2FKEA

Fk-506-binding protein: three-dimensional structure of the complex with the antagonist l-685,818
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title FK-506-binding protein: three-dimensional structure of the complex with the antagonist L-685,818.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2fkeA00
2VCDA 4DRHA 3O5OA 4ODNA 4LAWA 3I6CA 3MDYB 4LAYA 5B8IC 4DROA 4QT3A 4ODRA 2KFWA 1W26A 1ROTA 3O5IA 2UZ5A 2RUCA 5GPGA 4ODMA 4U84A 3PRDA 4W9PA 1NSGA 4DRJA 2LPVA 2RUDA 1C9HA 2XPAA 2Q5AA 2KGJA 3O5MA 4G2PA 4GIVA 3B7XA 4JFKA 5DITA 2PV2A 3LUOA 1NMWA 3O5EA 2RUQA 2ZR5A 1YW5A 4TX0A 2MNTA 1F8AB 2XP9A 4DZ2A 2FKEA 4FAPA 2ZQUA 1ZK6A 1J4RA 4QT2A 1D7IA 2OFNA 5HW7A 1L1PA 1BL4A 1FKGA 3GPKA 1FKFA 4DRNA 4BF8A 1R9HA 4JFIA 1JNSA 4W9QA 3EY6A 2IF4A 4TW6A 4JFJA 3UI5A 1T11A 5HKGA 2LGOA 4IQCA 2XP4A 3PA7A 3IK8A 3JYJA 2PV3A 4JFMA 1QZ2A 3UQIA 3ODKA 1EYMA 4U86A 4DH0A 5HWBA 5HWCA 2PPNA 3IKDA 1Q1CA 4C02B 4NNRA 5I98A 1FKKA 3NTPA 5HT1A 5DIUA 2KR7A 3UQAA 3IHZA 1A7XA 3KACA 3O5KA 2ZQSA 3IKGA 3O5LA 1J4IA 2PBCA 3RGCA 2ZR4A 4LAXA 3NI6A 1YATA 2N87A 4TYOA 1J6YA 1FAPA 4LAVA 4QIBA 3JYMA 2MLZA 1NMVA 3O5RA 2K8IA 3O5QA 4ODOA 1JNTA 3TDBA 2XPBA 4N19A 2MLYA 3KABA 4DRMA 2M2AA 2KO7A 1D7JA 3O5JA 5HUAA 1ZCNA 1KT0A 2Y78A 4W9OA 2AWGA 1P5QA 2XP8A 3OOBA 2RQSA 2ZR6A 3FAPA 2DG3A 1FKDA 1J4HA 2F4EA 2M1IA 3TC5A 5HTGA 1FJDA 4O2TA 1FKTA 1KT1A 1PINA 1BKFA 1QPFA 1U79A 3KAGA 4TW8A 4DRQA 2RSEA 1Q6HA 1Q6IA 4MGVA 4TW7A 2MPHA 4R0XA 4U85A 4DRIA 5D75A 3UI4A 3KAHA 3VAWA 2DG9A 2LKNA 1N1AA 3UI6A 4ODPA 1FD9A 4IQ2A 2F2DA 3TCZA 5HW6A 1B6CA 1D6OA 2ZQVA 4DZ3A 2PPOA 3O5PA 4DRKA 3O5DA 3KCEA 1FKJA 4DIPA 5J6EA 1HXVA 2XP3A 2RURA 2KE0A 2MF9A 3RFWA 2PV1A 4GGQA 4JYSA 1FKSA 3CGNA 3KAFA 4J4OA 4ODKA 3NRKA 3PRBA 4DT4A 3JXVA 2DG4A 2ITKA 2LJ4A 4FN2A 2M08A 1JVWA 4ITZA 5BXJA 4G50A 3KZ7A 4IPXA 2XP5A 1TCOC 5DIVA 2MLXA 1F40A 1FKRA 2KI3A 4J4NA 3H9RB 3KAIA 1PBKA 1FKHA 1Q6UA 2L2SA 3KADA 4ODLA 3UF8A 1EQ3A 3O5FA 4JFLA 5HW8A 4MSPA 1QPLA 2XP6A 1FKIA 1FKLA 1D7HA 1ROUA 2F21A 1FKBA 2PPPA 1M5YA 2ZQTA 2D9FA 4TNSA 3O5GA 3WH0A 3UQBA 4ODQA 4DRPA 2XP7A 3CGMA 2JZVA 1Y0OA 2VN1A 2FAPA
chains in the Genus database with same CATH superfamily
1W9VA 3I6CA 3MDYB 5B8IC 1RD6A 2KFWA 3CH9A 4MNJA 2RUCA 3RMEA 4W9PA 4DRJA 4WJXA 1VF8A 2Q5AA 4G2PA 2O9OA 1NMWA 2RUQA 2FKEA 4MPKA 2P4VA 4MAVA 1J4RA 1BL4A 1EIBA 1HKMA 4BF8A 1ZL1A 3BXWA 4WKHA 3AS3A 3B9AA 4IQCA 4QZVB 3ODKA 1EYMA 1E6PA 2PPNA 3AS1A 2A3BA 1FKKA 3NTPA 1TFVA 1A7XA 4MNKA 1GRJA 3RGCA 4R5EA 1X6LA 4TYOA 1W9UA 2B5UB 3TDBA 1E44A 4ZS6A 2KO7A 3PRAA 1EDQA 3FAPA 2DG3A 2F4EA 4O2TA 1KT1A 1U79A 4TW8A 2QF8A 4ZPTR 2ESCA 3ARSA 3QOKA 2DG9A 1N1AA 3UI6A 2F2DA 1B6CA 2ZQVA 1X6NA 5DF0A 1LL6A 2PPOA 3O5PA 3KCEA 1FKJA 1GOIA 4J4OA 2DSVA 3FY1A 4ODKA 3NRKA 2ETNA 4Z2GA 2DG4A 1XRVA 4MNMA 4IPXA 2XP5A 4HBEA 1F40A 1ZB5A 2KI3A 3H9RB 3KAIA 3KADA 1FKHA 3UF8A 4ODLA 1GUVA 3O5FA 1IX5A 4MSPA 1NH6A 2F21A 1FKBA 1M5YA 1WAWA 3G6LA 1H0GA 3UQBA 4ODQA 2WM0A 2XP7A 3CGMA 4P8WA 1Y0OA 2VN1A 3O5OA 3CHFA 3B8SA 5GPRA 3PR9A 1ROTA 3O5IA 2AOSA 3FXYA 4U84A 2RUDA 1C9HA 2XPAA 5DITA 4GIVA 3B7XA 4ZPWR 2O92A 1E15A 3O5EA 2MNTA 2XP9A 4DWSA 2OFNA 1W9PA 1L1PA 1WB0A 1FKFA 1K9TA 3ARZA 4JFIA 3ARXA 4Z2IA 4TW6A 4JFJA 3UI5A 1T11A 4Z2KA 3ALGA 3PA7A 3IK8A 1NWSA 2PV3A 3JYJA 1ZU8A 3UQIA 4U86A 4DH0A 5HWCA 1ZBKA 3OA5A 5DO2A 2KR7A 3O5KA 2ZQSA 3IKGA 3O5LA 4MNLA 1J4IA 2DT0A 3WIJA 4LAXA 1LG1A 1UR8A 4Z2LA 3NI6A 1YATA 1J6YA 4LAVA 4ZPVR 1W1PA 2MLZA 3O5QA 4AY1A 2MLYA 2M2AA 3O5JA 1JNEA 4NZCA 3CZ8A 2AWGA 5GQBA 1JNDA 3TC5A 1J4HA 2M1IA 1FJDA 2YBUA 4XAKA 2RSEA 1Q6HA 3GTYX 4MGVA 2WK2A 2MPHA 4R0XA 3UI4A 2LKNA 4L3NA 1FD9A 3AQUA 1D2KA 3EIPA 1LL7A 1CTNA 1ZBWA 4DRKA 2DSZA 5J6EA 1W1YA 4W5UA 2KE0A 3RFWA 4S3KA 3G6MA 1ZBCA 4GGQA 4WKAA 1FKSA 3KAFA 4DT4A 4FN2A 4DWSD 2M08A 4ITZA 3WD3A 2DSWA 3WL0A 4J4NA 3RM8A 1PBKA 1Q6UA 1EQ3A 4HARA 1LL4A 1D7HA 1ROUA 2G41A 4KQZA 2D9FA 3WH0A 3O5GA 4WIWA 3ARRA 1ITXA 1HJWA 2YBTA 4ODNA 4DROA 4ODRA 1W26A 4P8UA 3PRDA 2LPVA 1W1VA 2B31A 2KGJA 4Z2HA 3LUOA 3CHCA 4TX0A 2ZR5A 1YW5A 1UR9A 3ARVA 4WKFA 1D7IA 1FKGA 3GPKA 1OGBA 1LJYA 4IT4A 1JNSA 3ARUA 2IF4A 4MTVA 2DT2A 5HKGA 1HKIA 1E6NA 1QZ2A 4C02B 5I98A 5DIUA 3UQAA 3IHZA 3KACA 2PBCA 3WL1A 3CHDA 2ZR4A 3WD0A 2N87A 2A3AA 1FAPA 4QIBA 3JYMA 2K8IA 1XHGA 2IUZA 2XPBA 3ARQA 3KABA 1NWUA 4DRMA 3WD2A 1D7JA 3WD4A 5HUAA 1ZCNA 2Y78A 1FFQA 4W9OA 1E6RA 2WLYA 2F23A 3AS0A 2XP8A 3OOBA 3BMBA 1ZBVA 3KAGA 1Q6IA 4TW7A 4U85A 4DRIA 5D75A 3KAHA 3VAWA 2DT1A 4IQ2A 3TCZA 1KFWA 3ARWA 1D6OA 4DZ3A 4LGXA 3O5DA 2DT3A 3RM9A 1OGGA 2RURA 1H0IA 2PV1A 2G8ZA 3PRBA 3JXVA 5BXJA 1GPFA 3KZ7A 5DIVA 2MLXA 4L72B 4URIA 1JCHB 1FKLA 2EULA 2ZQTA 4TNSA 2WLZA 2OLHA 4DRPA 4DWSC 1EHNA 4ODMA 2VCDA 3AS2A 4DRHA 4LAWA 4LAYA 4QT3A 3B9EA 2UZ5A 1LQ0A 3WD1A 4NSBA 5GPGA 1NSGA 3O5MA 4JFKA 3WQWA 2PV2A 4Q7NA 1F8AB 4HBOA 4DZ2A 4FAPA 2ZQUA 4Z2JA 1ZK6A 1HKKA 4QT2A 5HW7A 4DRNA 1R9HA 4W9QA 3EY6A 2LGOA 2XP4A 1WNOA 4JFMA 3WKZA 5HWBA 1OWQA 5DEZA 3IKDA 1Q1CA 4WK9A 4NNRA 5HT1A 1NWTA 3GU0A 1HKJA 4IT6A 3AROA 3ARYA 3ALFA 3O5RA 1O6IA 1NMVA 4ODOA 1JNTA 4N19A 1HJVA 1E6ZA 1KT0A 2PI6A 1P5QA 2RQSA 2ZR6A 1LG2A 1FKDA 5HTGA 1FKTA 1PINA 1BKFA 1QPFA 3ARTA 4DRQA 4UDMA 3RM4A 5HBFA 4ODPA 2FDMA 1SYTA 5HW6A 4KR0B 2A3CA 4DWSB 1FFRA 2A3EA 4S3JA 4DIPA 1HXVA 1NWRA 2XP3A 3B9DA 2DPEA 2MF9A 3ARPA 4JYSA 1SR0A 3CGNA 4ML4A 2ITKA 4PTMA 2LJ4A 1JVWA 5JH8A 4P8VA 4G50A 1TCOC 3WQVA 1FKRA 2L2SA 3W4RA 2PN0A 4JFLA 5HW8A 1QPLA 1E9LA 2XP6A 1FKIA 3CHEA 4Q22A 2PPPA 4P8XA 1HJXA 2DSUA 2JZVA 1W1TA 2FAPA
chains in the Genus database with same CATH topology
1W9VA 3I6CA 3MDYB 5B8IC 1RD6A 2KFWA 3CH9A 4MNJA 2RUCA 3RMEA 4W9PA 4DRJA 4WJXA 1VF8A 2Q5AA 4G2PA 2O9OA 1NMWA 2RUQA 2FKEA 4MPKA 4MAVA 1J4RA 1BL4A 1EIBA 1HKMA 4BF8A 1ZL1A 3BXWA 4WKHA 3AS3A 3B9AA 4IQCA 4QZVB 3ODKA 1EYMA 1E6PA 2PPNA 3AS1A 2A3BA 1FKKA 3NTPA 1TFVA 1A7XA 4MNKA 3RGCA 4R5EA 1X6LA 4TYOA 1W9UA 3TDBA 4ZS6A 2KO7A 3PRAA 1EDQA 3FAPA 2DG3A 2F4EA 4O2TA 1KT1A 1U79A 4TW8A 2QF8A 4ZPTR 2ESCA 3ARSA 3QOKA 2DG9A 1N1AA 3UI6A 2F2DA 1B6CA 2ZQVA 1X6NA 5DF0A 1LL6A 2PPOA 3O5PA 3KCEA 1FKJA 1GOIA 4J4OA 2DSVA 3FY1A 4ODKA 3NRKA 4Z2GA 2DG4A 1XRVA 4MNMA 4IPXA 2XP5A 4HBEA 1F40A 1ZB5A 2KI3A 3H9RB 3KAIA 3KADA 1FKHA 3UF8A 4ODLA 1GUVA 3O5FA 1IX5A 4MSPA 1NH6A 2F21A 1FKBA 1M5YA 1WAWA 3G6LA 1H0GA 3UQBA 4ODQA 2WM0A 2XP7A 3CGMA 4P8WA 1Y0OA 2VN1A 3O5OA 3CHFA 3B8SA 5GPRA 3PR9A 1ROTA 3O5IA 2AOSA 3FXYA 4U84A 2RUDA 1C9HA 2XPAA 5DITA 4GIVA 3B7XA 4ZPWR 2O92A 1E15A 3O5EA 2MNTA 2XP9A 4DWSA 2OFNA 1W9PA 1L1PA 1WB0A 1FKFA 1K9TA 3ARZA 4JFIA 3ARXA 4Z2IA 4TW6A 4JFJA 3UI5A 1T11A 4Z2KA 3ALGA 3PA7A 3IK8A 1NWSA 2PV3A 3JYJA 1ZU8A 3UQIA 4U86A 4DH0A 5HWCA 1ZBKA 3OA5A 5DO2A 2KR7A 3O5KA 2ZQSA 3IKGA 3O5LA 4MNLA 1J4IA 2DT0A 3WIJA 4LAXA 1LG1A 1UR8A 4Z2LA 3NI6A 1YATA 1J6YA 4LAVA 4ZPVR 1W1PA 2MLZA 3O5QA 4AY1A 2MLYA 2M2AA 3O5JA 1JNEA 4NZCA 3CZ8A 2AWGA 5GQBA 1JNDA 3TC5A 1J4HA 2M1IA 1FJDA 2YBUA 4XAKA 2RSEA 1Q6HA 4MGVA 2WK2A 2MPHA 4R0XA 3UI4A 2LKNA 4L3NA 1FD9A 3AQUA 1D2KA 1LL7A 1CTNA 1ZBWA 4DRKA 2DSZA 5J6EA 1W1YA 4W5UA 2KE0A 3RFWA 4S3KA 3G6MA 1ZBCA 4GGQA 4WKAA 1FKSA 3KAFA 4DT4A 4FN2A 4DWSD 2M08A 4ITZA 3WD3A 2DSWA 3WL0A 4J4NA 3RM8A 1PBKA 1Q6UA 1EQ3A 4HARA 1LL4A 1D7HA 1ROUA 2G41A 4KQZA 2D9FA 3WH0A 3O5GA 4WIWA 3ARRA 1ITXA 1HJWA 2YBTA 4ODNA 4DROA 4ODRA 1W26A 4P8UA 3PRDA 2LPVA 1W1VA 2B31A 2KGJA 4Z2HA 3LUOA 3CHCA 4TX0A 2ZR5A 1YW5A 1UR9A 3ARVA 4WKFA 1D7IA 1FKGA 3GPKA 1OGBA 1LJYA 4IT4A 1JNSA 3ARUA 2IF4A 4MTVA 2DT2A 5HKGA 1HKIA 1E6NA 1QZ2A 4C02B 5I98A 5DIUA 3UQAA 3IHZA 3KACA 2PBCA 3WL1A 3CHDA 2ZR4A 3WD0A 2N87A 2A3AA 1FAPA 4QIBA 3JYMA 2K8IA 1XHGA 2IUZA 2XPBA 3ARQA 3KABA 1NWUA 4DRMA 3WD2A 1D7JA 3WD4A 5HUAA 1ZCNA 2Y78A 1FFQA 4W9OA 1E6RA 2WLYA 3AS0A 2XP8A 3OOBA 1ZBVA 3KAGA 1Q6IA 4TW7A 4U85A 4DRIA 5D75A 3KAHA 3VAWA 2DT1A 4IQ2A 3TCZA 1KFWA 3ARWA 1D6OA 4DZ3A 4LGXA 3O5DA 2DT3A 3RM9A 1OGGA 2RURA 1H0IA 2PV1A 2G8ZA 3PRBA 3JXVA 5BXJA 1GPFA 3KZ7A 5DIVA 2MLXA 4L72B 4URIA 1FKLA 2ZQTA 4TNSA 2WLZA 2OLHA 4DRPA 4DWSC 1EHNA 4ODMA 2VCDA 3AS2A 4DRHA 4LAWA 4LAYA 4QT3A 3B9EA 2UZ5A 1LQ0A 3WD1A 4NSBA 5GPGA 1NSGA 3O5MA 4JFKA 3WQWA 2PV2A 4Q7NA 1F8AB 4HBOA 4DZ2A 4FAPA 2ZQUA 4Z2JA 1ZK6A 1HKKA 4QT2A 5HW7A 4DRNA 1R9HA 4W9QA 3EY6A 2LGOA 2XP4A 1WNOA 4JFMA 3WKZA 5HWBA 1OWQA 5DEZA 3IKDA 1Q1CA 4WK9A 4NNRA 5HT1A 1NWTA 1HKJA 4IT6A 3AROA 3ARYA 3ALFA 3O5RA 1O6IA 1NMVA 4ODOA 1JNTA 4N19A 1HJVA 1E6ZA 1KT0A 2PI6A 1P5QA 2RQSA 2ZR6A 1LG2A 1FKDA 5HTGA 1FKTA 1PINA 1BKFA 1QPFA 3ARTA 4DRQA 3RM4A 5HBFA 4ODPA 2FDMA 1SYTA 5HW6A 4KR0B 2A3CA 4DWSB 1FFRA 2A3EA 4S3JA 4DIPA 1HXVA 1NWRA 2XP3A 3B9DA 2DPEA 2MF9A 3ARPA 4JYSA 1SR0A 3CGNA 4ML4A 2ITKA 4PTMA 2LJ4A 1JVWA 5JH8A 4P8VA 4G50A 1TCOC 3WQVA 1FKRA 2L2SA 3W4RA 4JFLA 5HW8A 1QPLA 1E9LA 2XP6A 1FKIA 3CHEA 4Q22A 2PPPA 4P8XA 1HJXA 2DSUA 2JZVA 1W1TA 2FAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCD A;  4DRH A;  3O5O A;  4ODN A;  4LAW A;  3I6C A;  3MDY B;  4LAY A;  5B8I C;  4DRO A;  4QT3 A;  4ODR A;  2KFW A;  1W26 A;  1ROT A;  3O5I A;  2UZ5 A;  2RUC A;  5GPG A;  4ODM A;  4U84 A;  3PRD A;  4W9P A;  1NSG A;  4DRJ A;  2LPV A;  2RUD A;  1C9H A;  2XPA A;  2Q5A A;  2KGJ A;  3O5M A;  4G2P A;  4GIV A;  3B7X A;  4JFK A;  5DIT A;  2PV2 A;  3LUO A;  1NMW A;  3O5E A;  2RUQ A;  2ZR5 A;  1YW5 A;  4TX0 A;  2MNT A;  1F8A B;  2XP9 A;  4DZ2 A;  2FKE A;  4FAP A;  2ZQU A;  1ZK6 A;  1J4R A;  4QT2 A;  1D7I A;  2OFN A;  5HW7 A;  1L1P A;  1BL4 A;  1FKG A;  3GPK A;  1FKF A;  4DRN A;  4BF8 A;  1R9H A;  4JFI A;  1JNS A;  4W9Q A;  3EY6 A;  2IF4 A;  4TW6 A;  4JFJ A;  3UI5 A;  1T11 A;  5HKG A;  2LGO A;  4IQC A;  2XP4 A;  3PA7 A;  3IK8 A;  3JYJ A;  2PV3 A;  4JFM A;  1QZ2 A;  3UQI A;  3ODK A;  1EYM A;  4U86 A;  4DH0 A;  5HWB A;  5HWC A;  2PPN A;  3IKD A;  1Q1C A;  4C02 B;  4NNR A;  5I98 A;  1FKK A;  3NTP A;  5HT1 A;  5DIU A;  2KR7 A;  3UQA A;  3IHZ A;  1A7X A;  3KAC A;  3O5K A;  2ZQS A;  3IKG A;  3O5L A;  1J4I A;  2PBC A;  3RGC A;  2ZR4 A;  4LAX A;  3NI6 A;  1YAT A;  2N87 A;  4TYO A;  1J6Y A;  1FAP A;  4LAV A;  4QIB A;  3JYM A;  2MLZ A;  1NMV A;  3O5R A;  2K8I A;  3O5Q A;  4ODO A;  1JNT A;  3TDB A;  2XPB A;  4N19 A;  2MLY A;  3KAB A;  4DRM A;  2M2A A;  2KO7 A;  1D7J A;  3O5J A;  5HUA A;  1ZCN A;  1KT0 A;  2Y78 A;  4W9O A;  2AWG A;  1P5Q A;  2XP8 A;  3OOB A;  2RQS A;  2ZR6 A;  3FAP A;  2DG3 A;  1FKD A;  1J4H A;  2F4E A;  2M1I A;  3TC5 A;  5HTG A;  1FJD A;  4O2T A;  1FKT A;  1KT1 A;  1PIN A;  1BKF A;  1QPF A;  1U79 A;  3KAG A;  4TW8 A;  4DRQ A;  2RSE A;  1Q6H A;  1Q6I A;  4MGV A;  4TW7 A;  2MPH A;  4R0X A;  4U85 A;  4DRI A;  5D75 A;  3UI4 A;  3KAH A;  3VAW A;  2DG9 A;  2LKN A;  1N1A A;  3UI6 A;  4ODP A;  1FD9 A;  4IQ2 A;  2F2D A;  3TCZ A;  5HW6 A;  1B6C A;  1D6O A;  2ZQV A;  4DZ3 A;  2PPO A;  3O5P A;  4DRK A;  3O5D A;  3KCE A;  1FKJ A;  4DIP A;  5J6E A;  1HXV A;  2XP3 A;  2RUR A;  2KE0 A;  2MF9 A;  3RFW A;  2PV1 A;  4GGQ A;  4JYS A;  1FKS A;  3CGN A;  3KAF A;  4J4O A;  4ODK A;  3NRK A;  3PRB A;  4DT4 A;  3JXV A;  2DG4 A;  2ITK A;  2LJ4 A;  4FN2 A;  2M08 A;  1JVW A;  4ITZ A;  5BXJ A;  4G50 A;  3KZ7 A;  4IPX A;  2XP5 A;  1TCO C;  5DIV A;  2MLX A;  1F40 A;  1FKR A;  2KI3 A;  4J4N A;  3H9R B;  3KAI A;  1PBK A;  1FKH A;  1Q6U A;  2L2S A;  3KAD A;  4ODL A;  3UF8 A;  1EQ3 A;  3O5F A;  4JFL A;  5HW8 A;  4MSP A;  1QPL A;  2XP6 A;  1FKI A;  1FKL A;  1D7H A;  1ROU A;  2F21 A;  1FKB A;  2PPP A;  1M5Y A;  2ZQT A;  2D9F A;  4TNS A;  3O5G A;  3WH0 A;  3UQB A;  4ODQ A;  4DRP A;  2XP7 A;  3CGM A;  2JZV A;  1Y0O A;  2VN1 A;  2FAP A; 
#chains in the Genus database with same CATH topology
 1W9V A;  3I6C A;  3MDY B;  5B8I C;  1RD6 A;  2KFW A;  3CH9 A;  4MNJ A;  2RUC A;  3RME A;  4W9P A;  4DRJ A;  4WJX A;  1VF8 A;  2Q5A A;  4G2P A;  2O9O A;  1NMW A;  2RUQ A;  2FKE A;  4MPK A;  2P4V A;  4MAV A;  1J4R A;  1BL4 A;  1EIB A;  1HKM A;  4BF8 A;  1ZL1 A;  3BXW A;  4WKH A;  3AS3 A;  3B9A A;  4IQC A;  4QZV B;  3ODK A;  1EYM A;  1E6P A;  2PPN A;  3AS1 A;  2A3B A;  1FKK A;  3NTP A;  1TFV A;  1A7X A;  4MNK A;  1GRJ A;  3RGC A;  4R5E A;  1X6L A;  4TYO A;  1W9U A;  2B5U B;  3TDB A;  1E44 A;  4ZS6 A;  2KO7 A;  3PRA A;  1EDQ A;  3FAP A;  2DG3 A;  2F4E A;  4O2T A;  1KT1 A;  1U79 A;  4TW8 A;  2QF8 A;  4ZPT R;  2ESC A;  3ARS A;  3QOK A;  2DG9 A;  1N1A A;  3UI6 A;  2F2D A;  1B6C A;  2ZQV A;  1X6N A;  5DF0 A;  1LL6 A;  2PPO A;  3O5P A;  3KCE A;  1FKJ A;  1GOI A;  4J4O A;  2DSV A;  3FY1 A;  4ODK A;  3NRK A;  2ETN A;  4Z2G A;  2DG4 A;  1XRV A;  4MNM A;  4IPX A;  2XP5 A;  4HBE A;  1F40 A;  1ZB5 A;  2KI3 A;  3H9R B;  3KAI A;  3KAD A;  1FKH A;  3UF8 A;  4ODL A;  1GUV A;  3O5F A;  1IX5 A;  4MSP A;  1NH6 A;  2F21 A;  1FKB A;  1M5Y A;  1WAW A;  3G6L A;  1H0G A;  3UQB A;  4ODQ A;  2WM0 A;  2XP7 A;  3CGM A;  4P8W A;  1Y0O A;  2VN1 A;  3O5O A;  3CHF A;  3B8S A;  5GPR A;  3PR9 A;  1ROT A;  3O5I A;  2AOS A;  3FXY A;  4U84 A;  2RUD A;  1C9H A;  2XPA A;  5DIT A;  4GIV A;  3B7X A;  4ZPW R;  2O92 A;  1E15 A;  3O5E A;  2MNT A;  2XP9 A;  4DWS A;  2OFN A;  1W9P A;  1L1P A;  1WB0 A;  1FKF A;  1K9T A;  3ARZ A;  4JFI A;  3ARX A;  4Z2I A;  4TW6 A;  4JFJ A;  3UI5 A;  1T11 A;  4Z2K A;  3ALG A;  3PA7 A;  3IK8 A;  1NWS A;  2PV3 A;  3JYJ A;  1ZU8 A;  3UQI A;  4U86 A;  4DH0 A;  5HWC A;  1ZBK A;  3OA5 A;  5DO2 A;  2KR7 A;  3O5K A;  2ZQS A;  3IKG A;  3O5L A;  4MNL A;  1J4I A;  2DT0 A;  3WIJ A;  4LAX A;  1LG1 A;  1UR8 A;  4Z2L A;  3NI6 A;  1YAT A;  1J6Y A;  4LAV A;  4ZPV R;  1W1P A;  2MLZ A;  3O5Q A;  4AY1 A;  2MLY A;  2M2A A;  3O5J A;  1JNE A;  4NZC A;  3CZ8 A;  2AWG A;  5GQB A;  1JND A;  3TC5 A;  1J4H A;  2M1I A;  1FJD A;  2YBU A;  4XAK A;  2RSE A;  1Q6H A;  3GTY X;  4MGV A;  2WK2 A;  2MPH A;  4R0X A;  3UI4 A;  2LKN A;  4L3N A;  1FD9 A;  3AQU A;  1D2K A;  3EIP A;  1LL7 A;  1CTN A;  1ZBW A;  4DRK A;  2DSZ A;  5J6E A;  1W1Y A;  4W5U A;  2KE0 A;  3RFW A;  4S3K A;  3G6M A;  1ZBC A;  4GGQ A;  4WKA A;  1FKS A;  3KAF A;  4DT4 A;  4FN2 A;  4DWS D;  2M08 A;  4ITZ A;  3WD3 A;  2DSW A;  3WL0 A;  4J4N A;  3RM8 A;  1PBK A;  1Q6U A;  1EQ3 A;  4HAR A;  1LL4 A;  1D7H A;  1ROU A;  2G41 A;  4KQZ A;  2D9F A;  3WH0 A;  3O5G A;  4WIW A;  3ARR A;  1ITX A;  1HJW A;  2YBT A;  4ODN A;  4DRO A;  4ODR A;  1W26 A;  4P8U A;  3PRD A;  2LPV A;  1W1V A;  2B31 A;  2KGJ A;  4Z2H A;  3LUO A;  3CHC A;  4TX0 A;  2ZR5 A;  1YW5 A;  1UR9 A;  3ARV A;  4WKF A;  1D7I A;  1FKG A;  3GPK A;  1OGB A;  1LJY A;  4IT4 A;  1JNS A;  3ARU A;  2IF4 A;  4MTV A;  2DT2 A;  5HKG A;  1HKI A;  1E6N A;  1QZ2 A;  4C02 B;  5I98 A;  5DIU A;  3UQA A;  3IHZ A;  3KAC A;  2PBC A;  3WL1 A;  3CHD A;  2ZR4 A;  3WD0 A;  2N87 A;  2A3A A;  1FAP A;  4QIB A;  3JYM A;  2K8I A;  1XHG A;  2IUZ A;  2XPB A;  3ARQ A;  3KAB A;  1NWU A;  4DRM A;  3WD2 A;  1D7J A;  3WD4 A;  5HUA A;  1ZCN A;  2Y78 A;  1FFQ A;  4W9O A;  1E6R A;  2WLY A;  2F23 A;  3AS0 A;  2XP8 A;  3OOB A;  3BMB A;  1ZBV A;  3KAG A;  1Q6I A;  4TW7 A;  4U85 A;  4DRI A;  5D75 A;  3KAH A;  3VAW A;  2DT1 A;  4IQ2 A;  3TCZ A;  1KFW A;  3ARW A;  1D6O A;  4DZ3 A;  4LGX A;  3O5D A;  2DT3 A;  3RM9 A;  1OGG A;  2RUR A;  1H0I A;  2PV1 A;  2G8Z A;  3PRB A;  3JXV A;  5BXJ A;  1GPF A;  3KZ7 A;  5DIV A;  2MLX A;  4L72 B;  4URI A;  1JCH B;  1FKL A;  2EUL A;  2ZQT A;  4TNS A;  2WLZ A;  2OLH A;  4DRP A;  4DWS C;  1EHN A;  4ODM A;  2VCD A;  3AS2 A;  4DRH A;  4LAW A;  4LAY A;  4QT3 A;  3B9E A;  2UZ5 A;  1LQ0 A;  3WD1 A;  4NSB A;  5GPG A;  1NSG A;  3O5M A;  4JFK A;  3WQW A;  2PV2 A;  4Q7N A;  1F8A B;  4HBO A;  4DZ2 A;  4FAP A;  2ZQU A;  4Z2J A;  1ZK6 A;  1HKK A;  4QT2 A;  5HW7 A;  4DRN A;  1R9H A;  4W9Q A;  3EY6 A;  2LGO A;  2XP4 A;  1WNO A;  4JFM A;  3WKZ A;  5HWB A;  1OWQ A;  5DEZ A;  3IKD A;  1Q1C A;  4WK9 A;  4NNR A;  5HT1 A;  1NWT A;  3GU0 A;  1HKJ A;  4IT6 A;  3ARO A;  3ARY A;  3ALF A;  3O5R A;  1O6I A;  1NMV A;  4ODO A;  1JNT A;  4N19 A;  1HJV A;  1E6Z A;  1KT0 A;  2PI6 A;  1P5Q A;  2RQS A;  2ZR6 A;  1LG2 A;  1FKD A;  5HTG A;  1FKT A;  1PIN A;  1BKF A;  1QPF A;  3ART A;  4DRQ A;  4UDM A;  3RM4 A;  5HBF A;  4ODP A;  2FDM A;  1SYT A;  5HW6 A;  4KR0 B;  2A3C A;  4DWS B;  1FFR A;  2A3E A;  4S3J A;  4DIP A;  1HXV A;  1NWR A;  2XP3 A;  3B9D A;  2DPE A;  2MF9 A;  3ARP A;  4JYS A;  1SR0 A;  3CGN A;  4ML4 A;  2ITK A;  4PTM A;  2LJ4 A;  1JVW A;  5JH8 A;  4P8V A;  4G50 A;  1TCO C;  3WQV A;  1FKR A;  2L2S A;  3W4R A;  2PN0 A;  4JFL A;  5HW8 A;  1QPL A;  1E9L A;  2XP6 A;  1FKI A;  3CHE A;  4Q22 A;  2PPP A;  4P8X A;  1HJX A;  2DSU A;  2JZV A;  1W1T A;  2FAP A; 
#chains in the Genus database with same CATH homology
 1W9V A;  3I6C A;  3MDY B;  5B8I C;  1RD6 A;  2KFW A;  3CH9 A;  4MNJ A;  2RUC A;  3RME A;  4W9P A;  4DRJ A;  4WJX A;  1VF8 A;  2Q5A A;  4G2P A;  2O9O A;  1NMW A;  2RUQ A;  2FKE A;  4MPK A;  4MAV A;  1J4R A;  1BL4 A;  1EIB A;  1HKM A;  4BF8 A;  1ZL1 A;  3BXW A;  4WKH A;  3AS3 A;  3B9A A;  4IQC A;  4QZV B;  3ODK A;  1EYM A;  1E6P A;  2PPN A;  3AS1 A;  2A3B A;  1FKK A;  3NTP A;  1TFV A;  1A7X A;  4MNK A;  3RGC A;  4R5E A;  1X6L A;  4TYO A;  1W9U A;  3TDB A;  4ZS6 A;  2KO7 A;  3PRA A;  1EDQ A;  3FAP A;  2DG3 A;  2F4E A;  4O2T A;  1KT1 A;  1U79 A;  4TW8 A;  2QF8 A;  4ZPT R;  2ESC A;  3ARS A;  3QOK A;  2DG9 A;  1N1A A;  3UI6 A;  2F2D A;  1B6C A;  2ZQV A;  1X6N A;  5DF0 A;  1LL6 A;  2PPO A;  3O5P A;  3KCE A;  1FKJ A;  1GOI A;  4J4O A;  2DSV A;  3FY1 A;  4ODK A;  3NRK A;  4Z2G A;  2DG4 A;  1XRV A;  4MNM A;  4IPX A;  2XP5 A;  4HBE A;  1F40 A;  1ZB5 A;  2KI3 A;  3H9R B;  3KAI A;  3KAD A;  1FKH A;  3UF8 A;  4ODL A;  1GUV A;  3O5F A;  1IX5 A;  4MSP A;  1NH6 A;  2F21 A;  1FKB A;  1M5Y A;  1WAW A;  3G6L A;  1H0G A;  3UQB A;  4ODQ A;  2WM0 A;  2XP7 A;  3CGM A;  4P8W A;  1Y0O A;  2VN1 A;  3O5O A;  3CHF A;  3B8S A;  5GPR A;  3PR9 A;  1ROT A;  3O5I A;  2AOS A;  3FXY A;  4U84 A;  2RUD A;  1C9H A;  2XPA A;  5DIT A;  4GIV A;  3B7X A;  4ZPW R;  2O92 A;  1E15 A;  3O5E A;  2MNT A;  2XP9 A;  4DWS A;  2OFN A;  1W9P A;  1L1P A;  1WB0 A;  1FKF A;  1K9T A;  3ARZ A;  4JFI A;  3ARX A;  4Z2I A;  4TW6 A;  4JFJ A;  3UI5 A;  1T11 A;  4Z2K A;  3ALG A;  3PA7 A;  3IK8 A;  1NWS A;  2PV3 A;  3JYJ A;  1ZU8 A;  3UQI A;  4U86 A;  4DH0 A;  5HWC A;  1ZBK A;  3OA5 A;  5DO2 A;  2KR7 A;  3O5K A;  2ZQS A;  3IKG A;  3O5L A;  4MNL A;  1J4I A;  2DT0 A;  3WIJ A;  4LAX A;  1LG1 A;  1UR8 A;  4Z2L A;  3NI6 A;  1YAT A;  1J6Y A;  4LAV A;  4ZPV R;  1W1P A;  2MLZ A;  3O5Q A;  4AY1 A;  2MLY A;  2M2A A;  3O5J A;  1JNE A;  4NZC A;  3CZ8 A;  2AWG A;  5GQB A;  1JND A;  3TC5 A;  1J4H A;  2M1I A;  1FJD A;  2YBU A;  4XAK A;  2RSE A;  1Q6H A;  4MGV A;  2WK2 A;  2MPH A;  4R0X A;  3UI4 A;  2LKN A;  4L3N A;  1FD9 A;  3AQU A;  1D2K A;  1LL7 A;  1CTN A;  1ZBW A;  4DRK A;  2DSZ A;  5J6E A;  1W1Y A;  4W5U A;  2KE0 A;  3RFW A;  4S3K A;  3G6M A;  1ZBC A;  4GGQ A;  4WKA A;  1FKS A;  3KAF A;  4DT4 A;  4FN2 A;  4DWS D;  2M08 A;  4ITZ A;  3WD3 A;  2DSW A;  3WL0 A;  4J4N A;  3RM8 A;  1PBK A;  1Q6U A;  1EQ3 A;  4HAR A;  1LL4 A;  1D7H A;  1ROU A;  2G41 A;  4KQZ A;  2D9F A;  3WH0 A;  3O5G A;  4WIW A;  3ARR A;  1ITX A;  1HJW A;  2YBT A;  4ODN A;  4DRO A;  4ODR A;  1W26 A;  4P8U A;  3PRD A;  2LPV A;  1W1V A;  2B31 A;  2KGJ A;  4Z2H A;  3LUO A;  3CHC A;  4TX0 A;  2ZR5 A;  1YW5 A;  1UR9 A;  3ARV A;  4WKF A;  1D7I A;  1FKG A;  3GPK A;  1OGB A;  1LJY A;  4IT4 A;  1JNS A;  3ARU A;  2IF4 A;  4MTV A;  2DT2 A;  5HKG A;  1HKI A;  1E6N A;  1QZ2 A;  4C02 B;  5I98 A;  5DIU A;  3UQA A;  3IHZ A;  3KAC A;  2PBC A;  3WL1 A;  3CHD A;  2ZR4 A;  3WD0 A;  2N87 A;  2A3A A;  1FAP A;  4QIB A;  3JYM A;  2K8I A;  1XHG A;  2IUZ A;  2XPB A;  3ARQ A;  3KAB A;  1NWU A;  4DRM A;  3WD2 A;  1D7J A;  3WD4 A;  5HUA A;  1ZCN A;  2Y78 A;  1FFQ A;  4W9O A;  1E6R A;  2WLY A;  3AS0 A;  2XP8 A;  3OOB A;  1ZBV A;  3KAG A;  1Q6I A;  4TW7 A;  4U85 A;  4DRI A;  5D75 A;  3KAH A;  3VAW A;  2DT1 A;  4IQ2 A;  3TCZ A;  1KFW A;  3ARW A;  1D6O A;  4DZ3 A;  4LGX A;  3O5D A;  2DT3 A;  3RM9 A;  1OGG A;  2RUR A;  1H0I A;  2PV1 A;  2G8Z A;  3PRB A;  3JXV A;  5BXJ A;  1GPF A;  3KZ7 A;  5DIV A;  2MLX A;  4L72 B;  4URI A;  1FKL A;  2ZQT A;  4TNS A;  2WLZ A;  2OLH A;  4DRP A;  4DWS C;  1EHN A;  4ODM A;  2VCD A;  3AS2 A;  4DRH A;  4LAW A;  4LAY A;  4QT3 A;  3B9E A;  2UZ5 A;  1LQ0 A;  3WD1 A;  4NSB A;  5GPG A;  1NSG A;  3O5M A;  4JFK A;  3WQW A;  2PV2 A;  4Q7N A;  1F8A B;  4HBO A;  4DZ2 A;  4FAP A;  2ZQU A;  4Z2J A;  1ZK6 A;  1HKK A;  4QT2 A;  5HW7 A;  4DRN A;  1R9H A;  4W9Q A;  3EY6 A;  2LGO A;  2XP4 A;  1WNO A;  4JFM A;  3WKZ A;  5HWB A;  1OWQ A;  5DEZ A;  3IKD A;  1Q1C A;  4WK9 A;  4NNR A;  5HT1 A;  1NWT A;  1HKJ A;  4IT6 A;  3ARO A;  3ARY A;  3ALF A;  3O5R A;  1O6I A;  1NMV A;  4ODO A;  1JNT A;  4N19 A;  1HJV A;  1E6Z A;  1KT0 A;  2PI6 A;  1P5Q A;  2RQS A;  2ZR6 A;  1LG2 A;  1FKD A;  5HTG A;  1FKT A;  1PIN A;  1BKF A;  1QPF A;  3ART A;  4DRQ A;  3RM4 A;  5HBF A;  4ODP A;  2FDM A;  1SYT A;  5HW6 A;  4KR0 B;  2A3C A;  4DWS B;  1FFR A;  2A3E A;  4S3J A;  4DIP A;  1HXV A;  1NWR A;  2XP3 A;  3B9D A;  2DPE A;  2MF9 A;  3ARP A;  4JYS A;  1SR0 A;  3CGN A;  4ML4 A;  2ITK A;  4PTM A;  2LJ4 A;  1JVW A;  5JH8 A;  4P8V A;  4G50 A;  1TCO C;  3WQV A;  1FKR A;  2L2S A;  3W4R A;  4JFL A;  5HW8 A;  1QPL A;  1E9L A;  2XP6 A;  1FKI A;  3CHE A;  4Q22 A;  2PPP A;  4P8X A;  1HJX A;  2DSU A;  2JZV A;  1W1T A;  2FAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...