2FKEA

Fk-506-binding protein: three-dimensional structure of the complex with the antagonist l-685,818
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title FK-506-binding protein: three-dimensional structure of the complex with the antagonist L-685,818.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2fkeA00
3JYMA 3ODKA 2RUCA 2F21A 5B8IC 1EQ3A 4O2TA 1A7XA 5HUAA 2MF9A 4LAYA 2MLZA 4LAWA 4DRIA 4U85A 3O5PA 3OOBA 3TDBA 3PRDA 5D75A 1T11A 3IHZA 3UI4A 4DRQA 4GIVA 3FAPA 4GGQA 3KZ7A 1ROUA 3KAHA 4IQ2A 4LAVA 2RURA 2AWGA 4DT4A 3KAIA 2ZR5A 5HWCA 2MPHA 2ZQSA 4JYSA 4U84A 3O5EA 3PRBA 2KGJA 1D7JA 1Q6UA 3NI6A 1F8AB 3KABA 3LUOA 1FKTA 4W9PA 2RUQA 2Y78A 1NSGA 2D9FA 3UQIA 4FAPA 4ODNA 4ODQA 5HW7A 1PINA 3IK8A 4JFMA 1FKSA 2LPVA 1EYMA 1L1PA 3JYJA 1NMVA 3O5IA 4U86A 1FKHA 2PV1A 2VN1A 2FKEA 2XP4A 5HW6A 1J4HA 5GPGA 1F40A 1D7HA 2PV2A 4DRNA 2VCDA 2KR7A 2M08A 2OFNA 4ODLA 1R9HA 2ZR6A 3O5FA 4G50A 1QPLA 1QZ2A 2MNTA 2DG3A 2KE0A 2MLYA 1KT0A 3IKGA 2XP6A 4JFLA 2M2AA 4NNRA 4ODMA 4ITZA 1TCOC 2XP5A 1QPFA 4TW8A 1FAPA 4DRPA 1D6OA 1FD9A 2MLXA 2N87A 2ZQUA 5DIUA 4BF8A 4ODPA 3UI5A 1JNSA 4TX0A 4QT2A 4TW7A 2RQSA 4N19A 5DITA 1FKIA 5HWBA 4IPXA 4ODOA 2ZQVA 3O5GA 2JZVA 4LAXA 2RUDA 1JVWA 2XP7A 5HKGA 3O5KA 3UQBA 2XP8A 2FAPA 1M5YA 2ZR4A 4DRHA 2PPNA 3JXVA 1J4IA 1BKFA 1KT1A 3CGNA 1ZK6A 3O5RA 4DRMA 4IQCA 2UZ5A 3TCZA 1B6CA 1ROTA 5J6EA 3MDYB 1U79A 2ITKA 1YW5A 1FKLA 1FKGA 3O5OA 1FKFA 2PV3A 3IKDA 4JFIA 3KADA 3O5DA 4G2PA 3NRKA 4DZ3A 3O5LA 1FKBA 3RFWA 4FN2A 1ZCNA 2F4EA 3KAGA 3UQAA 3KACA 2PPPA 4QT3A 1YATA 2F2DA 3O5JA 4MGVA 2XP3A 2ZQTA 3VAWA 1Y0OA 1J6YA 1N1AA 1BL4A 2KO7A 1PBKA 4J4NA 1JNTA 1FKJA 4ODRA 1Q6IA 2K8IA 2KI3A 2RSEA 2XPBA 3B7XA 3EY6A 4JFJA 3I6CA 3O5MA 3H9RB 4DIPA 1HXVA 2DG4A 2IF4A 5HW8A 3TC5A 2LKNA 4JFKA 2PBCA 1D7IA 1FKKA 3CGMA 1NMWA 1W26A 4QIBA 3UF8A 4C02B 2LJ4A 3WH0A 3RGCA 1Q1CA 3KAFA 4DRKA 4TW6A 4W9OA 4DZ2A 1FJDA 1P5QA 3PA7A 1J4RA 4MSPA 2M1IA 4DH0A 5BXJA 4DROA 5I98A 3GPKA 3KCEA 4R0XA 1C9HA 3O5QA 2LGOA 2L2SA 2XPAA 3NTPA 4J4OA 5DIVA 5HTGA 2KFWA 2PPOA 4TNSA 2DG9A 2XP9A 4DRJA 4ODKA 1FKDA 3UI6A 1FKRA 1Q6HA 2Q5AA 5HT1A 4W9QA 4TYOA
chains in the Genus database with same CATH superfamily
1NH6A 1OGBA 2RUCA 1A7XA 1X6NA 2FDMA 1GPFA 3UI4A 1ZBCA 3FAPA 1ROUA 2RURA 4KQZA 3ARVA 3KAIA 4DWSB 1NWRA 3O5EA 3PRBA 4DIPA 1D7JA 1Q6UA 3KABA 4FAPA 1FKTA 4Z2GA 2RUQA 4WKFA 3B8SA 4JFMA 2LPVA 1E6RA 1FFQA 1IX5A 1W1TA 3RM9A 1J4HA 2WLYA 1GRJA 1LG1A 2ZR6A 2DG3A 2KE0A 2MLYA 3IKGA 2XP6A 4JFLA 2M2AA 1QPFA 1FAPA 1OGGA 4BF8A 3GTYX 4WIWA 1LJYA 4ODPA 2F23A 2B31A 3AROA 2ZQVA 1SYTA 3O5GA 2JZVA 2G41A 3ARTA 2B5UB 3JXVA 1J4IA 1ZK6A 5HBFA 1ROTA 4MNKA 3AS3A 5GQBA 1H0IA 1FKFA 3IKDA 3BXWA 4JFIA 4QZVB 2F4EA 3KAGA 3CZ8A 4QT3A 1YATA 2F2DA 1N1AA 4J4NA 1Q6IA 2RSEA 2XPBA 3B7XA 1LL4A 3H9RB 1FKKA 3CGMA 3WKZA 4C02B 2LJ4A 4P8UA 1Q1CA 4DRKA 4W9OA 1FJDA 1P5QA 1J4RA 4MSPA 2M1IA 5BXJA 4R0XA 1C9HA 3NTPA 4J4OA 4UDMA 1W1YA 2G8ZA 4DRJA 4Q22A 1FKRA 5GPRA 5HT1A 2DPEA 1ZBWA 2F21A 3CHCA 4DRIA 2AOSA 3EIPA 3PRDA 4GIVA 3ARPA 1LL6A 4LAVA 3G6LA 4ZPVR 4DWSD 2MPHA 2ZQSA 4U84A 3WL1A 1F8AB 5DEZA 1JCHB 1NSGA 3B9AA 3UQIA 3CHFA 1W1PA 3IK8A 2A3AA 3JYJA 1NMVA 3O5IA 1D7HA 2PV2A 4DRNA 4Z2JA 2M08A 2OFNA 1HKMA 1KT0A 4LGXA 4ODMA 1TCOC 1E6PA 4TW8A 3QOKA 1D6OA 2MLXA 2P4VA 1W9VA 3AS2A 3UI5A 1JNSA 4TX0A 4QT2A 4TW7A 5HWBA 3AS1A 4ODOA 4LAXA 2XP8A 2ZR4A 1RD6A 4R5EA 1BKFA 1NWTA 4DRMA 3TCZA 2DT3A 1B6CA 3ARSA 3W4RA 1U79A 4Z2KA 1YW5A 1NWSA 2PV3A 3ARRA 1XHGA 3NRKA 3O5LA 4HARA 4FN2A 1ZCNA 3UQAA 2EULA 1J6YA 2IUZA 1Y0OA 3WL0A 1BL4A 3PRAA 1FKJA 5DO2A 3G6MA 1GOIA 3EY6A 2DT2A 3B9DA 4IT4A 4JFKA 4NSBA 1D7IA 4P8XA 3ARWA 1HKKA 4Q7NA 3B9EA 4DH0A 1E15A 5I98A 1E6NA 2OLHA 2LGOA 2XPAA 5DIVA 2O92A 4TNSA 1H0GA 5DF0A 4MNLA 5B8IC 1UR9A 4O2TA 5HUAA 1ZBVA 3PR9A 2MLZA 3WD0A 4WK9A 4U85A 4L72B 3OOBA 5D75A 1T11A 3IHZA 4DRQA 1K9TA 1JNEA 3KAHA 4IQ2A 1EDQA 2QF8A 3VAWA 3WD2A 3NI6A 3WD1A 1KFWA 4WJXA 3AS0A 3WD3A 4ODQA 1W9UA 5HW7A 1WAWA 1L1PA 1FKSA 1WB0A 3RM8A 4MNMA 2PV1A 2VN1A 4MAVA 2FKEA 2XP4A 5HW6A 2WK2A 1F40A 2VCDA 2KR7A 4ODLA 4DT4A 1EIBA 4ML4A 4NNRA 2XP5A 4S3JA 1WNOA 2ZQUA 5DIUA 2PN0A 2RQSA 4N19A 1FKIA 4IPXA 1HJVA 1W9PA 4HBEA 5HKGA 3O5KA 3UQBA 4MPKA 2FAPA 2PI6A 1D2KA 1ITXA 4IQCA 2UZ5A 5J6EA 1XRVA 1HJXA 2ITKA 1FKLA 1FKGA 2A3EA 3KADA 3OA5A 2O9OA 4G2PA 1SR0A 1TFVA 3RFWA 3WQVA 5JH8A 3KACA 4MGVA 3ALFA 2XP3A 2ZQTA 1JNTA 3BMBA 2WLZA 2KI3A 3CH9A 4JFJA 4S3KA 2ESCA 1W1VA 3O5MA 4P8VA 2DG4A 3TC5A 2LKNA 3ARXA 2PBCA 1NMWA 4WKHA 3UF8A 1E44A 3RGCA 4TW6A 4NZCA 3PA7A 3WIJA 2YBTA 3CHEA 4HBOA 4DROA 3GPKA 3KCEA 1E6ZA 3O5QA 2ETNA 3ARUA 5HTGA 2DG9A 2XP9A 3UI6A 3ALGA 1HJWA 1Q6HA 3JYMA 3ODKA 1ZL1A 4KR0B 2YBUA 1EQ3A 4MNJA 1ZBKA 2MF9A 4LAYA 4LAWA 4Z2HA 4WKAA 1O6IA 3O5PA 2DSZA 3ARQA 3TDBA 2DT0A 4GGQA 3KZ7A 4ZPTR 2AWGA 3RMEA 2ZR5A 5HWCA 4JYSA 2KGJA 3LUOA 4W9PA 2Y78A 2D9FA 4ODNA 1E9LA 1PINA 1EYMA 4U86A 1FKHA 4DWSA 4Z2LA 1NWUA 4XAKA 5GPGA 2DSWA 1R9HA 3O5FA 4G50A 1QPLA 1QZ2A 2MNTA 1HKIA 4ITZA 2WM0A 3FXYA 4PTMA 4DRPA 1FD9A 2N87A 5DITA 3FY1A 3GU0A 1FFRA 2RUDA 1JVWA 2XP7A 3RM4A 1GUVA 3CHDA 3AQUA 1M5YA 4DRHA 2PPNA 1HKJA 1UR8A 1KT1A 3CGNA 3O5RA 1X6LA 1EHNA 3MDYB 4L3NA 3O5OA 1LL7A 4URIA 3ARYA 4DZ3A 3O5DA 4DWSC 1JNDA 1FKBA 4P8WA 2PPPA 1ZB5A 3O5JA 4W5UA 2DSVA 2KO7A 1PBKA 1CTNA 1ZU8A 4ODRA 4MTVA 2K8IA 1VF8A 1LQ0A 3I6CA 1HXVA 1LG2A 2IF4A 5HW8A 2A3CA 1W26A 4QIBA 1OWQA 3WH0A 3KAFA 4DZ2A 2DT1A 4ZS6A 3WQWA 4ZPWR 2A3BA 4Z2IA 2L2SA 3WD4A 4IT6A 2KFWA 2PPOA 4ODKA 4AY1A 1FKDA 3ARZA 2Q5AA 4W9QA 2DSUA 4TYOA
chains in the Genus database with same CATH topology
1NH6A 1OGBA 2RUCA 1A7XA 1X6NA 2FDMA 1GPFA 3UI4A 1ZBCA 3FAPA 1ROUA 2RURA 4KQZA 3ARVA 3KAIA 4DWSB 1NWRA 3O5EA 3PRBA 4DIPA 1D7JA 1Q6UA 3KABA 4FAPA 1FKTA 4Z2GA 2RUQA 4WKFA 3B8SA 4JFMA 2LPVA 1E6RA 1FFQA 1IX5A 1W1TA 3RM9A 1J4HA 2WLYA 1LG1A 2ZR6A 2DG3A 2KE0A 2MLYA 3IKGA 2XP6A 4JFLA 2M2AA 1QPFA 1FAPA 1OGGA 4BF8A 4WIWA 1LJYA 4ODPA 2B31A 3AROA 2ZQVA 1SYTA 3O5GA 2JZVA 2G41A 3ARTA 3JXVA 1J4IA 1ZK6A 5HBFA 1ROTA 4MNKA 3AS3A 5GQBA 1H0IA 1FKFA 3IKDA 3BXWA 4JFIA 4QZVB 2F4EA 3KAGA 3CZ8A 4QT3A 1YATA 2F2DA 1N1AA 4J4NA 1Q6IA 2RSEA 2XPBA 3B7XA 1LL4A 3H9RB 1FKKA 3CGMA 3WKZA 4C02B 2LJ4A 4P8UA 1Q1CA 4DRKA 4W9OA 1FJDA 1P5QA 1J4RA 4MSPA 2M1IA 5BXJA 4R0XA 1C9HA 3NTPA 4J4OA 1W1YA 2G8ZA 4DRJA 4Q22A 1FKRA 5GPRA 5HT1A 2DPEA 1ZBWA 2F21A 3CHCA 4DRIA 2AOSA 3PRDA 4GIVA 3ARPA 1LL6A 4LAVA 3G6LA 4ZPVR 4DWSD 2MPHA 2ZQSA 4U84A 3WL1A 1F8AB 5DEZA 3UQIA 1NSGA 3B9AA 3CHFA 1W1PA 3IK8A 2A3AA 3JYJA 1NMVA 3O5IA 1D7HA 2PV2A 4DRNA 4Z2JA 2M08A 2OFNA 1HKMA 1KT0A 4LGXA 4ODMA 1TCOC 1E6PA 4TW8A 3QOKA 1D6OA 2MLXA 1W9VA 3AS2A 3UI5A 1JNSA 4TX0A 4QT2A 4TW7A 5HWBA 3AS1A 4ODOA 4LAXA 2XP8A 2ZR4A 1RD6A 4R5EA 1BKFA 1NWTA 4DRMA 3TCZA 2DT3A 1B6CA 3ARSA 3W4RA 1U79A 4Z2KA 1YW5A 1NWSA 2PV3A 3ARRA 1XHGA 3NRKA 3O5LA 4HARA 4FN2A 1ZCNA 3UQAA 1J6YA 2IUZA 1Y0OA 3WL0A 1BL4A 3PRAA 1FKJA 5DO2A 3G6MA 1GOIA 3EY6A 2DT2A 3B9DA 4IT4A 4JFKA 4NSBA 1D7IA 4P8XA 3ARWA 1HKKA 4Q7NA 3B9EA 4DH0A 1E15A 5I98A 1E6NA 2OLHA 2LGOA 2XPAA 5DIVA 2O92A 4TNSA 1H0GA 5DF0A 4MNLA 5B8IC 1UR9A 4O2TA 5HUAA 1ZBVA 3PR9A 2MLZA 3WD0A 4WK9A 4U85A 4L72B 3OOBA 5D75A 1T11A 3IHZA 4DRQA 1K9TA 1JNEA 3KAHA 4IQ2A 1EDQA 2QF8A 3VAWA 3WD2A 3NI6A 3WD1A 1KFWA 4WJXA 3AS0A 3WD3A 4ODQA 1W9UA 5HW7A 1WAWA 1L1PA 1FKSA 1WB0A 3RM8A 4MNMA 2PV1A 2VN1A 4MAVA 2FKEA 2XP4A 5HW6A 2WK2A 1F40A 2VCDA 2KR7A 4ODLA 4DT4A 1EIBA 4ML4A 4NNRA 2XP5A 4S3JA 1WNOA 2ZQUA 5DIUA 2RQSA 4N19A 1FKIA 4IPXA 1HJVA 1W9PA 4HBEA 5HKGA 3O5KA 3UQBA 4MPKA 2FAPA 2PI6A 1D2KA 1ITXA 4IQCA 2UZ5A 5J6EA 1XRVA 1HJXA 2ITKA 1FKLA 1FKGA 2A3EA 3KADA 3OA5A 2O9OA 4G2PA 1SR0A 1TFVA 3RFWA 3WQVA 5JH8A 3KACA 4MGVA 3ALFA 2XP3A 2ZQTA 1JNTA 2WLZA 2KI3A 3CH9A 4JFJA 4S3KA 2ESCA 1W1VA 3O5MA 4P8VA 2DG4A 3TC5A 2LKNA 3ARXA 2PBCA 1NMWA 4WKHA 3UF8A 3RGCA 4TW6A 4NZCA 3PA7A 3WIJA 2YBTA 3CHEA 4HBOA 4DROA 3GPKA 3KCEA 1E6ZA 3O5QA 3ARUA 5HTGA 2DG9A 2XP9A 3UI6A 3ALGA 1HJWA 1Q6HA 3JYMA 3ODKA 1ZL1A 4KR0B 2YBUA 1EQ3A 4MNJA 1ZBKA 2MF9A 4LAYA 4LAWA 4Z2HA 4WKAA 1O6IA 3O5PA 2DSZA 3ARQA 3TDBA 2DT0A 4GGQA 3KZ7A 4ZPTR 2AWGA 3RMEA 2ZR5A 5HWCA 4JYSA 2KGJA 3LUOA 4W9PA 2Y78A 2D9FA 4ODNA 1E9LA 1PINA 1EYMA 4U86A 1FKHA 4DWSA 4Z2LA 1NWUA 4XAKA 5GPGA 2DSWA 1R9HA 3O5FA 4G50A 1QPLA 1QZ2A 2MNTA 1HKIA 4ITZA 2WM0A 3FXYA 4PTMA 4DRPA 1FD9A 2N87A 5DITA 3FY1A 1FFRA 2RUDA 1JVWA 2XP7A 3RM4A 1GUVA 3CHDA 3AQUA 1M5YA 4DRHA 2PPNA 1HKJA 1UR8A 1KT1A 3CGNA 3O5RA 1X6LA 1EHNA 3MDYB 4L3NA 3O5OA 1LL7A 4URIA 3ARYA 4DZ3A 3O5DA 4DWSC 1JNDA 1FKBA 4P8WA 2PPPA 1ZB5A 3O5JA 4W5UA 2DSVA 2KO7A 1PBKA 1CTNA 1ZU8A 4ODRA 4MTVA 2K8IA 1VF8A 1LQ0A 3I6CA 1HXVA 1LG2A 2IF4A 5HW8A 2A3CA 1W26A 4QIBA 1OWQA 3WH0A 3KAFA 4DZ2A 2DT1A 4ZS6A 3WQWA 4ZPWR 2A3BA 4Z2IA 2L2SA 3WD4A 4IT6A 2KFWA 2PPOA 4ODKA 4AY1A 1FKDA 3ARZA 2Q5AA 4W9QA 2DSUA 4TYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYM A;  3ODK A;  2RUC A;  2F21 A;  5B8I C;  1EQ3 A;  4O2T A;  1A7X A;  5HUA A;  2MF9 A;  4LAY A;  2MLZ A;  4LAW A;  4DRI A;  4U85 A;  3O5P A;  3OOB A;  3TDB A;  3PRD A;  5D75 A;  1T11 A;  3IHZ A;  3UI4 A;  4DRQ A;  4GIV A;  3FAP A;  4GGQ A;  3KZ7 A;  1ROU A;  3KAH A;  4IQ2 A;  4LAV A;  2RUR A;  2AWG A;  4DT4 A;  3KAI A;  2ZR5 A;  5HWC A;  2MPH A;  2ZQS A;  4JYS A;  4U84 A;  3O5E A;  3PRB A;  2KGJ A;  1D7J A;  1Q6U A;  3NI6 A;  1F8A B;  3KAB A;  3LUO A;  1FKT A;  4W9P A;  2RUQ A;  2Y78 A;  1NSG A;  2D9F A;  3UQI A;  4FAP A;  4ODN A;  4ODQ A;  5HW7 A;  1PIN A;  3IK8 A;  4JFM A;  1FKS A;  2LPV A;  1EYM A;  1L1P A;  3JYJ A;  1NMV A;  3O5I A;  4U86 A;  1FKH A;  2PV1 A;  2VN1 A;  2FKE A;  2XP4 A;  5HW6 A;  1J4H A;  5GPG A;  1F40 A;  1D7H A;  2PV2 A;  4DRN A;  2VCD A;  2KR7 A;  2M08 A;  2OFN A;  4ODL A;  1R9H A;  2ZR6 A;  3O5F A;  4G50 A;  1QPL A;  1QZ2 A;  2MNT A;  2DG3 A;  2KE0 A;  2MLY A;  1KT0 A;  3IKG A;  2XP6 A;  4JFL A;  2M2A A;  4NNR A;  4ODM A;  4ITZ A;  1TCO C;  2XP5 A;  1QPF A;  4TW8 A;  1FAP A;  4DRP A;  1D6O A;  1FD9 A;  2MLX A;  2N87 A;  2ZQU A;  5DIU A;  4BF8 A;  4ODP A;  3UI5 A;  1JNS A;  4TX0 A;  4QT2 A;  4TW7 A;  2RQS A;  4N19 A;  5DIT A;  1FKI A;  5HWB A;  4IPX A;  4ODO A;  2ZQV A;  3O5G A;  2JZV A;  4LAX A;  2RUD A;  1JVW A;  2XP7 A;  5HKG A;  3O5K A;  3UQB A;  2XP8 A;  2FAP A;  1M5Y A;  2ZR4 A;  4DRH A;  2PPN A;  3JXV A;  1J4I A;  1BKF A;  1KT1 A;  3CGN A;  1ZK6 A;  3O5R A;  4DRM A;  4IQC A;  2UZ5 A;  3TCZ A;  1B6C A;  1ROT A;  5J6E A;  3MDY B;  1U79 A;  2ITK A;  1YW5 A;  1FKL A;  1FKG A;  3O5O A;  1FKF A;  2PV3 A;  3IKD A;  4JFI A;  3KAD A;  3O5D A;  4G2P A;  3NRK A;  4DZ3 A;  3O5L A;  1FKB A;  3RFW A;  4FN2 A;  1ZCN A;  2F4E A;  3KAG A;  3UQA A;  3KAC A;  2PPP A;  4QT3 A;  1YAT A;  2F2D A;  3O5J A;  4MGV A;  2XP3 A;  2ZQT A;  3VAW A;  1Y0O A;  1J6Y A;  1N1A A;  1BL4 A;  2KO7 A;  1PBK A;  4J4N A;  1JNT A;  1FKJ A;  4ODR A;  1Q6I A;  2K8I A;  2KI3 A;  2RSE A;  2XPB A;  3B7X A;  3EY6 A;  4JFJ A;  3I6C A;  3O5M A;  3H9R B;  4DIP A;  1HXV A;  2DG4 A;  2IF4 A;  5HW8 A;  3TC5 A;  2LKN A;  4JFK A;  2PBC A;  1D7I A;  1FKK A;  3CGM A;  1NMW A;  1W26 A;  4QIB A;  3UF8 A;  4C02 B;  2LJ4 A;  3WH0 A;  3RGC A;  1Q1C A;  3KAF A;  4DRK A;  4TW6 A;  4W9O A;  4DZ2 A;  1FJD A;  1P5Q A;  3PA7 A;  1J4R A;  4MSP A;  2M1I A;  4DH0 A;  5BXJ A;  4DRO A;  5I98 A;  3GPK A;  3KCE A;  4R0X A;  1C9H A;  3O5Q A;  2LGO A;  2L2S A;  2XPA A;  3NTP A;  4J4O A;  5DIV A;  5HTG A;  2KFW A;  2PPO A;  4TNS A;  2DG9 A;  2XP9 A;  4DRJ A;  4ODK A;  1FKD A;  3UI6 A;  1FKR A;  1Q6H A;  2Q5A A;  5HT1 A;  4W9Q A;  4TYO A; 
#chains in the Genus database with same CATH topology
 1NH6 A;  1OGB A;  2RUC A;  1A7X A;  1X6N A;  2FDM A;  1GPF A;  3UI4 A;  1ZBC A;  3FAP A;  1ROU A;  2RUR A;  4KQZ A;  3ARV A;  3KAI A;  4DWS B;  1NWR A;  3O5E A;  3PRB A;  4DIP A;  1D7J A;  1Q6U A;  3KAB A;  4FAP A;  1FKT A;  4Z2G A;  2RUQ A;  4WKF A;  3B8S A;  4JFM A;  2LPV A;  1E6R A;  1FFQ A;  1IX5 A;  1W1T A;  3RM9 A;  1J4H A;  2WLY A;  1GRJ A;  1LG1 A;  2ZR6 A;  2DG3 A;  2KE0 A;  2MLY A;  3IKG A;  2XP6 A;  4JFL A;  2M2A A;  1QPF A;  1FAP A;  1OGG A;  4BF8 A;  3GTY X;  4WIW A;  1LJY A;  4ODP A;  2F23 A;  2B31 A;  3ARO A;  2ZQV A;  1SYT A;  3O5G A;  2JZV A;  2G41 A;  3ART A;  2B5U B;  3JXV A;  1J4I A;  1ZK6 A;  5HBF A;  1ROT A;  4MNK A;  3AS3 A;  5GQB A;  1H0I A;  1FKF A;  3IKD A;  3BXW A;  4JFI A;  4QZV B;  2F4E A;  3KAG A;  3CZ8 A;  4QT3 A;  1YAT A;  2F2D A;  1N1A A;  4J4N A;  1Q6I A;  2RSE A;  2XPB A;  3B7X A;  1LL4 A;  3H9R B;  1FKK A;  3CGM A;  3WKZ A;  4C02 B;  2LJ4 A;  4P8U A;  1Q1C A;  4DRK A;  4W9O A;  1FJD A;  1P5Q A;  1J4R A;  4MSP A;  2M1I A;  5BXJ A;  4R0X A;  1C9H A;  3NTP A;  4J4O A;  4UDM A;  1W1Y A;  2G8Z A;  4DRJ A;  4Q22 A;  1FKR A;  5GPR A;  5HT1 A;  2DPE A;  1ZBW A;  2F21 A;  3CHC A;  4DRI A;  2AOS A;  3EIP A;  3PRD A;  4GIV A;  3ARP A;  1LL6 A;  4LAV A;  3G6L A;  4ZPV R;  4DWS D;  2MPH A;  2ZQS A;  4U84 A;  3WL1 A;  1F8A B;  5DEZ A;  1JCH B;  1NSG A;  3B9A A;  3UQI A;  3CHF A;  1W1P A;  3IK8 A;  2A3A A;  3JYJ A;  1NMV A;  3O5I A;  1D7H A;  2PV2 A;  4DRN A;  4Z2J A;  2M08 A;  2OFN A;  1HKM A;  1KT0 A;  4LGX A;  4ODM A;  1TCO C;  1E6P A;  4TW8 A;  3QOK A;  1D6O A;  2MLX A;  2P4V A;  1W9V A;  3AS2 A;  3UI5 A;  1JNS A;  4TX0 A;  4QT2 A;  4TW7 A;  5HWB A;  3AS1 A;  4ODO A;  4LAX A;  2XP8 A;  2ZR4 A;  1RD6 A;  4R5E A;  1BKF A;  1NWT A;  4DRM A;  3TCZ A;  2DT3 A;  1B6C A;  3ARS A;  3W4R A;  1U79 A;  4Z2K A;  1YW5 A;  1NWS A;  2PV3 A;  3ARR A;  1XHG A;  3NRK A;  3O5L A;  4HAR A;  4FN2 A;  1ZCN A;  3UQA A;  2EUL A;  1J6Y A;  2IUZ A;  1Y0O A;  3WL0 A;  1BL4 A;  3PRA A;  1FKJ A;  5DO2 A;  3G6M A;  1GOI A;  3EY6 A;  2DT2 A;  3B9D A;  4IT4 A;  4JFK A;  4NSB A;  1D7I A;  4P8X A;  3ARW A;  1HKK A;  4Q7N A;  3B9E A;  4DH0 A;  1E15 A;  5I98 A;  1E6N A;  2OLH A;  2LGO A;  2XPA A;  5DIV A;  2O92 A;  4TNS A;  1H0G A;  5DF0 A;  4MNL A;  5B8I C;  1UR9 A;  4O2T A;  5HUA A;  1ZBV A;  3PR9 A;  2MLZ A;  3WD0 A;  4WK9 A;  4U85 A;  4L72 B;  3OOB A;  5D75 A;  1T11 A;  3IHZ A;  4DRQ A;  1K9T A;  1JNE A;  3KAH A;  4IQ2 A;  1EDQ A;  2QF8 A;  3VAW A;  3WD2 A;  3NI6 A;  3WD1 A;  1KFW A;  4WJX A;  3AS0 A;  3WD3 A;  4ODQ A;  1W9U A;  5HW7 A;  1WAW A;  1L1P A;  1FKS A;  1WB0 A;  3RM8 A;  4MNM A;  2PV1 A;  2VN1 A;  4MAV A;  2FKE A;  2XP4 A;  5HW6 A;  2WK2 A;  1F40 A;  2VCD A;  2KR7 A;  4ODL A;  4DT4 A;  1EIB A;  4ML4 A;  4NNR A;  2XP5 A;  4S3J A;  1WNO A;  2ZQU A;  5DIU A;  2PN0 A;  2RQS A;  4N19 A;  1FKI A;  4IPX A;  1HJV A;  1W9P A;  4HBE A;  5HKG A;  3O5K A;  3UQB A;  4MPK A;  2FAP A;  2PI6 A;  1D2K A;  1ITX A;  4IQC A;  2UZ5 A;  5J6E A;  1XRV A;  1HJX A;  2ITK A;  1FKL A;  1FKG A;  2A3E A;  3KAD A;  3OA5 A;  2O9O A;  4G2P A;  1SR0 A;  1TFV A;  3RFW A;  3WQV A;  5JH8 A;  3KAC A;  4MGV A;  3ALF A;  2XP3 A;  2ZQT A;  1JNT A;  3BMB A;  2WLZ A;  2KI3 A;  3CH9 A;  4JFJ A;  4S3K A;  2ESC A;  1W1V A;  3O5M A;  4P8V A;  2DG4 A;  3TC5 A;  2LKN A;  3ARX A;  2PBC A;  1NMW A;  4WKH A;  3UF8 A;  1E44 A;  3RGC A;  4TW6 A;  4NZC A;  3PA7 A;  3WIJ A;  2YBT A;  3CHE A;  4HBO A;  4DRO A;  3GPK A;  3KCE A;  1E6Z A;  3O5Q A;  2ETN A;  3ARU A;  5HTG A;  2DG9 A;  2XP9 A;  3UI6 A;  3ALG A;  1HJW A;  1Q6H A;  3JYM A;  3ODK A;  1ZL1 A;  4KR0 B;  2YBU A;  1EQ3 A;  4MNJ A;  1ZBK A;  2MF9 A;  4LAY A;  4LAW A;  4Z2H A;  4WKA A;  1O6I A;  3O5P A;  2DSZ A;  3ARQ A;  3TDB A;  2DT0 A;  4GGQ A;  3KZ7 A;  4ZPT R;  2AWG A;  3RME A;  2ZR5 A;  5HWC A;  4JYS A;  2KGJ A;  3LUO A;  4W9P A;  2Y78 A;  2D9F A;  4ODN A;  1E9L A;  1PIN A;  1EYM A;  4U86 A;  1FKH A;  4DWS A;  4Z2L A;  1NWU A;  4XAK A;  5GPG A;  2DSW A;  1R9H A;  3O5F A;  4G50 A;  1QPL A;  1QZ2 A;  2MNT A;  1HKI A;  4ITZ A;  2WM0 A;  3FXY A;  4PTM A;  4DRP A;  1FD9 A;  2N87 A;  5DIT A;  3FY1 A;  3GU0 A;  1FFR A;  2RUD A;  1JVW A;  2XP7 A;  3RM4 A;  1GUV A;  3CHD A;  3AQU A;  1M5Y A;  4DRH A;  2PPN A;  1HKJ A;  1UR8 A;  1KT1 A;  3CGN A;  3O5R A;  1X6L A;  1EHN A;  3MDY B;  4L3N A;  3O5O A;  1LL7 A;  4URI A;  3ARY A;  4DZ3 A;  3O5D A;  4DWS C;  1JND A;  1FKB A;  4P8W A;  2PPP A;  1ZB5 A;  3O5J A;  4W5U A;  2DSV A;  2KO7 A;  1PBK A;  1CTN A;  1ZU8 A;  4ODR A;  4MTV A;  2K8I A;  1VF8 A;  1LQ0 A;  3I6C A;  1HXV A;  1LG2 A;  2IF4 A;  5HW8 A;  2A3C A;  1W26 A;  4QIB A;  1OWQ A;  3WH0 A;  3KAF A;  4DZ2 A;  2DT1 A;  4ZS6 A;  3WQW A;  4ZPW R;  2A3B A;  4Z2I A;  2L2S A;  3WD4 A;  4IT6 A;  2KFW A;  2PPO A;  4ODK A;  4AY1 A;  1FKD A;  3ARZ A;  2Q5A A;  4W9Q A;  2DSU A;  4TYO A; 
#chains in the Genus database with same CATH homology
 1NH6 A;  1OGB A;  2RUC A;  1A7X A;  1X6N A;  2FDM A;  1GPF A;  3UI4 A;  1ZBC A;  3FAP A;  1ROU A;  2RUR A;  4KQZ A;  3ARV A;  3KAI A;  4DWS B;  1NWR A;  3O5E A;  3PRB A;  4DIP A;  1D7J A;  1Q6U A;  3KAB A;  4FAP A;  1FKT A;  4Z2G A;  2RUQ A;  4WKF A;  3B8S A;  4JFM A;  2LPV A;  1E6R A;  1FFQ A;  1IX5 A;  1W1T A;  3RM9 A;  1J4H A;  2WLY A;  1LG1 A;  2ZR6 A;  2DG3 A;  2KE0 A;  2MLY A;  3IKG A;  2XP6 A;  4JFL A;  2M2A A;  1QPF A;  1FAP A;  1OGG A;  4BF8 A;  4WIW A;  1LJY A;  4ODP A;  2B31 A;  3ARO A;  2ZQV A;  1SYT A;  3O5G A;  2JZV A;  2G41 A;  3ART A;  3JXV A;  1J4I A;  1ZK6 A;  5HBF A;  1ROT A;  4MNK A;  3AS3 A;  5GQB A;  1H0I A;  1FKF A;  3IKD A;  3BXW A;  4JFI A;  4QZV B;  2F4E A;  3KAG A;  3CZ8 A;  4QT3 A;  1YAT A;  2F2D A;  1N1A A;  4J4N A;  1Q6I A;  2RSE A;  2XPB A;  3B7X A;  1LL4 A;  3H9R B;  1FKK A;  3CGM A;  3WKZ A;  4C02 B;  2LJ4 A;  4P8U A;  1Q1C A;  4DRK A;  4W9O A;  1FJD A;  1P5Q A;  1J4R A;  4MSP A;  2M1I A;  5BXJ A;  4R0X A;  1C9H A;  3NTP A;  4J4O A;  1W1Y A;  2G8Z A;  4DRJ A;  4Q22 A;  1FKR A;  5GPR A;  5HT1 A;  2DPE A;  1ZBW A;  2F21 A;  3CHC A;  4DRI A;  2AOS A;  3PRD A;  4GIV A;  3ARP A;  1LL6 A;  4LAV A;  3G6L A;  4ZPV R;  4DWS D;  2MPH A;  2ZQS A;  4U84 A;  3WL1 A;  1F8A B;  5DEZ A;  3UQI A;  1NSG A;  3B9A A;  3CHF A;  1W1P A;  3IK8 A;  2A3A A;  3JYJ A;  1NMV A;  3O5I A;  1D7H A;  2PV2 A;  4DRN A;  4Z2J A;  2M08 A;  2OFN A;  1HKM A;  1KT0 A;  4LGX A;  4ODM A;  1TCO C;  1E6P A;  4TW8 A;  3QOK A;  1D6O A;  2MLX A;  1W9V A;  3AS2 A;  3UI5 A;  1JNS A;  4TX0 A;  4QT2 A;  4TW7 A;  5HWB A;  3AS1 A;  4ODO A;  4LAX A;  2XP8 A;  2ZR4 A;  1RD6 A;  4R5E A;  1BKF A;  1NWT A;  4DRM A;  3TCZ A;  2DT3 A;  1B6C A;  3ARS A;  3W4R A;  1U79 A;  4Z2K A;  1YW5 A;  1NWS A;  2PV3 A;  3ARR A;  1XHG A;  3NRK A;  3O5L A;  4HAR A;  4FN2 A;  1ZCN A;  3UQA A;  1J6Y A;  2IUZ A;  1Y0O A;  3WL0 A;  1BL4 A;  3PRA A;  1FKJ A;  5DO2 A;  3G6M A;  1GOI A;  3EY6 A;  2DT2 A;  3B9D A;  4IT4 A;  4JFK A;  4NSB A;  1D7I A;  4P8X A;  3ARW A;  1HKK A;  4Q7N A;  3B9E A;  4DH0 A;  1E15 A;  5I98 A;  1E6N A;  2OLH A;  2LGO A;  2XPA A;  5DIV A;  2O92 A;  4TNS A;  1H0G A;  5DF0 A;  4MNL A;  5B8I C;  1UR9 A;  4O2T A;  5HUA A;  1ZBV A;  3PR9 A;  2MLZ A;  3WD0 A;  4WK9 A;  4U85 A;  4L72 B;  3OOB A;  5D75 A;  1T11 A;  3IHZ A;  4DRQ A;  1K9T A;  1JNE A;  3KAH A;  4IQ2 A;  1EDQ A;  2QF8 A;  3VAW A;  3WD2 A;  3NI6 A;  3WD1 A;  1KFW A;  4WJX A;  3AS0 A;  3WD3 A;  4ODQ A;  1W9U A;  5HW7 A;  1WAW A;  1L1P A;  1FKS A;  1WB0 A;  3RM8 A;  4MNM A;  2PV1 A;  2VN1 A;  4MAV A;  2FKE A;  2XP4 A;  5HW6 A;  2WK2 A;  1F40 A;  2VCD A;  2KR7 A;  4ODL A;  4DT4 A;  1EIB A;  4ML4 A;  4NNR A;  2XP5 A;  4S3J A;  1WNO A;  2ZQU A;  5DIU A;  2RQS A;  4N19 A;  1FKI A;  4IPX A;  1HJV A;  1W9P A;  4HBE A;  5HKG A;  3O5K A;  3UQB A;  4MPK A;  2FAP A;  2PI6 A;  1D2K A;  1ITX A;  4IQC A;  2UZ5 A;  5J6E A;  1XRV A;  1HJX A;  2ITK A;  1FKL A;  1FKG A;  2A3E A;  3KAD A;  3OA5 A;  2O9O A;  4G2P A;  1SR0 A;  1TFV A;  3RFW A;  3WQV A;  5JH8 A;  3KAC A;  4MGV A;  3ALF A;  2XP3 A;  2ZQT A;  1JNT A;  2WLZ A;  2KI3 A;  3CH9 A;  4JFJ A;  4S3K A;  2ESC A;  1W1V A;  3O5M A;  4P8V A;  2DG4 A;  3TC5 A;  2LKN A;  3ARX A;  2PBC A;  1NMW A;  4WKH A;  3UF8 A;  3RGC A;  4TW6 A;  4NZC A;  3PA7 A;  3WIJ A;  2YBT A;  3CHE A;  4HBO A;  4DRO A;  3GPK A;  3KCE A;  1E6Z A;  3O5Q A;  3ARU A;  5HTG A;  2DG9 A;  2XP9 A;  3UI6 A;  3ALG A;  1HJW A;  1Q6H A;  3JYM A;  3ODK A;  1ZL1 A;  4KR0 B;  2YBU A;  1EQ3 A;  4MNJ A;  1ZBK A;  2MF9 A;  4LAY A;  4LAW A;  4Z2H A;  4WKA A;  1O6I A;  3O5P A;  2DSZ A;  3ARQ A;  3TDB A;  2DT0 A;  4GGQ A;  3KZ7 A;  4ZPT R;  2AWG A;  3RME A;  2ZR5 A;  5HWC A;  4JYS A;  2KGJ A;  3LUO A;  4W9P A;  2Y78 A;  2D9F A;  4ODN A;  1E9L A;  1PIN A;  1EYM A;  4U86 A;  1FKH A;  4DWS A;  4Z2L A;  1NWU A;  4XAK A;  5GPG A;  2DSW A;  1R9H A;  3O5F A;  4G50 A;  1QPL A;  1QZ2 A;  2MNT A;  1HKI A;  4ITZ A;  2WM0 A;  3FXY A;  4PTM A;  4DRP A;  1FD9 A;  2N87 A;  5DIT A;  3FY1 A;  1FFR A;  2RUD A;  1JVW A;  2XP7 A;  3RM4 A;  1GUV A;  3CHD A;  3AQU A;  1M5Y A;  4DRH A;  2PPN A;  1HKJ A;  1UR8 A;  1KT1 A;  3CGN A;  3O5R A;  1X6L A;  1EHN A;  3MDY B;  4L3N A;  3O5O A;  1LL7 A;  4URI A;  3ARY A;  4DZ3 A;  3O5D A;  4DWS C;  1JND A;  1FKB A;  4P8W A;  2PPP A;  1ZB5 A;  3O5J A;  4W5U A;  2DSV A;  2KO7 A;  1PBK A;  1CTN A;  1ZU8 A;  4ODR A;  4MTV A;  2K8I A;  1VF8 A;  1LQ0 A;  3I6C A;  1HXV A;  1LG2 A;  2IF4 A;  5HW8 A;  2A3C A;  1W26 A;  4QIB A;  1OWQ A;  3WH0 A;  3KAF A;  4DZ2 A;  2DT1 A;  4ZS6 A;  3WQW A;  4ZPW R;  2A3B A;  4Z2I A;  2L2S A;  3WD4 A;  4IT6 A;  2KFW A;  2PPO A;  4ODK A;  4AY1 A;  1FKD A;  3ARZ A;  2Q5A A;  4W9Q A;  2DSU A;  4TYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...