WD2A 4MNLA 1UR8A 1Y0OA 3O5KA 5HW6A 2FKEA 1NWUA 5HWBA 4ODQA 4QZVB 4Z2GA 1QPLA 2ITKA 2PV2A 4TW8A 1FKBA 1LL6A 3KADA 4G50A 4XAKA 3O5MA 1X6NA 1SYTA 1W9PA 4DWSD 1NMWA 4IQCA 4KQZA 4DZ2A 3JYJA 1FAPA 1EIBA 1E6RA 3B9AA 3CHFA 3O5FA 4W9OA 4ODKA 3B9DA 4Z2JA 2VN1A 3CH9A 1HJWA 2Y78A 1FFRA 1LQ0A 3WIJA 1EDQA 2DPEA 3LUOA 1T11A 4QT2A 4Z2LA 3ARTA 3UI6A 4C02B 2DT3A 3WD3A 1K9TA 1RD6A 1KT1A 2RSEA 1GUVA 1FFQA 2UZ5A 3O5QA 3ARSA 4S3KA 3ARYA 1W9VA 1KFWA 1OGGA 1ZBCA 4DH0A 2A3BA 3QOKA 4TNSA 5I98A 1TCOC 1FKTA 4ZPTR 1X6LA 1ZCNA 4N19A 2RUDA 1Q6IA 1E15A 2KE0A 2MF9A 1FKDA 4URIA 1EHNA 4DRNA 3IHZA 3ARQA 3AS0A 4P8VA 1FKSA 1GOIA 1VF8A 4TW6A 1ZBWA 4GGQA 1OGBA 4G2PA 2XP5A 2PBCA 2B31A 1W1TA 3B8SA 4LAXA 2KFWA 1W9UA 2ZQSA 1EQ3A 4W9PA 3OA5A 1FKIA 2O9OA 3ARVA 4ODNA 4DWSA 4NZCA 3ALGA 4PTMA 4MTVA 2MLYA 3FAPA 5GPGA 1D7IA 2K8IA 1JNTA 3PA7A 3FXYA 1C9HA 2F4EA 3KZ7A 2KGJA 3B7XA 2F21A 1ITXA 3CHEA 1ZU8A 2ZR5A 4WIWA 3WD0A 4ITZA 1D2KA 1M5YA 2WM0A 3UQIA 2N87A 2AWGA 2FAPA 5DEZA 2OLHA 1D7JA 2DSZA 1W1VA 4WKHA 4DWSB 2IF4A 3UI5A 4BF8A 4Z2KA 1HKKA 4Q7NA 3WL0A 2WLZA 5HT1A 4TX0A 3G6MA 3AQUA 1LG2A 2ZR4A 3FY1A 1D7HA 3I6CA 3EY6A 4WJXA 1W1PA 3RM4A 1ROTA 1HJVA 3PR9A 1L1PA 4WKAA 3RMEA 4JFMA 1E6PA 2DG9A 3O5OA 4MNMA 1KT0A 1ZB5A 2PI6A 4DRJA 3O5GA 2AOSA 3RM9A 4P8WA 1HKJA 2LGOA 1FKFA 3ARWA 4DWSC 2MPHA 4IT4A 1J4HA 1NWRA 3RFWA 3WD4A 4NNRA 3TC5A 3AROA 2RURA 3CGMA 4DRPA 2XP4A 3RM8A 1ROUA 2YBUA 5JH8A 4R0XA 3G6LA 1XRVA 1WAWA 3KACA 4W5UA 3WD1A 2D9FA 3O5RA 1YATA 1WB0A 4DIPA 5HBFA 3BXWA 4LAVA 1E9LA 5HKGA 2XP3A 5HUAA 1TFVA 1W26A 2PPOA 1HKMA 3CHCA 4JYSA 3JYMA 1OWQA 2WK2A 3CZ8A 5HWCA 4ODMA 2OFNA 4MNKA 4P8UA 3RGCA 2VCDA 2DT1A 4S3JA 3AS3A 2XP9A 4LGXA 3KCEA 2RUQA 4IT6A 5B8IC 5DITA 4FAPA 1EYMA 4J4NA 1Q1CA 4MAVA 4R5EA 2IUZA 1J6YA 2RUCA 1H0GA 2Q5AA 3WH0A 1FKGA 2F2DA 5DIUA 2DT0A 3WQVA 4U85A 2XPBA 2A3EA 3H9RB 4Z2HA 4W9QA 4ML4A 1F8AB 4L3NA 4L72B 4HBOA 1F40A 2PV1A 1A7XA 2XPAA 1H0IA 3KAIA 3W4RA 1FKKA 2YBTA 2LPVA 2FDMA 1E6ZA 3AS2A 5BXJA 2KR7A 4Q22A 1N1AA 1HJXA 2WLYA 3KAHA 4HARA 5HW7A 1NWTA 1SR0A 4P8XA 1PINA 1QPFA 2M08A 4ODPA 1W1YA 1CTNA 1UR9A 4TYOA 1D6OA 2XP8A 3MDYB 3ODKA 2LKNA 3AS1A 4MNJA 1BKFA 3OOBA 1XHGA 3WQWA 3O5LA 2DSUA 4DRHA 3ARZA 3NI6A 2ZR6A 2M2AA 2PPNA 3IKGA 4U84A 2L2SA 2PV3A 2DSWA 4ODOA 2JZVA 1R9HA 4LAYA 1NSGA 1JNSA 4JFIA 1P5QA 4HBEA 4DZ3A 1Q6UA 4MSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKS A;  1YAT A;  3PRB A;  4JFK A;  3O5P A;  5HTG A;  4TW6 A;  4DIP A;  4DRQ A;  3NTP A;  4GGQ A;  3TCZ A;  4LAV A;  5HW6 A;  1B6C A;  2MNT A;  2KI3 A;  4IPX A;  5DIV A;  5HKG A;  1FJD A;  2DG4 A;  2XP3 A;  4MGV A;  4G2P A;  5HUA A;  3GPK A;  4DRI A;  1W26 A;  2XP5 A;  3UF8 A;  2PBC A;  2PPO A;  4FN2 A;  3UQA A;  4JYS A;  1QZ2 A;  4J4O A;  2XP6 A;  4IQ2 A;  3KAF A;  4LAX A;  2KFW A;  1JVW A;  3O5J A;  4GIV A;  2ZQS A;  3JYM A;  4ODL A;  4DRP A;  1EQ3 A;  4W9P A;  4JFJ A;  1FKI A;  5HWC A;  4ODN A;  4ODM A;  1FD9 A;  2OFN A;  5D75 A;  3RGC A;  1ZK6 A;  2VCD A;  3O5D A;  2ZQT A;  2XP9 A;  3KCE A;  2RUQ A;  4DRK A;  5B8I C;  2MLY A;  3FAP A;  3KAB A;  5DIT A;  5J6E A;  5GPG A;  2M1I A;  4FAP A;  1EYM A;  2ZQV A;  4J4N A;  1Q1C A;  1J4R A;  4DRO A;  1D7I A;  2K8I A;  1JNT A;  1J6Y A;  2RUC A;  2Q5A A;  3PA7 A;  3WH0 A;  1FKG A;  1C9H A;  1Y0O A;  2F2D A;  2F4E A;  2KGJ A;  2F21 A;  2RQS A;  3B7X A;  3KZ7 A;  3O5K A;  2XPB A;  2FKE A;  4U85 A;  5DIU A;  1FKR A;  2ZR5 A;  3UI4 A;  3H9R B;  3IKD A;  1FKH A;  4W9Q A;  1PBK A;  4ITZ A;  4ODQ A;  1F8A B;  5HWB A;  3O5I A;  2PPP A;  1QPL A;  2LJ4 A;  2PV1 A;  2ITK A;  2PV2 A;  1F40 A;  1A7X A;  2XPA A;  4TW8 A;  1FKB A;  3KAI A;  1M5Y A;  3UQI A;  1HXV A;  1FKK A;  2N87 A;  2AWG A;  3KAD A;  2FAP A;  1U79 A;  2MLZ A;  2LPV A;  1D7J A;  4G50 A;  4JFL A;  3VAW A;  3O5M A;  2IF4 A;  3UI5 A;  4BF8 A;  1NMW A;  4IQC A;  5BXJ A;  3NRK A;  2KO7 A;  2KR7 A;  4U84 A;  3O5E A;  4DZ2 A;  1N1A A;  5HT1 A;  3JYJ A;  4TX0 A;  3JXV A;  1FAP A;  1FKL A;  3KAH A;  2ZR4 A;  3O5F A;  4W9O A;  4ODK A;  1D7H A;  3I6C A;  2VN1 A;  5HW7 A;  3EY6 A;  2Y78 A;  4QIB A;  1ROT A;  1PIN A;  1QPF A;  1Q6H A;  4U86 A;  3TDB A;  2M08 A;  3LUO A;  4ODP A;  1T11 A;  4QT2 A;  1L1P A;  4JFM A;  3UI6 A;  4C02 B;  2DG9 A;  2XP7 A;  3O5O A;  4LAW A;  4TYO A;  1KT0 A;  1D6O A;  1KT1 A;  2XP8 A;  3MDY B;  3ODK A;  2LKN A;  2RSE A;  3O5G A;  4DRJ A;  1BKF A;  3OOB A;  2UZ5 A;  3O5Q A;  2ZQU A;  4O2T A;  2LGO A;  3O5L A;  1FKF A;  4DRH A;  2MPH A;  2DG3 A;  1J4H A;  3NI6 A;  3RFW A;  1J4I A;  4DH0 A;  4TNS A;  4NNR A;  2ZR6 A;  3CGN A;  2MLX A;  2M2A A;  3TC5 A;  2PPN A;  5I98 A;  1TCO C;  1YW5 A;  1FKT A;  2RUR A;  2L2S A;  3CGM A;  1ZCN A;  2PV3 A;  2XP4 A;  3IKG A;  3KAG A;  2RUD A;  3PRD A;  4N19 A;  1ROU A;  1Q6I A;  4ODO A;  4R0X A;  2JZV A;  1R9H A;  2KE0 A;  4DRM A;  3IK8 A;  2MF9 A;  4LAY A;  1FKD A;  1NSG A;  3KAC A;  1JNS A;  4JFI A;  1P5Q A;  2D9F A;  1BL4 A;  1NMV A;  4DT4 A;  4DZ3 A;  4DRN A;  1FKJ A;  1Q6U A;  4ODR A;  4QT3 A;  4TW7 A;  3O5R A;  3IHZ A;  5HW8 A;  3UQB A;  4MSP A; 
#chains in the Genus database with same CATH topology
 1NH6 A;  3PRB A;  4JFK A;  1ZBV A;  5DF0 A;  5GPR A;  3NTP A;  1JND A;  3TCZ A;  1FJD A;  4MGV A;  1E44 A;  4ZS6 A;  3ARU A;  2PN0 A;  2G41 A;  1O6I A;  2XP6 A;  3KAF A;  4WKF A;  4JFJ A;  1JNE A;  1FD9 A;  1ZK6 A;  2ZQT A;  4MPK A;  5J6E A;  1IX5 A;  2M1I A;  1GPF A;  1J4R A;  4DRO A;  1ZL1 A;  5GQB A;  1FKR A;  2RQS A;  2F23 A;  2QF8 A;  3UI4 A;  3IKD A;  2P4V A;  1FKH A;  1PBK A;  3O5I A;  2PPP A;  4NSB A;  2LJ4 A;  1HXV A;  1U79 A;  2MLZ A;  3VAW A;  4JFL A;  3NRK A;  2KO7 A;  4KR0 B;  3O5E A;  2A3A A;  3JXV A;  1FKL A;  2EUL A;  4QIB A;  4AY1 A;  4WK9 A;  1Q6H A;  4U86 A;  3TDB A;  2DT2 A;  3WL1 A;  2XP7 A;  4LAW A;  3ALF A;  1ZBK A;  3CHD A;  2ZQU A;  4O2T A;  1LL4 A;  2DG3 A;  1J4I A;  3CGN A;  2MLX A;  2O92 A;  1YW5 A;  2A3C A;  3PRD A;  3KAG A;  3PRA A;  4DRM A;  3ARX A;  3IK8 A;  4ZPV R;  2G8Z A;  3WKZ A;  1BL4 A;  1NMV A;  4DT4 A;  1FKJ A;  4ODR A;  4QT3 A;  4TW7 A;  5HW8 A;  3UQB A;  1LG1 A;  3O5P A;  5HTG A;  3EIP A;  4DRQ A;  3B9E A;  1B6C A;  2MNT A;  2KI3 A;  2B5U B;  4IPX A;  5DIV A;  2DG4 A;  3GPK A;  4DRI A;  2ESC A;  3UF8 A;  4FN2 A;  5DO2 A;  1LJY A;  2DSV A;  3ARP A;  3UQA A;  1QZ2 A;  4J4O A;  1NWS A;  4IQ2 A;  1JVW A;  3ARR A;  3O5J A;  4GIV A;  4ODL A;  1LL7 A;  4ZPW R;  5D75 A;  1WNO A;  3O5D A;  4Z2I A;  1E6N A;  1HKI A;  4DRK A;  3KAB A;  2ZQV A;  3WD2 A;  4MNL A;  1UR8 A;  1Y0O A;  3O5K A;  5HW6 A;  2FKE A;  1NWU A;  5HWB A;  4ODQ A;  4QZV B;  4Z2G A;  1QPL A;  2ITK A;  2PV2 A;  4TW8 A;  1FKB A;  1LL6 A;  3KAD A;  4G50 A;  4XAK A;  3O5M A;  1X6N A;  1SYT A;  1W9P A;  4DWS D;  1NMW A;  4IQC A;  4KQZ A;  4DZ2 A;  3JYJ A;  1FAP A;  1EIB A;  1E6R A;  3B9A A;  3CHF A;  3O5F A;  4W9O A;  4ODK A;  3B9D A;  4Z2J A;  2VN1 A;  3CH9 A;  1HJW A;  2Y78 A;  1FFR A;  1LQ0 A;  3WIJ A;  1EDQ A;  2DPE A;  3LUO A;  1T11 A;  4QT2 A;  4Z2L A;  3ART A;  3UI6 A;  4C02 B;  2DT3 A;  3WD3 A;  1K9T A;  1RD6 A;  1KT1 A;  2RSE A;  1GUV A;  1FFQ A;  2UZ5 A;  3O5Q A;  3ARS A;  4S3K A;  3ARY A;  1W9V A;  1KFW A;  1OGG A;  1ZBC A;  4DH0 A;  2A3B A;  3QOK A;  4TNS A;  5I98 A;  1TCO C;  1FKT A;  4ZPT R;  1X6L A;  1ZCN A;  4N19 A;  2RUD A;  1Q6I A;  1E15 A;  2KE0 A;  2MF9 A;  1FKD A;  4URI A;  1EHN A;  4DRN A;  3IHZ A;  3ARQ A;  3AS0 A;  4P8V A;  1FKS A;  1GOI A;  1VF8 A;  4TW6 A;  1ZBW A;  4GGQ A;  1GRJ A;  1OGB A;  4G2P A;  2XP5 A;  2PBC A;  2B31 A;  1JCH B;  1W1T A;  3B8S A;  4LAX A;  2KFW A;  1W9U A;  2ZQS A;  1EQ3 A;  4W9P A;  3OA5 A;  1FKI A;  2O9O A;  3ARV A;  4ODN A;  4DWS A;  4NZC A;  3ALG A;  4PTM A;  4MTV A;  2MLY A;  3FAP A;  5GPG A;  1D7I A;  2K8I A;  1JNT A;  3PA7 A;  3FXY A;  1C9H A;  2F4E A;  3KZ7 A;  3B7X A;  2KGJ A;  2F21 A;  1ITX A;  2ETN A;  3CHE A;  1ZU8 A;  2ZR5 A;  4WIW A;  3WD0 A;  4ITZ A;  1D2K A;  1M5Y A;  2WM0 A;  3UQI A;  2N87 A;  2AWG A;  2FAP A;  5DEZ A;  2OLH A;  1D7J A;  2DSZ A;  1W1V A;  4WKH A;  4DWS B;  2IF4 A;  3UI5 A;  4BF8 A;  4Z2K A;  1HKK A;  4Q7N A;  3WL0 A;  2WLZ A;  5HT1 A;  4TX0 A;  3G6M A;  3AQU A;  1LG2 A;  2ZR4 A;  3FY1 A;  1D7H A;  3I6C A;  3EY6 A;  4WJX A;  1W1P A;  3RM4 A;  1ROT A;  1HJV A;  3PR9 A;  1L1P A;  4WKA A;  3RME A;  4JFM A;  1E6P A;  2DG9 A;  3O5O A;  4MNM A;  1KT0 A;  1ZB5 A;  2PI6 A;  4DRJ A;  3O5G A;  2AOS A;  3RM9 A;  4P8W A;  1HKJ A;  2LGO A;  1FKF A;  3ARW A;  4DWS C;  2MPH A;  4IT4 A;  1J4H A;  1NWR A;  3RFW A;  3WD4 A;  4NNR A;  3TC5 A;  3ARO A;  2RUR A;  3CGM A;  4DRP A;  2XP4 A;  3RM8 A;  1ROU A;  2YBU A;  5JH8 A;  4R0X A;  3G6L A;  1XRV A;  1WAW A;  3KAC A;  4W5U A;  3WD1 A;  2D9F A;  3O5R A;  1YAT A;  1WB0 A;  4DIP A;  5HBF A;  3BXW A;  4LAV A;  1E9L A;  5HKG A;  2XP3 A;  5HUA A;  1TFV A;  1W26 A;  3GTY X;  2PPO A;  1HKM A;  3BMB A;  3CHC A;  4JYS A;  3JYM A;  1OWQ A;  2WK2 A;  3CZ8 A;  5HWC A;  4ODM A;  2OFN A;  4MNK A;  4P8U A;  3RGC A;  2VCD A;  2DT1 A;  4S3J A;  3AS3 A;  2XP9 A;  4LGX A;  3KCE A;  2RUQ A;  4IT6 A;  5B8I C;  5DIT A;  4UDM A;  4FAP A;  1EYM A;  4J4N A;  1Q1C A;  4MAV A;  4R5E A;  2IUZ A;  1J6Y A;  2RUC A;  1H0G A;  2Q5A A;  3WH0 A;  1FKG A;  2F2D A;  5DIU A;  2DT0 A;  3WQV A;  4U85 A;  2XPB A;  2A3E A;  3H9R B;  4Z2H A;  4W9Q A;  3GU0 A;  4ML4 A;  1F8A B;  4L3N A;  4L72 B;  4HBO A;  1F40 A;  2PV1 A;  1A7X A;  2XPA A;  1H0I A;  3KAI A;  3W4R A;  1FKK A;  2YBT A;  2LPV A;  2FDM A;  1E6Z A;  3AS2 A;  5BXJ A;  2KR7 A;  4Q22 A;  1N1A A;  1HJX A;  2WLY A;  3KAH A;  4HAR A;  5HW7 A;  1NWT A;  1SR0 A;  4P8X A;  1PIN A;  1QPF A;  2M08 A;  4ODP A;  1W1Y A;  1CTN A;  1UR9 A;  4TYO A;  1D6O A;  2XP8 A;  3MDY B;  3ODK A;  2LKN A;  3AS1 A;  4MNJ A;  1BKF A;  3OOB A;  1XHG A;  3WQW A;  3O5L A;  2DSU A;  4DRH A;  3ARZ A;  3NI6 A;  2ZR6 A;  2M2A A;  2PPN A;  3IKG A;  4U84 A;  2L2S A;  2PV3 A;  2DSW A;  4ODO A;  2JZV A;  1R9H A;  4LAY A;  1NSG A;  1JNS A;  4JFI A;  1P5Q A;  4HBE A;  4DZ3 A;  1Q6U A;  4MSP A; 
#chains in the Genus database with same CATH homology
 1NH6 A;  3PRB A;  4JFK A;  1ZBV A;  5DF0 A;  5GPR A;  3NTP A;  1JND A;  3TCZ A;  1FJD A;  4MGV A;  4ZS6 A;  3ARU A;  2G41 A;  1O6I A;  2XP6 A;  3KAF A;  4WKF A;  4JFJ A;  1JNE A;  1FD9 A;  1ZK6 A;  2ZQT A;  4MPK A;  5J6E A;  1IX5 A;  2M1I A;  1GPF A;  1J4R A;  4DRO A;  1ZL1 A;  5GQB A;  1FKR A;  2RQS A;  2QF8 A;  3UI4 A;  3IKD A;  1FKH A;  1PBK A;  3O5I A;  2PPP A;  4NSB A;  2LJ4 A;  1HXV A;  1U79 A;  2MLZ A;  3VAW A;  4JFL A;  3NRK A;  2KO7 A;  4KR0 B;  3O5E A;  2A3A A;  3JXV A;  1FKL A;  4QIB A;  4AY1 A;  4WK9 A;  1Q6H A;  4U86 A;  3TDB A;  2DT2 A;  3WL1 A;  2XP7 A;  4LAW A;  3ALF A;  1ZBK A;  3CHD A;  2ZQU A;  4O2T A;  1LL4 A;  2DG3 A;  1J4I A;  3CGN A;  2MLX A;  2O92 A;  1YW5 A;  2A3C A;  3PRD A;  3KAG A;  3PRA A;  4DRM A;  3ARX A;  3IK8 A;  4ZPV R;  2G8Z A;  3WKZ A;  1BL4 A;  1NMV A;  4DT4 A;  1FKJ A;  4ODR A;  4QT3 A;  4TW7 A;  5HW8 A;  3UQB A;  1LG1 A;  3O5P A;  5HTG A;  4DRQ A;  3B9E A;  1B6C A;  2MNT A;  2KI3 A;  4IPX A;  5DIV A;  2DG4 A;  3GPK A;  4DRI A;  2ESC A;  3UF8 A;  4FN2 A;  5DO2 A;  1LJY A;  2DSV A;  3ARP A;  3UQA A;  1QZ2 A;  4J4O A;  1NWS A;  4IQ2 A;  1JVW A;  3ARR A;  3O5J A;  4GIV A;  4ODL A;  1LL7 A;  4ZPW R;  5D75 A;  1WNO A;  3O5D A;  4Z2I A;  1E6N A;  1HKI A;  4DRK A;  3KAB A;  2ZQV A;  3WD2 A;  4MNL A;  1UR8 A;  1Y0O A;  3O5K A;  5HW6 A;  2FKE A;  1NWU A;  5HWB A;  4ODQ A;  4QZV B;  4Z2G A;  1QPL A;  2ITK A;  2PV2 A;  4TW8 A;  1FKB A;  1LL6 A;  3KAD A;  4G50 A;  4XAK A;  3O5M A;  1X6N A;  1SYT A;  1W9P A;  4DWS D;  1NMW A;  4IQC A;  4KQZ A;  4DZ2 A;  3JYJ A;  1FAP A;  1EIB A;  1E6R A;  3B9A A;  3CHF A;  3O5F A;  4W9O A;  4ODK A;  3B9D A;  4Z2J A;  2VN1 A;  3CH9 A;  1HJW A;  2Y78 A;  1FFR A;  1LQ0 A;  3WIJ A;  1EDQ A;  2DPE A;  3LUO A;  1T11 A;  4QT2 A;  4Z2L A;  3ART A;  3UI6 A;  4C02 B;  2DT3 A;  3WD3 A;  1K9T A;  1RD6 A;  1KT1 A;  2RSE A;  1GUV A;  1FFQ A;  2UZ5 A;  3O5Q A;  3ARS A;  4S3K A;  3ARY A;  1W9V A;  1KFW A;  1OGG A;  1ZBC A;  4DH0 A;  2A3B A;  3QOK A;  4TNS A;  5I98 A;  1TCO C;  1FKT A;  4ZPT R;  1X6L A;  1ZCN A;  4N19 A;  2RUD A;  1Q6I A;  1E15 A;  2KE0 A;  2MF9 A;  1FKD A;  4URI A;  1EHN A;  4DRN A;  3IHZ A;  3ARQ A;  3AS0 A;  4P8V A;  1FKS A;  1GOI A;  1VF8 A;  4TW6 A;  1ZBW A;  4GGQ A;  1OGB A;  4G2P A;  2XP5 A;  2PBC A;  2B31 A;  1W1T A;  3B8S A;  4LAX A;  2KFW A;  1W9U A;  2ZQS A;  1EQ3 A;  4W9P A;  3OA5 A;  1FKI A;  2O9O A;  3ARV A;  4ODN A;  4DWS A;  4NZC A;  3ALG A;  4PTM A;  4MTV A;  2MLY A;  3FAP A;  5GPG A;  1D7I A;  2K8I A;  1JNT A;  3PA7 A;  3FXY A;  1C9H A;  2F4E A;  3KZ7 A;  2KGJ A;  3B7X A;  2F21 A;  1ITX A;  3CHE A;  1ZU8 A;  2ZR5 A;  4WIW A;  3WD0 A;  4ITZ A;  1D2K A;  1M5Y A;  2WM0 A;  3UQI A;  2N87 A;  2AWG A;  2FAP A;  5DEZ A;  2OLH A;  1D7J A;  2DSZ A;  1W1V A;  4WKH A;  4DWS B;  2IF4 A;  3UI5 A;  4BF8 A;  4Z2K A;  1HKK A;  4Q7N A;  3WL0 A;  2WLZ A;  5HT1 A;  4TX0 A;  3G6M A;  3AQU A;  1LG2 A;  2ZR4 A;  3FY1 A;  1D7H A;  3I6C A;  3EY6 A;  4WJX A;  1W1P A;  3RM4 A;  1ROT A;  1HJV A;  3PR9 A;  1L1P A;  4WKA A;  3RME A;  4JFM A;  1E6P A;  2DG9 A;  3O5O A;  4MNM A;  1KT0 A;  1ZB5 A;  2PI6 A;  4DRJ A;  3O5G A;  2AOS A;  3RM9 A;  4P8W A;  1HKJ A;  2LGO A;  1FKF A;  3ARW A;  4DWS C;  2MPH A;  4IT4 A;  1J4H A;  1NWR A;  3RFW A;  3WD4 A;  4NNR A;  3TC5 A;  3ARO A;  2RUR A;  3CGM A;  4DRP A;  2XP4 A;  3RM8 A;  1ROU A;  2YBU A;  5JH8 A;  4R0X A;  3G6L A;  1XRV A;  1WAW A;  3KAC A;  4W5U A;  3WD1 A;  2D9F A;  3O5R A;  1YAT A;  1WB0 A;  4DIP A;  5HBF A;  3BXW A;  4LAV A;  1E9L A;  5HKG A;  2XP3 A;  5HUA A;  1TFV A;  1W26 A;  2PPO A;  1HKM A;  3CHC A;  4JYS A;  3JYM A;  1OWQ A;  2WK2 A;  3CZ8 A;  5HWC A;  4ODM A;  2OFN A;  4MNK A;  4P8U A;  3RGC A;  2VCD A;  2DT1 A;  4S3J A;  3AS3 A;  2XP9 A;  4LGX A;  3KCE A;  2RUQ A;  4IT6 A;  5B8I C;  5DIT A;  4FAP A;  1EYM A;  4J4N A;  1Q1C A;  4MAV A;  4R5E A;  2IUZ A;  1J6Y A;  2RUC A;  1H0G A;  2Q5A A;  3WH0 A;  1FKG A;  2F2D A;  5DIU A;  2DT0 A;  3WQV A;  4U85 A;  2XPB A;  2A3E A;  3H9R B;  4Z2H A;  4W9Q A;  4ML4 A;  1F8A B;  4L3N A;  4L72 B;  4HBO A;  1F40 A;  2PV1 A;  1A7X A;  2XPA A;  1H0I A;  3KAI A;  3W4R A;  1FKK A;  2YBT A;  2LPV A;  2FDM A;  1E6Z A;  3AS2 A;  5BXJ A;  2KR7 A;  4Q22 A;  1N1A A;  1HJX A;  2WLY A;  3KAH A;  4HAR A;  5HW7 A;  1NWT A;  1SR0 A;  4P8X A;  1PIN A;  1QPF A;  2M08 A;  4ODP A;  1W1Y A;  1CTN A;  1UR9 A;  4TYO A;  1D6O A;  2XP8 A;  3MDY B;  3ODK A;  2LKN A;  3AS1 A;  4MNJ A;  1BKF A;  3OOB A;  1XHG A;  3WQW A;  3O5L A;  2DSU A;  4DRH A;  3ARZ A;  3NI6 A;  2ZR6 A;  2M2A A;  2PPN A;  3IKG A;  4U84 A;  2L2S A;  2PV3 A;  2DSW A;  4ODO A;  2JZV A;  1R9H A;  4LAY A;  1NSG A;  1JNS A;  4JFI A;  1P5Q A;  4HBE A;  4DZ3 A;  1Q6U A;  4MSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...