2FKEA

Fk-506-binding protein: three-dimensional structure of the complex with the antagonist l-685,818
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FK-506-binding protein: three-dimensional structure of the complex with the antagonist L-685,818.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
molecule keywords FK506 BINDING PROTEIN
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2fkeA00
3VAWA 1ROTA 4MGVA 5D75A 3H9RB 1FKRA 3MDYB 3WH0A 4ODNA 1BKFA 2RSEA 3O5LA 4FAPA 4ODKA 1KT1A 3IKDA 1FKGA 3O5OA 1FJDA 3O5GA 4LAVA 2LKNA 5HWBA 1W26A 5HUAA 1R9HA 4QT3A 2LJ4A 2RUDA 3KZ7A 1F8AB 2XPAA 4ODLA 2FAPA 5HW6A 1JNSA 2KI3A 3PRDA 2KE0A 3O5DA 4JFKA 1FD9A 1TCOC 2XP6A 4TW7A 2IF4A 2LPVA 4MSPA 1B6CA 3PA7A 3KADA 2MLZA 1T11A 4TNSA 4U86A 4DROA 1FKBA 3CGMA 4JFIA 1FKLA 2DG3A 3NI6A 2D9FA 3KAGA 3RFWA 2VCDA 3KABA 4DZ3A 3O5JA 4JFLA 1Q6UA 5DIUA 2MNTA 3KAIA 2ITKA 2RUQA 1Y0OA 4TYOA 4LAXA 5HTGA 3PRBA 2ZR6A 5HWCA 3O5IA 1A7XA 3I6CA 2XP3A 2F21A 3JYMA 1FKJA 4J4NA 4GIVA 2VN1A 1C9HA 3FAPA 1FKTA 2PPOA 2PV3A 2JZVA 1BL4A 2RUCA 3NRKA 1FKSA 1JNTA 4DRJA 2F4EA 3KACA 1NMVA 1PBKA 2ZQSA 2PPNA 1L1PA 4ODMA 1D7IA 2ZQVA 2K8IA 4W9PA 4DH0A 4C02B 2ZR4A 2M2AA 1KT0A 4DRNA 2KGJA 2RQSA 2OFNA 1QPFA 2LGOA 2Y78A 2DG4A 2M08A 1NSGA 3LUOA 1EYMA 3TC5A 3UF8A 3JXVA 1FKHA 2XP4A 1HXVA 2RURA 5I98A 1FAPA 1FKFA 1J4RA 1YW5A 1ZCNA 3KAFA 1J4HA 2XPBA 4QT2A 1D7HA 2MF9A 4O2TA 1JVWA 2M1IA 3UQIA 4IQ2A 4G2PA 1M5YA 2KO7A 2ZQUA 2AWGA 1YATA 2F2DA 4ODQA 3TCZA 4JFJA 1FKIA 4ODOA 2KFWA 1F40A 1FKDA 3O5EA 4U85A 5BXJA 3O5QA 4JYSA 3GPKA 4LAWA 3OOBA 4TX0A 1FKKA 1P5QA 2UZ5A 1ZK6A 2ZR5A 4LAYA 4J4OA 4DRIA 4GGQA 5GPGA 1EQ3A 1Q6IA 4W9QA 4IPXA 1N1AA 4FN2A 3RGCA 5DIVA 5HT1A 2MPHA 2PBCA 2PV2A 2Q5AA 3O5KA 4ODPA 5DITA 3KAHA 3O5RA 2FKEA 4NNRA 4DRMA 3UI6A 2XP7A 2MLYA 1U79A 1QZ2A 2PV1A 4TW6A 4W9OA 4DRHA 3ODKA 4R0XA 4ITZA 4U84A 1J4IA 2ZQTA 3CGNA 1PINA 2MLXA 4JFMA 2XP5A 4DRPA 1D6OA 4G50A 2KR7A 3EY6A 3IK8A 3O5PA 3UI4A 5HW7A 2XP8A 5J6EA 1NMWA 2L2SA 1QPLA 3B7XA 3IHZA 2XP9A 1J6YA 2PPPA 3O5FA 4ODRA 3IKGA 4TW8A 2N87A 4BF8A 3NTPA 5HW8A 4IQCA 4QIBA 4DRQA 4DZ2A 1Q6HA 3KCEA 5B8IC 5HKGA 3JYJA 4DT4A 1ROUA 1D7JA 1Q1CA 2DG9A 3UI5A 4N19A 3UQBA 3O5MA 3TDBA 4DIPA 4DRKA 3UQAA
chains in the Genus database with same CATH superfamily
3VAWA 4MGVA 3PRAA 1FJDA 1SYTA 4LAVA 1W26A 3WQVA 1F8AB 3ALGA 4ODLA 3AROA 1JNSA 2KE0A 2DT1A 2B5UB 2LPVA 3G6LA 3PA7A 4TNSA 3KADA 2MLZA 2DG3A 2D9FA 4IT4A 2EULA 3KABA 1SR0A 4JFLA 2RUQA 1Y0OA 4TYOA 5HTGA 3BMBA 2XP3A 3JYMA 1K9TA 3B9AA 4GIVA 3W4RA 1W9UA 1JNTA 3B8SA 2PPNA 3PR9A 4MNMA 4ODMA 4MNJA 4ZS6A 4WKHA 4DH0A 4MNKA 2M2AA 2RQSA 3TC5A 2DG4A 1NSGA 3WD3A 1EYMA 1ITXA 1HXVA 1FFQA 4WK9A 1FKFA 1J4RA 1ZCNA 1H0IA 2XPBA 4IT6A 1D7HA 1JVWA 3CHCA 4G2PA 5GPRA 4ZPVR 1E6ZA 4ODQA 2PI6A 2IUZA 1FKIA 1NWUA 2KFWA 4JFJA 5BXJA 3GPKA 4LAWA 1LJYA 2ZR5A 3ARQA 1TFVA 4W9QA 4LGXA 1W9PA 3GTYX 5DIVA 2PBCA 2Q5AA 4UDMA 2DT3A 5DEZA 3RM8A 3BXWA 4ITZA 4U84A 3CHFA 1J4IA 1WAWA 2ZQTA 3G6MA 1HKKA 2KR7A 1E6PA 2XP8A 5J6EA 1NMWA 4ZPTR 2L2SA 1QPLA 3OA5A 1OWQA 4PTMA 3CHEA 5B8IC 3KCEA 1E6NA 1ROUA 1D7JA 1Q1CA 2DG9A 3AS1A 3UI5A 3TDBA 3AQUA 3ARYA 1ROTA 1OGGA 4AY1A 3MDYB 1HKJA 3CHDA 4Z2IA 1BKFA 3O5LA 1FKGA 2WM0A 5HWBA 2YBUA 1R9HA 4QT3A 2RUDA 1NH6A 2XPAA 4ZPWR 2FAPA 2KI3A 3PRDA 3WKZA 3O5DA 4JFKA 4P8VA 2IF4A 1B6CA 3ALFA 4MNLA 1FKBA 4NZCA 3RFWA 4HBOA 3ARTA 2VCDA 3O5JA 1LQ0A 1Q6UA 4LAXA 2DSUA 2ZR6A 5HWCA 1FKJA 1KFWA 1CTNA 2VN1A 4Z2HA 3FAPA 2PV3A 2RUCA 1FKSA 4DRJA 3KACA 1NMVA 3CZ8A 1LL7A 3RM9A 3WD0A 4Z2JA 1RD6A 3GU0A 1NWSA 3UF8A 1OGBA 3JXVA 1FKHA 4R5EA 1FAPA 1YW5A 1J4HA 2MF9A 1HKMA 3UQIA 4XAKA 1WB0A 2A3BA 2ZQUA 1ZBCA 1XRVA 2F2DA 4ODOA 1F40A 1FKDA 4JYSA 4DWSA 4TX0A 3ARZA 4GGQA 1UR9A 4DWSC 5HT1A 3B9DA 2DSVA 5DITA 1XHGA 4NNRA 4DRMA 2FKEA 2DPEA 2MLYA 4W9OA 3RMEA 2G41A 1W1PA 4R0XA 2OLHA 2MLXA 4JFMA 4Q7NA 3O5PA 3RM4A 3AS0A 3B9EA 1ZBKA 3IHZA 1E44A 2XP9A 1ZU8A 4ODRA 4BF8A 3WD2A 2A3CA 4DRQA 4DZ2A 5HKGA 4N19A 3O5MA 1E9LA 4DRKA 3ARXA 3H9RB 3AS3A 4ODNA 1W1TA 2RSEA 4MTVA 4ODKA 3O5OA 5GQBA 3O5GA 4DWSD 2LJ4A 3KZ7A 1HJWA 4WKAA 1FD9A 1TCOC 1JNDA 4TW7A 2PN0A 4MSPA 1T11A 4U86A 1NWTA 1UR8A 4JFIA 3KAGA 4DZ3A 2ITKA 3EIPA 2DSZA 3O5IA 3CH9A 2WLYA 3WL1A 2PPOA 2JZVA 1BL4A 2WK2A 2F4EA 2ZQSA 1GPFA 1L1PA 2DT2A 1D7IA 4W9PA 2O92A 3WQWA 2ZR4A 1KT0A 2KGJA 1QPFA 3QOKA 2QF8A 2XP4A 2RURA 5DF0A 3FY1A 1EHNA 3KAFA 4WJXA 4IQ2A 4KR0B 1EIBA 4MPKA 2KO7A 3TCZA 1W1YA 4U85A 3O5QA 1FKKA 2UZ5A 4LAYA 1ZK6A 1D2KA 1O6IA 5DO2A 3RGCA 4ODPA 4P8XA 3KAHA 3O5RA 2XP7A 1U79A 1QZ2A 2PV1A 4TW6A 3ODKA 1E6RA 1EDQA 3WD1A 2DSWA 2YBTA 4DRPA 1D6OA 4KQZA 3EY6A 3IK8A 3UI4A 3B7XA 1LG2A 1X6LA 2O9OA 3O5FA 1J6YA 4TW8A 3IKGA 2AOSA 2N87A 1GOIA 3AS2A 4IQCA 3ARVA 1W1VA 3JYJA 1JCHB 4DT4A 3ARUA 1NWRA 4DWSB 1ZBVA 1HJXA 2WLZA 5D75A 4L72B 1FKRA 2DT0A 3WH0A 4FAPA 3ARSA 1KT1A 3IKDA 1HJVA 3ARWA 1E15A 2LKNA 1W9VA 1LL4A 5HUAA 4HARA 3ARRA 5HW6A 1WNOA 5JH8A 4ML4A 2XP6A 1IX5A 2ESCA 4DROA 1HKIA 3CGMA 5HBFA 1FKLA 3NI6A 1H0GA 5DIUA 2MNTA 1X6NA 3KAIA 2A3EA 3PRBA 1A7XA 3I6CA 2F21A 4J4NA 4HBEA 1C9HA 1FKTA 3NRKA 4P8WA 1LG1A 2P4VA 1PBKA 2ZQVA 2ETNA 2K8IA 2FDMA 4C02B 4DRNA 2OFNA 2LGOA 4MAVA 2Y78A 3LUOA 2M08A 3WIJA 3ARPA 1FFRA 5I98A 2A3AA 1GRJA 3WL0A 1VF8A 4QT2A 1ZBWA 1ZB5A 4O2TA 2M1IA 1M5YA 1LL6A 4L3NA 2AWGA 1YATA 4WKFA 4Q22A 1ZL1A 3O5EA 4P8UA 4NSBA 2G8ZA 4QZVB 4WIWA 3OOBA 4Z2GA 1P5QA 4J4OA 2B31A 4DRIA 5GPGA 1EQ3A 1Q6IA 4IPXA 1JNEA 1N1AA 4FN2A 2MPHA 2PV2A 3O5KA 3WD4A 3UI6A 4DRHA 4URIA 3FXYA 3CGNA 1GUVA 1PINA 2XP5A 4G50A 4S3JA 5HW7A 4W5UA 4S3KA 2PPPA 3NTPA 5HW8A 4QIBA 1Q6HA 2F23A 4Z2LA 4Z2KA 3UQBA 4DIPA 3UQAA
chains in the Genus database with same CATH topology
3VAWA 4MGVA 3PRAA 1FJDA 1SYTA 4LAVA 1W26A 3WQVA 1F8AB 3ALGA 4ODLA 3AROA 1JNSA 2KE0A 2DT1A 2LPVA 3G6LA 3PA7A 4TNSA 3KADA 2MLZA 2DG3A 2D9FA 4IT4A 3KABA 1SR0A 4JFLA 2RUQA 1Y0OA 4TYOA 5HTGA 2XP3A 3JYMA 1K9TA 3B9AA 4GIVA 3W4RA 1W9UA 1JNTA 3B8SA 2PPNA 3PR9A 4MNMA 4ODMA 4MNJA 4ZS6A 4WKHA 4DH0A 4MNKA 2M2AA 2RQSA 3TC5A 2DG4A 1NSGA 3WD3A 1EYMA 1ITXA 1HXVA 1FFQA 4WK9A 1FKFA 1J4RA 1ZCNA 1H0IA 2XPBA 4IT6A 1D7HA 1JVWA 3CHCA 4G2PA 5GPRA 4ZPVR 1E6ZA 4ODQA 2PI6A 2IUZA 1FKIA 1NWUA 2KFWA 4JFJA 5BXJA 3GPKA 4LAWA 1LJYA 2ZR5A 3ARQA 1TFVA 4W9QA 4LGXA 1W9PA 5DIVA 2PBCA 2Q5AA 2DT3A 5DEZA 3RM8A 3BXWA 4ITZA 4U84A 3CHFA 1J4IA 1WAWA 2ZQTA 3G6MA 1HKKA 2KR7A 1E6PA 2XP8A 5J6EA 1NMWA 4ZPTR 2L2SA 1QPLA 3OA5A 1OWQA 4PTMA 3CHEA 5B8IC 3KCEA 1E6NA 1ROUA 1D7JA 1Q1CA 2DG9A 3AS1A 3UI5A 3TDBA 3AQUA 3ARYA 1ROTA 1OGGA 4AY1A 3MDYB 1HKJA 3CHDA 4Z2IA 1BKFA 3O5LA 1FKGA 2WM0A 5HWBA 2YBUA 1R9HA 4QT3A 2RUDA 1NH6A 2XPAA 4ZPWR 2FAPA 2KI3A 3PRDA 3WKZA 3O5DA 4JFKA 4P8VA 2IF4A 1B6CA 3ALFA 4MNLA 1FKBA 4NZCA 3RFWA 4HBOA 3ARTA 2VCDA 3O5JA 1LQ0A 1Q6UA 4LAXA 2DSUA 2ZR6A 5HWCA 1FKJA 1KFWA 1CTNA 2VN1A 4Z2HA 3FAPA 2PV3A 2RUCA 1FKSA 4DRJA 3KACA 1NMVA 3CZ8A 1LL7A 3RM9A 3WD0A 4Z2JA 1RD6A 1NWSA 3UF8A 1OGBA 3JXVA 1FKHA 4R5EA 1FAPA 1YW5A 1J4HA 2MF9A 1HKMA 3UQIA 4XAKA 1WB0A 2A3BA 2ZQUA 1ZBCA 1XRVA 2F2DA 4ODOA 1F40A 1FKDA 4JYSA 4DWSA 4TX0A 3ARZA 4GGQA 1UR9A 4DWSC 5HT1A 3B9DA 2DSVA 5DITA 1XHGA 4NNRA 4DRMA 2FKEA 2DPEA 2MLYA 4W9OA 3RMEA 2G41A 1W1PA 4R0XA 2OLHA 2MLXA 4JFMA 4Q7NA 3O5PA 3RM4A 3AS0A 3B9EA 1ZBKA 3IHZA 2XP9A 1ZU8A 4ODRA 4BF8A 3WD2A 2A3CA 4DRQA 4DZ2A 5HKGA 4N19A 3O5MA 1E9LA 4DRKA 3ARXA 3H9RB 3AS3A 4ODNA 1W1TA 2RSEA 4MTVA 4ODKA 3O5OA 5GQBA 3O5GA 4DWSD 2LJ4A 3KZ7A 1HJWA 4WKAA 1FD9A 1TCOC 1JNDA 4TW7A 4MSPA 1T11A 4U86A 1NWTA 1UR8A 4JFIA 3KAGA 4DZ3A 2ITKA 2DSZA 3O5IA 3CH9A 2WLYA 3WL1A 2PPOA 2JZVA 1BL4A 2WK2A 2F4EA 2ZQSA 1GPFA 1L1PA 2DT2A 1D7IA 4W9PA 2O92A 3WQWA 2ZR4A 1KT0A 2KGJA 1QPFA 3QOKA 2QF8A 2XP4A 2RURA 5DF0A 3FY1A 1EHNA 3KAFA 4WJXA 4IQ2A 4KR0B 1EIBA 4MPKA 2KO7A 3TCZA 1W1YA 4U85A 3O5QA 1FKKA 2UZ5A 4LAYA 1ZK6A 1D2KA 1O6IA 5DO2A 3RGCA 4ODPA 4P8XA 3KAHA 3O5RA 2XP7A 1U79A 1QZ2A 2PV1A 4TW6A 3ODKA 1E6RA 1EDQA 3WD1A 2DSWA 2YBTA 4DRPA 1D6OA 4KQZA 3EY6A 3IK8A 3UI4A 3B7XA 1LG2A 1X6LA 2O9OA 3O5FA 1J6YA 4TW8A 3IKGA 2AOSA 2N87A 1GOIA 3AS2A 4IQCA 3ARVA 1W1VA 3JYJA 4DT4A 3ARUA 1NWRA 4DWSB 1ZBVA 1HJXA 2WLZA 5D75A 4L72B 1FKRA 2DT0A 3WH0A 4FAPA 3ARSA 1KT1A 3IKDA 1HJVA 3ARWA 1E15A 2LKNA 1W9VA 1LL4A 5HUAA 4HARA 3ARRA 5HW6A 1WNOA 5JH8A 4ML4A 2XP6A 1IX5A 2ESCA 4DROA 1HKIA 3CGMA 5HBFA 1FKLA 3NI6A 1H0GA 5DIUA 2MNTA 1X6NA 3KAIA 2A3EA 3PRBA 1A7XA 3I6CA 2F21A 4J4NA 4HBEA 1C9HA 1FKTA 3NRKA 4P8WA 1LG1A 1PBKA 2ZQVA 2K8IA 2FDMA 4C02B 4DRNA 2OFNA 2LGOA 4MAVA 2Y78A 3LUOA 2M08A 3WIJA 3ARPA 1FFRA 5I98A 2A3AA 3WL0A 1VF8A 4QT2A 1ZBWA 1ZB5A 4O2TA 2M1IA 1M5YA 1LL6A 4L3NA 2AWGA 1YATA 4WKFA 4Q22A 1ZL1A 3O5EA 4P8UA 4NSBA 2G8ZA 4QZVB 4WIWA 3OOBA 4Z2GA 1P5QA 4J4OA 2B31A 4DRIA 5GPGA 1EQ3A 1Q6IA 4IPXA 1JNEA 1N1AA 4FN2A 2MPHA 2PV2A 3O5KA 3WD4A 3UI6A 4DRHA 4URIA 3FXYA 3CGNA 1GUVA 1PINA 2XP5A 4G50A 4S3JA 5HW7A 4W5UA 4S3KA 2PPPA 3NTPA 5HW8A 4QIBA 1Q6HA 4Z2LA 4Z2KA 3UQBA 4DIPA 3UQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VAW A;  1ROT A;  4MGV A;  5D75 A;  3H9R B;  1FKR A;  3MDY B;  3WH0 A;  4ODN A;  1BKF A;  2RSE A;  3O5L A;  4FAP A;  4ODK A;  1KT1 A;  3IKD A;  1FKG A;  3O5O A;  1FJD A;  3O5G A;  4LAV A;  2LKN A;  5HWB A;  1W26 A;  5HUA A;  1R9H A;  4QT3 A;  2LJ4 A;  2RUD A;  3KZ7 A;  1F8A B;  2XPA A;  4ODL A;  2FAP A;  5HW6 A;  1JNS A;  2KI3 A;  3PRD A;  2KE0 A;  3O5D A;  4JFK A;  1FD9 A;  1TCO C;  2XP6 A;  4TW7 A;  2IF4 A;  2LPV A;  4MSP A;  1B6C A;  3PA7 A;  3KAD A;  2MLZ A;  1T11 A;  4TNS A;  4U86 A;  4DRO A;  1FKB A;  3CGM A;  4JFI A;  1FKL A;  2DG3 A;  3NI6 A;  2D9F A;  3KAG A;  3RFW A;  2VCD A;  3KAB A;  4DZ3 A;  3O5J A;  4JFL A;  1Q6U A;  5DIU A;  2MNT A;  3KAI A;  2ITK A;  2RUQ A;  1Y0O A;  4TYO A;  4LAX A;  5HTG A;  3PRB A;  2ZR6 A;  5HWC A;  3O5I A;  1A7X A;  3I6C A;  2XP3 A;  2F21 A;  3JYM A;  1FKJ A;  4J4N A;  4GIV A;  2VN1 A;  1C9H A;  3FAP A;  1FKT A;  2PPO A;  2PV3 A;  2JZV A;  1BL4 A;  2RUC A;  3NRK A;  1FKS A;  1JNT A;  4DRJ A;  2F4E A;  3KAC A;  1NMV A;  1PBK A;  2ZQS A;  2PPN A;  1L1P A;  4ODM A;  1D7I A;  2ZQV A;  2K8I A;  4W9P A;  4DH0 A;  4C02 B;  2ZR4 A;  2M2A A;  1KT0 A;  4DRN A;  2KGJ A;  2RQS A;  2OFN A;  1QPF A;  2LGO A;  2Y78 A;  2DG4 A;  2M08 A;  1NSG A;  3LUO A;  1EYM A;  3TC5 A;  3UF8 A;  3JXV A;  1FKH A;  2XP4 A;  1HXV A;  2RUR A;  5I98 A;  1FAP A;  1FKF A;  1J4R A;  1YW5 A;  1ZCN A;  3KAF A;  1J4H A;  2XPB A;  4QT2 A;  1D7H A;  2MF9 A;  4O2T A;  1JVW A;  2M1I A;  3UQI A;  4IQ2 A;  4G2P A;  1M5Y A;  2KO7 A;  2ZQU A;  2AWG A;  1YAT A;  2F2D A;  4ODQ A;  3TCZ A;  4JFJ A;  1FKI A;  4ODO A;  2KFW A;  1F40 A;  1FKD A;  3O5E A;  4U85 A;  5BXJ A;  3O5Q A;  4JYS A;  3GPK A;  4LAW A;  3OOB A;  4TX0 A;  1FKK A;  1P5Q A;  2UZ5 A;  1ZK6 A;  2ZR5 A;  4LAY A;  4J4O A;  4DRI A;  4GGQ A;  5GPG A;  1EQ3 A;  1Q6I A;  4W9Q A;  4IPX A;  1N1A A;  4FN2 A;  3RGC A;  5DIV A;  5HT1 A;  2MPH A;  2PBC A;  2PV2 A;  2Q5A A;  3O5K A;  4ODP A;  5DIT A;  3KAH A;  3O5R A;  2FKE A;  4NNR A;  4DRM A;  3UI6 A;  2XP7 A;  2MLY A;  1U79 A;  1QZ2 A;  2PV1 A;  4TW6 A;  4W9O A;  4DRH A;  3ODK A;  4R0X A;  4ITZ A;  4U84 A;  1J4I A;  2ZQT A;  3CGN A;  1PIN A;  2MLX A;  4JFM A;  2XP5 A;  4DRP A;  1D6O A;  4G50 A;  2KR7 A;  3EY6 A;  3IK8 A;  3O5P A;  3UI4 A;  5HW7 A;  2XP8 A;  5J6E A;  1NMW A;  2L2S A;  1QPL A;  3B7X A;  3IHZ A;  2XP9 A;  1J6Y A;  2PPP A;  3O5F A;  4ODR A;  3IKG A;  4TW8 A;  2N87 A;  4BF8 A;  3NTP A;  5HW8 A;  4IQC A;  4QIB A;  4DRQ A;  4DZ2 A;  1Q6H A;  3KCE A;  5B8I C;  5HKG A;  3JYJ A;  4DT4 A;  1ROU A;  1D7J A;  1Q1C A;  2DG9 A;  3UI5 A;  4N19 A;  3UQB A;  3O5M A;  3TDB A;  4DIP A;  4DRK A;  3UQA A; 
#chains in the Genus database with same CATH topology
 3VAW A;  4MGV A;  3PRA A;  1FJD A;  1SYT A;  4LAV A;  1W26 A;  3WQV A;  1F8A B;  3ALG A;  4ODL A;  3ARO A;  1JNS A;  2KE0 A;  2DT1 A;  2B5U B;  2LPV A;  3G6L A;  3PA7 A;  4TNS A;  3KAD A;  2MLZ A;  2DG3 A;  2D9F A;  4IT4 A;  2EUL A;  3KAB A;  1SR0 A;  4JFL A;  2RUQ A;  1Y0O A;  4TYO A;  5HTG A;  3BMB A;  2XP3 A;  3JYM A;  1K9T A;  3B9A A;  4GIV A;  3W4R A;  1W9U A;  1JNT A;  3B8S A;  2PPN A;  3PR9 A;  4MNM A;  4ODM A;  4MNJ A;  4ZS6 A;  4WKH A;  4DH0 A;  4MNK A;  2M2A A;  2RQS A;  3TC5 A;  2DG4 A;  1NSG A;  3WD3 A;  1EYM A;  1ITX A;  1HXV A;  1FFQ A;  4WK9 A;  1FKF A;  1J4R A;  1ZCN A;  1H0I A;  2XPB A;  4IT6 A;  1D7H A;  1JVW A;  3CHC A;  4G2P A;  5GPR A;  4ZPV R;  1E6Z A;  4ODQ A;  2PI6 A;  2IUZ A;  1FKI A;  1NWU A;  2KFW A;  4JFJ A;  5BXJ A;  3GPK A;  4LAW A;  1LJY A;  2ZR5 A;  3ARQ A;  1TFV A;  4W9Q A;  4LGX A;  1W9P A;  3GTY X;  5DIV A;  2PBC A;  2Q5A A;  4UDM A;  2DT3 A;  5DEZ A;  3RM8 A;  3BXW A;  4ITZ A;  4U84 A;  3CHF A;  1J4I A;  1WAW A;  2ZQT A;  3G6M A;  1HKK A;  2KR7 A;  1E6P A;  2XP8 A;  5J6E A;  1NMW A;  4ZPT R;  2L2S A;  1QPL A;  3OA5 A;  1OWQ A;  4PTM A;  3CHE A;  5B8I C;  3KCE A;  1E6N A;  1ROU A;  1D7J A;  1Q1C A;  2DG9 A;  3AS1 A;  3UI5 A;  3TDB A;  3AQU A;  3ARY A;  1ROT A;  1OGG A;  4AY1 A;  3MDY B;  1HKJ A;  3CHD A;  4Z2I A;  1BKF A;  3O5L A;  1FKG A;  2WM0 A;  5HWB A;  2YBU A;  1R9H A;  4QT3 A;  2RUD A;  1NH6 A;  2XPA A;  4ZPW R;  2FAP A;  2KI3 A;  3PRD A;  3WKZ A;  3O5D A;  4JFK A;  4P8V A;  2IF4 A;  1B6C A;  3ALF A;  4MNL A;  1FKB A;  4NZC A;  3RFW A;  4HBO A;  3ART A;  2VCD A;  3O5J A;  1LQ0 A;  1Q6U A;  4LAX A;  2DSU A;  2ZR6 A;  5HWC A;  1FKJ A;  1KFW A;  1CTN A;  2VN1 A;  4Z2H A;  3FAP A;  2PV3 A;  2RUC A;  1FKS A;  4DRJ A;  3KAC A;  1NMV A;  3CZ8 A;  1LL7 A;  3RM9 A;  3WD0 A;  4Z2J A;  1RD6 A;  3GU0 A;  1NWS A;  3UF8 A;  1OGB A;  3JXV A;  1FKH A;  4R5E A;  1FAP A;  1YW5 A;  1J4H A;  2MF9 A;  1HKM A;  3UQI A;  4XAK A;  1WB0 A;  2A3B A;  2ZQU A;  1ZBC A;  1XRV A;  2F2D A;  4ODO A;  1F40 A;  1FKD A;  4JYS A;  4DWS A;  4TX0 A;  3ARZ A;  4GGQ A;  1UR9 A;  4DWS C;  5HT1 A;  3B9D A;  2DSV A;  5DIT A;  1XHG A;  4NNR A;  4DRM A;  2FKE A;  2DPE A;  2MLY A;  4W9O A;  3RME A;  2G41 A;  1W1P A;  4R0X A;  2OLH A;  2MLX A;  4JFM A;  4Q7N A;  3O5P A;  3RM4 A;  3AS0 A;  3B9E A;  1ZBK A;  3IHZ A;  1E44 A;  2XP9 A;  1ZU8 A;  4ODR A;  4BF8 A;  3WD2 A;  2A3C A;  4DRQ A;  4DZ2 A;  5HKG A;  4N19 A;  3O5M A;  1E9L A;  4DRK A;  3ARX A;  3H9R B;  3AS3 A;  4ODN A;  1W1T A;  2RSE A;  4MTV A;  4ODK A;  3O5O A;  5GQB A;  3O5G A;  4DWS D;  2LJ4 A;  3KZ7 A;  1HJW A;  4WKA A;  1FD9 A;  1TCO C;  1JND A;  4TW7 A;  2PN0 A;  4MSP A;  1T11 A;  4U86 A;  1NWT A;  1UR8 A;  4JFI A;  3KAG A;  4DZ3 A;  2ITK A;  3EIP A;  2DSZ A;  3O5I A;  3CH9 A;  2WLY A;  3WL1 A;  2PPO A;  2JZV A;  1BL4 A;  2WK2 A;  2F4E A;  2ZQS A;  1GPF A;  1L1P A;  2DT2 A;  1D7I A;  4W9P A;  2O92 A;  3WQW A;  2ZR4 A;  1KT0 A;  2KGJ A;  1QPF A;  3QOK A;  2QF8 A;  2XP4 A;  2RUR A;  5DF0 A;  3FY1 A;  1EHN A;  3KAF A;  4WJX A;  4IQ2 A;  4KR0 B;  1EIB A;  4MPK A;  2KO7 A;  3TCZ A;  1W1Y A;  4U85 A;  3O5Q A;  1FKK A;  2UZ5 A;  4LAY A;  1ZK6 A;  1D2K A;  1O6I A;  5DO2 A;  3RGC A;  4ODP A;  4P8X A;  3KAH A;  3O5R A;  2XP7 A;  1U79 A;  1QZ2 A;  2PV1 A;  4TW6 A;  3ODK A;  1E6R A;  1EDQ A;  3WD1 A;  2DSW A;  2YBT A;  4DRP A;  1D6O A;  4KQZ A;  3EY6 A;  3IK8 A;  3UI4 A;  3B7X A;  1LG2 A;  1X6L A;  2O9O A;  3O5F A;  1J6Y A;  4TW8 A;  3IKG A;  2AOS A;  2N87 A;  1GOI A;  3AS2 A;  4IQC A;  3ARV A;  1W1V A;  3JYJ A;  1JCH B;  4DT4 A;  3ARU A;  1NWR A;  4DWS B;  1ZBV A;  1HJX A;  2WLZ A;  5D75 A;  4L72 B;  1FKR A;  2DT0 A;  3WH0 A;  4FAP A;  3ARS A;  1KT1 A;  3IKD A;  1HJV A;  3ARW A;  1E15 A;  2LKN A;  1W9V A;  1LL4 A;  5HUA A;  4HAR A;  3ARR A;  5HW6 A;  1WNO A;  5JH8 A;  4ML4 A;  2XP6 A;  1IX5 A;  2ESC A;  4DRO A;  1HKI A;  3CGM A;  5HBF A;  1FKL A;  3NI6 A;  1H0G A;  5DIU A;  2MNT A;  1X6N A;  3KAI A;  2A3E A;  3PRB A;  1A7X A;  3I6C A;  2F21 A;  4J4N A;  4HBE A;  1C9H A;  1FKT A;  3NRK A;  4P8W A;  1LG1 A;  2P4V A;  1PBK A;  2ZQV A;  2ETN A;  2K8I A;  2FDM A;  4C02 B;  4DRN A;  2OFN A;  2LGO A;  4MAV A;  2Y78 A;  3LUO A;  2M08 A;  3WIJ A;  3ARP A;  1FFR A;  5I98 A;  2A3A A;  1GRJ A;  3WL0 A;  1VF8 A;  4QT2 A;  1ZBW A;  1ZB5 A;  4O2T A;  2M1I A;  1M5Y A;  1LL6 A;  4L3N A;  2AWG A;  1YAT A;  4WKF A;  4Q22 A;  1ZL1 A;  3O5E A;  4P8U A;  4NSB A;  2G8Z A;  4QZV B;  4WIW A;  3OOB A;  4Z2G A;  1P5Q A;  4J4O A;  2B31 A;  4DRI A;  5GPG A;  1EQ3 A;  1Q6I A;  4IPX A;  1JNE A;  1N1A A;  4FN2 A;  2MPH A;  2PV2 A;  3O5K A;  3WD4 A;  3UI6 A;  4DRH A;  4URI A;  3FXY A;  3CGN A;  1GUV A;  1PIN A;  2XP5 A;  4G50 A;  4S3J A;  5HW7 A;  4W5U A;  4S3K A;  2PPP A;  3NTP A;  5HW8 A;  4QIB A;  1Q6H A;  2F23 A;  4Z2L A;  4Z2K A;  3UQB A;  4DIP A;  3UQA A; 
#chains in the Genus database with same CATH homology
 3VAW A;  4MGV A;  3PRA A;  1FJD A;  1SYT A;  4LAV A;  1W26 A;  3WQV A;  1F8A B;  3ALG A;  4ODL A;  3ARO A;  1JNS A;  2KE0 A;  2DT1 A;  2LPV A;  3G6L A;  3PA7 A;  4TNS A;  3KAD A;  2MLZ A;  2DG3 A;  2D9F A;  4IT4 A;  3KAB A;  1SR0 A;  4JFL A;  2RUQ A;  1Y0O A;  4TYO A;  5HTG A;  2XP3 A;  3JYM A;  1K9T A;  3B9A A;  4GIV A;  3W4R A;  1W9U A;  1JNT A;  3B8S A;  2PPN A;  3PR9 A;  4MNM A;  4ODM A;  4MNJ A;  4ZS6 A;  4WKH A;  4DH0 A;  4MNK A;  2M2A A;  2RQS A;  3TC5 A;  2DG4 A;  1NSG A;  3WD3 A;  1EYM A;  1ITX A;  1HXV A;  1FFQ A;  4WK9 A;  1FKF A;  1J4R A;  1ZCN A;  1H0I A;  2XPB A;  4IT6 A;  1D7H A;  1JVW A;  3CHC A;  4G2P A;  5GPR A;  4ZPV R;  1E6Z A;  4ODQ A;  2PI6 A;  2IUZ A;  1FKI A;  1NWU A;  2KFW A;  4JFJ A;  5BXJ A;  3GPK A;  4LAW A;  1LJY A;  2ZR5 A;  3ARQ A;  1TFV A;  4W9Q A;  4LGX A;  1W9P A;  5DIV A;  2PBC A;  2Q5A A;  2DT3 A;  5DEZ A;  3RM8 A;  3BXW A;  4ITZ A;  4U84 A;  3CHF A;  1J4I A;  1WAW A;  2ZQT A;  3G6M A;  1HKK A;  2KR7 A;  1E6P A;  2XP8 A;  5J6E A;  1NMW A;  4ZPT R;  2L2S A;  1QPL A;  3OA5 A;  1OWQ A;  4PTM A;  3CHE A;  5B8I C;  3KCE A;  1E6N A;  1ROU A;  1D7J A;  1Q1C A;  2DG9 A;  3AS1 A;  3UI5 A;  3TDB A;  3AQU A;  3ARY A;  1ROT A;  1OGG A;  4AY1 A;  3MDY B;  1HKJ A;  3CHD A;  4Z2I A;  1BKF A;  3O5L A;  1FKG A;  2WM0 A;  5HWB A;  2YBU A;  1R9H A;  4QT3 A;  2RUD A;  1NH6 A;  2XPA A;  4ZPW R;  2FAP A;  2KI3 A;  3PRD A;  3WKZ A;  3O5D A;  4JFK A;  4P8V A;  2IF4 A;  1B6C A;  3ALF A;  4MNL A;  1FKB A;  4NZC A;  3RFW A;  4HBO A;  3ART A;  2VCD A;  3O5J A;  1LQ0 A;  1Q6U A;  4LAX A;  2DSU A;  2ZR6 A;  5HWC A;  1FKJ A;  1KFW A;  1CTN A;  2VN1 A;  4Z2H A;  3FAP A;  2PV3 A;  2RUC A;  1FKS A;  4DRJ A;  3KAC A;  1NMV A;  3CZ8 A;  1LL7 A;  3RM9 A;  3WD0 A;  4Z2J A;  1RD6 A;  1NWS A;  3UF8 A;  1OGB A;  3JXV A;  1FKH A;  4R5E A;  1FAP A;  1YW5 A;  1J4H A;  2MF9 A;  1HKM A;  3UQI A;  4XAK A;  1WB0 A;  2A3B A;  2ZQU A;  1ZBC A;  1XRV A;  2F2D A;  4ODO A;  1F40 A;  1FKD A;  4JYS A;  4DWS A;  4TX0 A;  3ARZ A;  4GGQ A;  1UR9 A;  4DWS C;  5HT1 A;  3B9D A;  2DSV A;  5DIT A;  1XHG A;  4NNR A;  4DRM A;  2FKE A;  2DPE A;  2MLY A;  4W9O A;  3RME A;  2G41 A;  1W1P A;  4R0X A;  2OLH A;  2MLX A;  4JFM A;  4Q7N A;  3O5P A;  3RM4 A;  3AS0 A;  3B9E A;  1ZBK A;  3IHZ A;  2XP9 A;  1ZU8 A;  4ODR A;  4BF8 A;  3WD2 A;  2A3C A;  4DRQ A;  4DZ2 A;  5HKG A;  4N19 A;  3O5M A;  1E9L A;  4DRK A;  3ARX A;  3H9R B;  3AS3 A;  4ODN A;  1W1T A;  2RSE A;  4MTV A;  4ODK A;  3O5O A;  5GQB A;  3O5G A;  4DWS D;  2LJ4 A;  3KZ7 A;  1HJW A;  4WKA A;  1FD9 A;  1TCO C;  1JND A;  4TW7 A;  4MSP A;  1T11 A;  4U86 A;  1NWT A;  1UR8 A;  4JFI A;  3KAG A;  4DZ3 A;  2ITK A;  2DSZ A;  3O5I A;  3CH9 A;  2WLY A;  3WL1 A;  2PPO A;  2JZV A;  1BL4 A;  2WK2 A;  2F4E A;  2ZQS A;  1GPF A;  1L1P A;  2DT2 A;  1D7I A;  4W9P A;  2O92 A;  3WQW A;  2ZR4 A;  1KT0 A;  2KGJ A;  1QPF A;  3QOK A;  2QF8 A;  2XP4 A;  2RUR A;  5DF0 A;  3FY1 A;  1EHN A;  3KAF A;  4WJX A;  4IQ2 A;  4KR0 B;  1EIB A;  4MPK A;  2KO7 A;  3TCZ A;  1W1Y A;  4U85 A;  3O5Q A;  1FKK A;  2UZ5 A;  4LAY A;  1ZK6 A;  1D2K A;  1O6I A;  5DO2 A;  3RGC A;  4ODP A;  4P8X A;  3KAH A;  3O5R A;  2XP7 A;  1U79 A;  1QZ2 A;  2PV1 A;  4TW6 A;  3ODK A;  1E6R A;  1EDQ A;  3WD1 A;  2DSW A;  2YBT A;  4DRP A;  1D6O A;  4KQZ A;  3EY6 A;  3IK8 A;  3UI4 A;  3B7X A;  1LG2 A;  1X6L A;  2O9O A;  3O5F A;  1J6Y A;  4TW8 A;  3IKG A;  2AOS A;  2N87 A;  1GOI A;  3AS2 A;  4IQC A;  3ARV A;  1W1V A;  3JYJ A;  4DT4 A;  3ARU A;  1NWR A;  4DWS B;  1ZBV A;  1HJX A;  2WLZ A;  5D75 A;  4L72 B;  1FKR A;  2DT0 A;  3WH0 A;  4FAP A;  3ARS A;  1KT1 A;  3IKD A;  1HJV A;  3ARW A;  1E15 A;  2LKN A;  1W9V A;  1LL4 A;  5HUA A;  4HAR A;  3ARR A;  5HW6 A;  1WNO A;  5JH8 A;  4ML4 A;  2XP6 A;  1IX5 A;  2ESC A;  4DRO A;  1HKI A;  3CGM A;  5HBF A;  1FKL A;  3NI6 A;  1H0G A;  5DIU A;  2MNT A;  1X6N A;  3KAI A;  2A3E A;  3PRB A;  1A7X A;  3I6C A;  2F21 A;  4J4N A;  4HBE A;  1C9H A;  1FKT A;  3NRK A;  4P8W A;  1LG1 A;  1PBK A;  2ZQV A;  2K8I A;  2FDM A;  4C02 B;  4DRN A;  2OFN A;  2LGO A;  4MAV A;  2Y78 A;  3LUO A;  2M08 A;  3WIJ A;  3ARP A;  1FFR A;  5I98 A;  2A3A A;  3WL0 A;  1VF8 A;  4QT2 A;  1ZBW A;  1ZB5 A;  4O2T A;  2M1I A;  1M5Y A;  1LL6 A;  4L3N A;  2AWG A;  1YAT A;  4WKF A;  4Q22 A;  1ZL1 A;  3O5E A;  4P8U A;  4NSB A;  2G8Z A;  4QZV B;  4WIW A;  3OOB A;  4Z2G A;  1P5Q A;  4J4O A;  2B31 A;  4DRI A;  5GPG A;  1EQ3 A;  1Q6I A;  4IPX A;  1JNE A;  1N1A A;  4FN2 A;  2MPH A;  2PV2 A;  3O5K A;  3WD4 A;  3UI6 A;  4DRH A;  4URI A;  3FXY A;  3CGN A;  1GUV A;  1PIN A;  2XP5 A;  4G50 A;  4S3J A;  5HW7 A;  4W5U A;  4S3K A;  2PPP A;  3NTP A;  5HW8 A;  4QIB A;  1Q6H A;  4Z2L A;  4Z2K A;  3UQB A;  4DIP A;  3UQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...