2FKGA

The crystal structure of engineered ospa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
315
structure length
315
Chain Sequence
b'NSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer Surface Protein A
publication title Atomic structures of peptide self-assembly mimics.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags De novo protein
total genus 56
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2006-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2fkgA01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2fkgA02
3.90.930.30 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2fkgA03
1OSPO 5B10O 3EC5A 5B11O 2OL6O 1FJ1E 2G8CO 5B3MO 2OY5O 2HKDA 2OY8A 3AUMO 2FKGA 2I5VO 2OY1O 1P4PA 2AF5A 2FKJA 2OY7A 2OYBO 2OL8O 3CKGA 3CKFA 2OL7A 2PI3O 2I5ZO 5B2AO 1RJLC
chains in the Genus database with same CATH superfamily
2MO5A 3ZW1B 4WFVA 4ARHA 2WUTA 1E06A 3CCLE 2G5LA 2UYWA 5LJGA 2QO5A 1VQ9E 1QFVA 1DF8A 2QOMA 1HY2A 2FR3A 5HAEA 1AVDA 2WEWA 4LKPA 1KL3A 3ELZA 3HWEA 1U0XA 2OVAA 4C5PA 4GETA 5DM6E 2RTPB 2OFRX 1VWOB 1BSQA 3FR5A 2IZJA 2AT5X 1HBPA 1G85A 3OBLA 3QKGA 3LTWA 1VWKB 1SRIA 5D47A 2A13A 2DJGA 4JHQA 2IZAA 2LBAA 2KTDA 2FKJA 1NGLA 5LJDA 3C77X 3WYPA 3FR4A 2Q4NA 1LUQA 1HMRA 2EU7X 3ZQ3A 2AT0X 5B11O 1IKEA 5GADG 1CBQA 1BRPA 4ZR2A 3WZOA 4AZMA 1NQNA 5FQ8E 3CPWE 2X8SA 1SRFA 1Q86G 2OL8O 1JV4A 4ORXA 3FMZA 1W6FA 4O4UA 4BVMA 4YDAA 4IBAA 1VYOA 3EM0A 4FBRA 4IOCE 4ORUA 5IRWA 3B2LA 4U8UM 2JU7A 2KT4B 3VHIA 3D9WA 4GH7A 4I9RA 3KQ0A 1DZPA 1EIOA 2K62A 2A8GA 3PP6A 2OYBO 1JBHA 4HPAA 4OMXA 4AZPA 3CD6E 1LELA 2BT9A 2BHVA 1LNMA 5LJEA 1RL6A 1YWAA 4NLJA 1K8AG 1LFOA 3T2WA 3TF6A 4MVKA 3SLJA 3VG3A 2RTFB 4Z2PA 3S26A 2FKGA 1SWTA 3NQ9A 1MEPA 1Y0GA 1O1VA 1YWBA 4O4OA 2YG2A 3PH6A 2L68A 4KH8A 1HN2A 4D6AA 5FQ6E 2W2AA 1ICNA 2HKDA 1DF3A 1KFFA 3PQUA 3BRNA 3S60A 1XKIA 3APWA 1EUOA 4BJ8A 2CM9A 2RA6A 2L5PA 3KFHA 1K9MG 2QA4E 5BVTA 1VQKE 4IMNA 5JVGE 3FDCA 2JMBA 1JJUA 2CZUA 3KFGA 5KICA 2IZFB 3CCRE 1EI5A 3RWXA 2C1SA 1I78A 5BVSA 1NP1A 1SWDA 2Q39A 2OVEA 4O3XB 1N9YA 2RTJA 4DQ4A 3I0AA 4IAWA 4QGXA 3PIOE 1VQOE 2MJIA 2ZJPE 1B4MA 1Y52X 3FYFA 1SWHA 1MOYA 3BY0A 1NC9A 5B29A 3U9PC 2F09A 2X45A 3OE3A 2ZAIA 3VU1A 3ZZVA 3Q34A 3CC7E 1X8QA 2PI3O 3UEVA 4AZNA 4HFOA 1SWBA 3RE5A 3B2JA 1Z24A 1UYOX 1BLRA 2R73A 3AKNA 1GKAA 3WJDA 1D3SA 1JZUA 1YWDA 4BBOA 4TNNA 1ADLA 1VYGA 3CWKA 1Q7YG 3BX7A 2G78A 1W2BE 1DZMA 1NDJA 3TGCA 4I9SA 2BLGA 1YWCA 3ZW1A 4BX6B 4ZHCA 4Y0SA 2OFAA 1QFTA 4YBUA 3AKMA 4U8UN 1T68X 4OS8A 4JO6A 1LCWA 5HCEC 1ZRYA 5HA0A 1VWQB 5HWZA 5L8IA 2AVIA 2OZQA 1ZNLA 4LQZA 4I95A 4L1NA 4UU3A 3HWFA 2M4LA 2AMMX 3STMX 2Y32A 3BU9A 2QM9A 2BS6A 1SWSA 1GT4A 2JU8A 1X89A 4IABA 1I4UA 2IZKA 2RTCB 3RDSA 3H3IA 4OMWA 5LKFA 3FA7A 3DSZA 2W2FA 2RTRB 2GTFX 3FW5A 5IXGA 3CKGA 4O3YA 1IJ8A 1KD1G 3BDRA 4YVBA 1Y9LA 2ZAGA 2Q2PA 1SY1A 1FE3A 5FAZA 1QABE 3T1DA 4ORYA 3O2YA 4GGZA 2G7BA 1RXJA 5AEOA 1QVFE 4IOAE 1HQQA 4PSQA 5JD2A 4ZH9A 2LKKA 1STPA 4ALBA 1TW4A 2ACPX 3BSZE 4FGIB 4XMFA 4XMCA 2ZJQE 5AJBA 2NNEA 1G5WA 4NV8A 2AF5A 1STSB 3B2IA 5HTDA 1GX9A 1JYJA 2GTLN 1LIBA 3JQOA 4RUNA 3CR6A 5F6BA 1SLEB 1JYDA 1KL5A 1SMPI 4CDDA 3ZUOA 4IB7A 2RTNB 2BSZA 3NP1A 1M90G 4Y0PA 4YKOA 1A57A 1PBOA 1EIIA 4MEEA 2LFOA 1H91A 5GAGG 2RTKA 2IZBA 3EC5A 5EPQA 4PJ2A 3KFFA 1QQSA 2WQAE 4NV7A 3RKGA 3SZIA 1OBPA 5B3MO 4YFRA 2FGSA 1SWCA 4KT5A 3FIDA 5F58A 4K19A 1E00A 3CMEE 2Z4IA 2RQ0A 1FTPA 5HA1A 1YHQE 4YFPA 3OJYC 2KW1A 4FBVA 4EFGA 1LCZA 5HL7E 3CQRA 5HZ9A 3MM0A 5B5GA 1W5RA 1K24A 4Y5DA 4BCSA 4Z2VA 2IZLB 2LB6A 4CDCA 5AN9B 3S5VA 1AELA 3NQ3A 4YGZA 1PEEA 4A8ZA 3RDQA 3CBCA 4Z2OA 1SXXA 3SAOA 1VYFA 1ACDA 1KT6A 2LBVA 3I17A 4QZTA 4ZGFA 3UEWA 3CCME 5FFHA 3RDXA 1KOIA 1Y53X 1CJ5A 5D45A 1N8RG 4GE1A 1TVQA 2RD7C 4I60A 4OS3A 2A2GA 5H9NA 3NPOA 3CCJE 3WJFA 2HLVA 1MX8A 4YKMA 2X8TA 1LIDA 1I06A 2K23A 3ZI8A 3FA9A 1A18A 1HQPA 5C0NA 1YI2E 3PQSA 1SWNA 4GNYA 1BBPA 5L3YA 4BX6A 5D4AA 4NLIA 2A3FX 2CZTA 3FENA 1VQ5E 3CXCE 2RTQB 2R74A 1N9MA 1SRGA 1NBXA 3VG5A 1SRJA 3RDUA 2OTJE 2MF6A 1RAVA 2FT9A 1KT4A 2AKQA 1KT3A 4YH0A 1MM9A 1GXAA 3T2XA 2CM4A 2E4JA 5LJCA 1N4JA 5D8JA 5CE4A 1SLGB 2OF9A 4IMOA 1RXKA 1JMXA 1FDQA 4UU2A 3PK2A 3EYCA 2Y3FA 2IZDB 3RBYA 3VHMA 1BM5A 4YBPA 1P6PA 3C76X 3NADA 3FW4A 4WFBE 1LKEA 1N7YA 3VG2A 1HXLA 1AQBA 1ZNKA 2X46A 2QEXE 2CBRA 4GNWA 2QO4A 2WSJA 1KZXA 2X8FA 3VE2A 3NX1A 1DZKA 1LIEA 2I5ZO 4A60A 1YJ9E 4ES7A 3CQNA 1PM1X 1MDCA 2WEXA 4WCEE 1QY1A 2R56A 3NX2A 1B8EA 4CSBA 1E2TA 3WOVA 2KD2A 4ZHDA 1SA8A 1I05A 1VQME 4ZHGA 5DM7E 1GT1A 3VE1A 2A5BA 3FIQA 2RTDB 2NP1A 1HBQA 1QY2A 3CCQE 3F8AA 3C78X 4I3CA 3CBSA 2DM5A 2FHLA 4OELA 3VG6A 1I9HA 3KFIA 4HPDA 3CCEE 2Z4HA 4GJSA 4ON1A 4I6SA 2JW1A 3U03A 2AT6X 4EQAC 1KT5A 2FWVA 4KC7A 4N7DA 2RTIB 2AT8X 3APUA 2YMSA 1EPAA 2ALLX 4IB8A 5F6ZA 3G6EE 4ZHHA 1SRHA 3BX8A 1CRBA 1VWEB 1X8NA 2KTSA 3HWDA 4WHIA 4YCEA 4ZGUA 3N91A 3WXQA 1KGLA 4KIIA 1MX7A 1BSYA 1ML7A 2G8CO 3CMPA 4BGFA 4ZHFA 4FBOA 1CBRA 1YP7A 1JJ2E 2ANSA 1SWRA 4GJVA 4TKBA 4QGWA 4NYQA 1SY3A 3VHHA 5K68A 2FHNX 1LCVA 5H9AA 1YIVA 1SWJA 3OD9A 1ZNGA 4EKVA 2FRSA 2IZHB 1M1KG 3HWGA 3Q6LA 2WWPA 3CC4E 1EPBA 1NP4A 3STNA 1AVGI 4GK9A 4BX5B 4ZJ0A 2BC3A 2NNQA 4GZVA 4HPBA 3P6GA 5BYPA 1RBPA 1IKJA 2FLJA 4YGHA 3WJGA 1AB0A 1GT3A 1SWKA 4FQBB 5GAEG 2HMBA 4INNA 5DPQA 1FENA 2ZSCA 3WZPA 2X32A 1HMSA 1LIFA 1JJXA 4WFAE 3VG4A 3EBWA 2WPUA 3G7XA 1K73G 2CQLA 4CPHB 1Q82G 1T8VA 1SWQA 3SLTA 2AH7X 3D4RA 1BEBA 3V8UA 1S2PA 3WJEA 1EXSA 5F7GA 3FELA 5EDBA 4ID2A 1ZNDA 1RXHA 5HZQA 2X55A 5FQ7E 2RTOB 4IB9A 2GJ5A 3QQ2A 4ODDA 3I55E 1SWFA 4O3WA 2OL7A 4LKTA 3B2KA 4GDAA 1RSUB 5EEEA 4IO9E 1ERBA 4YDBA 1QWDA 5H9KA 2OTLE 1STRB 3UEUA 3BS2A 1VWDB 1GT5A 3PEDA 3CCUE 4CPIA 2QOSC 4O49A 1VWMB 5IO6A 1VWPB 4IRWA 4OS0A 2A0AA 3VG7A 4R0BA 1BSOA 1BRQA 4U9CA 1SXUA 2OFBA 5HZ5A 4BQUA 3FEKA 1SWEA 1Y55X 1OBQA 2VFCA 3HTYA 4TQ2A 1IW2A 2AT3X 4WFUA 1W4TA 1X8PA 4Z27A 1KL4A 3CCVE 5F2BA 3S5XA 3T6LA 3CKFA 3HOLA 4TKJA 1RJLC 4DCBA 3I56E 2ACOA 5B10O 3EMMA 2RTEB 1SWUA 2RTGB 1SLFB 2O62A 2RTHB 3P6DA 2IZGB 4BX7B 3APXA 1EQDA 1HXZA 4O4SA 2HYSA 2X56A 1WUBA 5IO5A 3KZAA 5KHPA 1CBIA 1O8VA 5AJCA 5H9LA 2RTMA 2MM3A 1JJJA 2OY8A 4M7MA 3CC2E 2FTBA 1A3YA 3RSWA 4TLJA 1IFCA 5KIDA 4GGTA 4B55A 1ZNHA 2XKLA 1VWBB 5HBSA 3P6FA 4ALOA 1OPAA 5BVQA 1OSPO 1OEJA 3NBXX 1FELA 4EXZA 1LPJA 3O19A 4JGLA 1LDQA 1MK5A 5D48A 2A5CA 2RTLA 3RY1A 4AZOA 4XMGA 3FR2A 4CK4A 1KT7A 1VQ6E 4BX5A 1U18A 3GAQA 4XMEA 2GC9A 1ZNEA 1RLBE 1SXWA 2DJFA 4Y0RA 2OY7A 3B2HA 3KVNA 4CDFA 4GGRA 1VWHB 4ORSA 4ML7B 3CMAE 4JNJA 3UEXA 1QVGE 5HZ6A 3AUMO 1SWOA 4O3ZA 3VPJE 2JGSA 1RSTB 3P6HA 5IRUA 1Y9TA 1ALBA 2XSTA 1BJ7A 1VWAB 2ASNX 1UZ2X 1S7DA 4GKCA 3RDMA 1NJIG 4I3BA 4AYHA 2HZRA 1R0UA 1JQPA 3ZWEA 2OVDA 1DV9A 4YGGA 3G71E 2MWHA 1K3BA 3MBTA 1LDOA 1KC8G 4LZVA 4Z6JA 1JIWI 3ZUIA 4AZQA 4CPHA 2LA7A 1VQPE 1SWLA 4A1HA 4MVIA 3RDOA 4CDEA 3O22A 4NW4A 4ZCBA 1VPRA 3CCSE 1LICA 3L4RA 3NQKA 1SWPA 1VQNE 3UAQA 3IA8A 2RCTA 2POAA 1VWIB 2VFBA 1UREA 2ZJRE 2QCBA 4CPEA 2RTAA 2W2BA 2L9CA 2P8GA 5IO7A 1U17A 1E02A 4TJZA 1HMTA 1S72E 3F6ZB 1WBIA 4GDZA 1TOWA 1SWGA 5F1EA 3FLLA 2QO6A 5H1SI 4GRJA 5LJHA 4YCHA 3ELXA 4QYPA 3WYQA 1YJNE 3U0DA 3TGBA 3MVFA 4AZRA 2Y3EA 1L6MA 2WR6A 1D2UA 1KXOA 5DG4A 2OY5O 1VQLE 2BS5A 3EW2A 5JVHE 1I04A 4U67E 4O9SA 4U8UO 3K3LA 3TZSA 4ZH6A 1EALA 3PPTA 1YITE 4M6SA 1GX8A 2OF8A 3APVA 2QMIA 2PY1A 4L3RA 4Y59A 1A2DA 1SXYA 4YFQA 3SOTA 4GUZA 4NP1A 1KQWA 4QAEA 4WF9E 4MIRA 4U3QA 3P24A 1DZJA 4GD9A 2OVSA 1DFVA 1OEKA 3WZNA 2UZ2A 5LJBA 5EDCA 2L67A 4BX7A 4NNSA 3LV4A 2HZQA 5JR8A 5IRAA 4UY8G 1NQMA 4DQ3A 2IZEB 4N7CA 3WZQA 5LKEA 5K67A 2GTLM 4O4XA 1AVEA 3WBGA 3IGEA 1PTSA 3ZW0B 3D95A 3SZHA 5LJKA 2I5VO 2OY1O 3BLGA 3PDFA 2FS6A 2OFMX 3SLOA 3DTQA 2F73A 1G74A 1KQXA 3F9DA 3LHNA 4HWMA 4A1YA 4BOEA 1E5PA 4KC8A 4ORRA 4QQ1A 4D6BA 4DNEA 1VQ8E 4EEJA 2FS7A 2Q9SA 3MX7A 1BWYA 3P6CA 5CSEA 3PECA 1EW3A 2GTLO 5L8OA 3WVMA 3D96A 4IAXA 5CHKA 1OBUA 1VWGB 2IFBA 3WJBA 3D97A 5HTEA 1X8UA 1YIJE 3EBKA 4QRLA 2N93A 3MG5A 4Y0QA 4I3DA 3FA6A 2JOZA 5L8NA 1GX3A 2CAMA 2F01A 2CBSA 1T0VA 1QY0A 2G79A 1SY2A 1VWFB 2X34A 2GH7A 2X4MA 4ORWA 1YJWE 4COTA 2C4IA 2C1QA 5HCDC 4GU8A 3CF5E 1S44A 3RE6A 3FA8A 3SZJA 1PMPA 1CBSA 1OEEA 4CV7A 1VQ4E 4RUUA 1VWLB 3BU1A 3AEHA 4YMYA 1N0SA 5EZ2A 1X8OA 4MVEA 5B27A 4QNIA 1TXLA 1ERXA 1O1UA 1YUPA 1GM6A 1B0OA 3FEPA 3JSQA 4OKAA 1MUPA 2OL6O 3HOEA 4NNTA 1B56A 3J7ZG 2IZIA 1JMZA 3PIPE 1TOUA 1Q81G 3IFBA 4MISA 4EDEA 4WFNE 2RTBB 3VGWA 1YP6A 3RY2A 1P4PA 1UYNX 3HK1A 3EW1A 4IB6A 2IZCB 3NR3A 1X71A 3T6FA 5EEDA 1PBYA 1FEMA 4U46A 1VWRB 3IG9A 3RZYA 4QZUA 2Q2MA 4MVLA 5B2AO 5HZ8A 2AL0X 2MHDA 2RN4A 1SLDB 4OEMA 3DLLE 4HPCA 1QG5A 1FJ1E 4NYRA 2VDFA 4LZUA 4CPFA 1IIUA 3GE2A 1VWCB 4QYNA 4TKHA 1VWJB 3HPEA 1SY0A 2HNXA 3STKA 3JS1A 3G4SE 3P02A 4AW8A 4QGVA 4ZFXA 5HCCC 1G7NA 5MLCH 3PH5A 3ZW2A 1VWNB 5B5FA 1VQ7E 2FR2A 1ICMA 3X00A 1MVGA 3P6EA 5GAHG 5H8TA 4Z28A 1XCAA 1DC9A 5AQ6A 5K06A 2JN3A 4KCAA 3WJCA 1GKAB 5FENA 3TGAA 4XMHA 1N43A 2A2UA 1SREA 1SWAA 4WBKA 3ZW0A 1IFBA 3E3CA 2WQ9A 1LF7A 3OW2E 2NNDA 1KZWA 2RCQA 5CYBA 1GGLA 4XMDA 1OPBA 2JU3A 1KQSE
chains in the Genus database with same CATH topology
1OSPO 5B10O 3EC5A 3IGEA 5B11O 2OL6O 1FJ1E 2G8CO 5B3MO 2OY5O 2HKDA 2OY8A 3AUMO 2FKGA 2I5VO 2OY1O 1P4PA 2AF5A 2FKJA 2OY7A 2OYBO 3IG9A 2OL8O 3CKGA 3CKFA 2OL7A 2PI3O 2I5ZO 5B2AO 1RJLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OSP O;  5B10 O;  3EC5 A;  5B11 O;  2OL6 O;  1FJ1 E;  2G8C O;  5B3M O;  2OY5 O;  2HKD A;  2OY8 A;  3AUM O;  2FKG A;  2I5V O;  2OY1 O;  1P4P A;  2AF5 A;  2FKJ A;  2OY7 A;  2OYB O;  2OL8 O;  3CKG A;  3CKF A;  2OL7 A;  2PI3 O;  2I5Z O;  5B2A O;  1RJL C; 
#chains in the Genus database with same CATH topology
 2MO5 A;  3ZW1 B;  4WFV A;  4ARH A;  2WUT A;  1E06 A;  3CCL E;  2G5L A;  2UYW A;  5LJG A;  2QO5 A;  1VQ9 E;  1QFV A;  1DF8 A;  2QOM A;  1HY2 A;  2FR3 A;  5HAE A;  1AVD A;  2WEW A;  4LKP A;  1KL3 A;  3ELZ A;  3HWE A;  1U0X A;  2OVA A;  4C5P A;  4GET A;  5DM6 E;  2RTP B;  2OFR X;  1VWO B;  1BSQ A;  3FR5 A;  2IZJ A;  2AT5 X;  1HBP A;  1G85 A;  3OBL A;  3QKG A;  3LTW A;  1VWK B;  1SRI A;  5D47 A;  2A13 A;  2DJG A;  4JHQ A;  2IZA A;  2LBA A;  2KTD A;  2FKJ A;  1NGL A;  5LJD A;  3C77 X;  3WYP A;  3FR4 A;  2Q4N A;  1LUQ A;  1HMR A;  2EU7 X;  3ZQ3 A;  2AT0 X;  5B11 O;  1IKE A;  5GAD G;  1CBQ A;  1BRP A;  4ZR2 A;  3WZO A;  4AZM A;  1NQN A;  5FQ8 E;  3CPW E;  2X8S A;  1SRF A;  1Q86 G;  2OL8 O;  1JV4 A;  4ORX A;  3FMZ A;  1W6F A;  4O4U A;  4BVM A;  4YDA A;  4IBA A;  1VYO A;  3EM0 A;  4FBR A;  4IOC E;  4ORU A;  5IRW A;  3B2L A;  4U8U M;  2JU7 A;  2KT4 B;  3VHI A;  3D9W A;  4GH7 A;  4I9R A;  3KQ0 A;  1DZP A;  1EIO A;  2K62 A;  2A8G A;  3PP6 A;  2OYB O;  1JBH A;  4HPA A;  4OMX A;  4AZP A;  3CD6 E;  1LEL A;  2BT9 A;  2BHV A;  1LNM A;  5LJE A;  1RL6 A;  1YWA A;  4NLJ A;  1K8A G;  1LFO A;  3T2W A;  3TF6 A;  4MVK A;  3SLJ A;  3VG3 A;  2RTF B;  4Z2P A;  3S26 A;  2FKG A;  1SWT A;  3NQ9 A;  1MEP A;  1Y0G A;  1O1V A;  1YWB A;  4O4O A;  2YG2 A;  3PH6 A;  2L68 A;  4KH8 A;  1HN2 A;  4D6A A;  5FQ6 E;  2W2A A;  1ICN A;  2HKD A;  1DF3 A;  1KFF A;  3PQU A;  3BRN A;  3S60 A;  1XKI A;  3APW A;  1EUO A;  4BJ8 A;  2CM9 A;  2RA6 A;  2L5P A;  3KFH A;  1K9M G;  2QA4 E;  5BVT A;  1VQK E;  4IMN A;  5JVG E;  3FDC A;  2JMB A;  1JJU A;  2CZU A;  3KFG A;  5KIC A;  2IZF B;  3CCR E;  1EI5 A;  3RWX A;  2C1S A;  1I78 A;  5BVS A;  1NP1 A;  1SWD A;  2Q39 A;  2OVE A;  4O3X B;  1N9Y A;  2RTJ A;  4DQ4 A;  3I0A A;  4IAW A;  4QGX A;  3PIO E;  1VQO E;  2MJI A;  2ZJP E;  1B4M A;  1Y52 X;  3FYF A;  1SWH A;  1MOY A;  3BY0 A;  1NC9 A;  5B29 A;  3U9P C;  2F09 A;  2X45 A;  3OE3 A;  2ZAI A;  3VU1 A;  3ZZV A;  3Q34 A;  3CC7 E;  1X8Q A;  2PI3 O;  3UEV A;  4AZN A;  4HFO A;  1SWB A;  3RE5 A;  3B2J A;  1Z24 A;  1UYO X;  1BLR A;  2R73 A;  3AKN A;  1GKA A;  3WJD A;  1D3S A;  1JZU A;  1YWD A;  4BBO A;  4TNN A;  1ADL A;  1VYG A;  3CWK A;  1Q7Y G;  3BX7 A;  2G78 A;  1W2B E;  1DZM A;  1NDJ A;  3TGC A;  4I9S A;  2BLG A;  1YWC A;  3ZW1 A;  4BX6 B;  4ZHC A;  4Y0S A;  2OFA A;  1QFT A;  4YBU A;  3AKM A;  4U8U N;  1T68 X;  4OS8 A;  4JO6 A;  1LCW A;  5HCE C;  1ZRY A;  5HA0 A;  1VWQ B;  5HWZ A;  5L8I A;  2AVI A;  2OZQ A;  1ZNL A;  4LQZ A;  4I95 A;  4L1N A;  4UU3 A;  3HWF A;  2M4L A;  2AMM X;  3STM X;  2Y32 A;  3BU9 A;  2QM9 A;  2BS6 A;  1SWS A;  1GT4 A;  2JU8 A;  1X89 A;  4IAB A;  1I4U A;  2IZK A;  2RTC B;  3RDS A;  3H3I A;  4OMW A;  5LKF A;  3FA7 A;  3DSZ A;  2W2F A;  2RTR B;  2GTF X;  3FW5 A;  5IXG A;  3CKG A;  4O3Y A;  1IJ8 A;  1KD1 G;  3BDR A;  4YVB A;  1Y9L A;  2ZAG A;  2Q2P A;  1SY1 A;  1FE3 A;  5FAZ A;  1QAB E;  3T1D A;  4ORY A;  3O2Y A;  4GGZ A;  2G7B A;  1RXJ A;  5AEO A;  1QVF E;  4IOA E;  1HQQ A;  4PSQ A;  5JD2 A;  4ZH9 A;  2LKK A;  1STP A;  4ALB A;  1TW4 A;  2ACP X;  3BSZ E;  4FGI B;  4XMF A;  4XMC A;  2ZJQ E;  5AJB A;  2NNE A;  1G5W A;  4NV8 A;  2AF5 A;  1STS B;  3B2I A;  5HTD A;  1GX9 A;  1JYJ A;  2GTL N;  1LIB A;  3JQO A;  4RUN A;  3CR6 A;  5F6B A;  1SLE B;  1JYD A;  1KL5 A;  1SMP I;  4CDD A;  3ZUO A;  4IB7 A;  2RTN B;  2BSZ A;  3NP1 A;  1M90 G;  4Y0P A;  4YKO A;  1A57 A;  1PBO A;  1EII A;  4MEE A;  2LFO A;  1H91 A;  5GAG G;  2RTK A;  2IZB A;  3EC5 A;  5EPQ A;  4PJ2 A;  3KFF A;  1QQS A;  2WQA E;  4NV7 A;  3RKG A;  3SZI A;  1OBP A;  5B3M O;  4YFR A;  2FGS A;  1SWC A;  4KT5 A;  3FID A;  5F58 A;  4K19 A;  1E00 A;  3CME E;  2Z4I A;  2RQ0 A;  1FTP A;  5HA1 A;  1YHQ E;  4YFP A;  3OJY C;  2KW1 A;  4FBV A;  4EFG A;  1LCZ A;  5HL7 E;  3CQR A;  5HZ9 A;  3MM0 A;  5B5G A;  1W5R A;  1K24 A;  4Y5D A;  4BCS A;  4Z2V A;  2IZL B;  2LB6 A;  4CDC A;  5AN9 B;  3S5V A;  1AEL A;  3NQ3 A;  4YGZ A;  1PEE A;  4A8Z A;  3RDQ A;  3CBC A;  4Z2O A;  1SXX A;  3SAO A;  1VYF A;  1ACD A;  1KT6 A;  2LBV A;  3I17 A;  4QZT A;  4ZGF A;  3UEW A;  3CCM E;  5FFH A;  3RDX A;  1KOI A;  1Y53 X;  1CJ5 A;  5D45 A;  1N8R G;  4GE1 A;  1TVQ A;  2RD7 C;  4I60 A;  4OS3 A;  2A2G A;  5H9N A;  3NPO A;  3CCJ E;  3WJF A;  2HLV A;  1MX8 A;  4YKM A;  2X8T A;  1LID A;  1I06 A;  2K23 A;  3ZI8 A;  3FA9 A;  1A18 A;  1HQP A;  5C0N A;  1YI2 E;  3PQS A;  1SWN A;  4GNY A;  1BBP A;  5L3Y A;  4BX6 A;  5D4A A;  4NLI A;  2A3F X;  2CZT A;  3FEN A;  1VQ5 E;  3CXC E;  2RTQ B;  2R74 A;  1N9M A;  1SRG A;  1NBX A;  3VG5 A;  1SRJ A;  3RDU A;  2OTJ E;  2MF6 A;  1RAV A;  2FT9 A;  1KT4 A;  2AKQ A;  1KT3 A;  4YH0 A;  1MM9 A;  1GXA A;  3T2X A;  2CM4 A;  2E4J A;  5LJC A;  1N4J A;  5D8J A;  5CE4 A;  1SLG B;  2OF9 A;  4IMO A;  1RXK A;  1JMX A;  1FDQ A;  4UU2 A;  3PK2 A;  3EYC A;  2Y3F A;  2IZD B;  3RBY A;  3VHM A;  1BM5 A;  4YBP A;  1P6P A;  3C76 X;  3NAD A;  3FW4 A;  4WFB E;  1LKE A;  1N7Y A;  3VG2 A;  1HXL A;  1AQB A;  1ZNK A;  2X46 A;  2QEX E;  2CBR A;  4GNW A;  2QO4 A;  2WSJ A;  1KZX A;  2X8F A;  3VE2 A;  3NX1 A;  1DZK A;  1LIE A;  2I5Z O;  4A60 A;  1YJ9 E;  4ES7 A;  3CQN A;  1PM1 X;  1MDC A;  2WEX A;  4WCE E;  1QY1 A;  2R56 A;  3NX2 A;  1B8E A;  4CSB A;  1E2T A;  3WOV A;  2KD2 A;  4ZHD A;  1SA8 A;  1I05 A;  1VQM E;  4ZHG A;  5DM7 E;  1GT1 A;  3VE1 A;  2A5B A;  3FIQ A;  2RTD B;  2NP1 A;  1HBQ A;  1QY2 A;  3CCQ E;  3F8A A;  3C78 X;  4I3C A;  3CBS A;  2DM5 A;  2FHL A;  4OEL A;  3VG6 A;  1I9H A;  3KFI A;  4HPD A;  3CCE E;  2Z4H A;  4GJS A;  4ON1 A;  4I6S A;  2JW1 A;  3U03 A;  2AT6 X;  4EQA C;  1KT5 A;  2FWV A;  4KC7 A;  4N7D A;  2RTI B;  2AT8 X;  3APU A;  2YMS A;  1EPA A;  2ALL X;  4IB8 A;  5F6Z A;  3G6E E;  4ZHH A;  1SRH A;  3BX8 A;  1CRB A;  1VWE B;  1X8N A;  2KTS A;  3HWD A;  4WHI A;  4YCE A;  4ZGU A;  3N91 A;  3WXQ A;  1KGL A;  4KII A;  1MX7 A;  1BSY A;  1ML7 A;  2G8C O;  3CMP A;  4BGF A;  4ZHF A;  4FBO A;  1CBR A;  1YP7 A;  1JJ2 E;  2ANS A;  1SWR A;  4GJV A;  4TKB A;  4QGW A;  4NYQ A;  1SY3 A;  3VHH A;  5K68 A;  2FHN X;  1LCV A;  5H9A A;  1YIV A;  1SWJ A;  3OD9 A;  1ZNG A;  4EKV A;  2FRS A;  2IZH B;  1M1K G;  3HWG A;  3Q6L A;  2WWP A;  3CC4 E;  1EPB A;  1NP4 A;  3STN A;  1AVG I;  4GK9 A;  4BX5 B;  4ZJ0 A;  2BC3 A;  2NNQ A;  4GZV A;  4HPB A;  3P6G A;  5BYP A;  1RBP A;  1IKJ A;  2FLJ A;  4YGH A;  3WJG A;  1AB0 A;  1GT3 A;  1SWK A;  4FQB B;  5GAE G;  2HMB A;  4INN A;  5DPQ A;  1FEN A;  2ZSC A;  3WZP A;  2X32 A;  1HMS A;  1LIF A;  1JJX A;  4WFA E;  3VG4 A;  3EBW A;  2WPU A;  3G7X A;  1K73 G;  2CQL A;  4CPH B;  1Q82 G;  1T8V A;  1SWQ A;  3SLT A;  2AH7 X;  3D4R A;  1BEB A;  3V8U A;  1S2P A;  3WJE A;  1EXS A;  5F7G A;  3FEL A;  5EDB A;  4ID2 A;  1ZND A;  1RXH A;  5HZQ A;  2X55 A;  5FQ7 E;  2RTO B;  4IB9 A;  2GJ5 A;  3QQ2 A;  4ODD A;  3I55 E;  1SWF A;  4O3W A;  2OL7 A;  4LKT A;  3B2K A;  4GDA A;  1RSU B;  5EEE A;  4IO9 E;  1ERB A;  4YDB A;  1QWD A;  5H9K A;  2OTL E;  1STR B;  3UEU A;  3BS2 A;  1VWD B;  1GT5 A;  3PED A;  3CCU E;  4CPI A;  2QOS C;  4O49 A;  1VWM B;  5IO6 A;  1VWP B;  4IRW A;  4OS0 A;  2A0A A;  3VG7 A;  4R0B A;  1BSO A;  1BRQ A;  4U9C A;  1SXU A;  2OFB A;  5HZ5 A;  4BQU A;  3FEK A;  1SWE A;  1Y55 X;  1OBQ A;  2VFC A;  3HTY A;  4TQ2 A;  1IW2 A;  2AT3 X;  4WFU A;  1W4T A;  1X8P A;  4Z27 A;  1KL4 A;  3CCV E;  5F2B A;  3S5X A;  3T6L A;  3CKF A;  3HOL A;  4TKJ A;  1RJL C;  4DCB A;  3I56 E;  2ACO A;  5B10 O;  3EMM A;  2RTE B;  1SWU A;  2RTG B;  1SLF B;  2O62 A;  2RTH B;  3P6D A;  2IZG B;  4BX7 B;  3APX A;  1EQD A;  1HXZ A;  4O4S A;  2HYS A;  2X56 A;  1WUB A;  5IO5 A;  3KZA A;  5KHP A;  1CBI A;  1O8V A;  5AJC A;  5H9L A;  2RTM A;  2MM3 A;  1JJJ A;  2OY8 A;  4M7M A;  3CC2 E;  2FTB A;  1A3Y A;  3RSW A;  4TLJ A;  1IFC A;  5KID A;  4GGT A;  4B55 A;  1ZNH A;  2XKL A;  1VWB B;  5HBS A;  3P6F A;  4ALO A;  1OPA A;  5BVQ A;  1OSP O;  1OEJ A;  3NBX X;  1FEL A;  4EXZ A;  1LPJ A;  3O19 A;  4JGL A;  1LDQ A;  1MK5 A;  5D48 A;  2A5C A;  2RTL A;  3RY1 A;  4AZO A;  4XMG A;  3FR2 A;  4CK4 A;  1KT7 A;  1VQ6 E;  4BX5 A;  1U18 A;  3GAQ A;  4XME A;  2GC9 A;  1ZNE A;  1RLB E;  1SXW A;  2DJF A;  4Y0R A;  2OY7 A;  3B2H A;  3KVN A;  4CDF A;  4GGR A;  1VWH B;  4ORS A;  4ML7 B;  3CMA E;  4JNJ A;  3UEX A;  1QVG E;  5HZ6 A;  3AUM O;  1SWO A;  4O3Z A;  3VPJ E;  2JGS A;  1RST B;  3P6H A;  5IRU A;  1Y9T A;  1ALB A;  2XST A;  1BJ7 A;  1VWA B;  2ASN X;  1UZ2 X;  1S7D A;  4GKC A;  3RDM A;  1NJI G;  4I3B A;  4AYH A;  2HZR A;  1R0U A;  1JQP A;  3ZWE A;  2OVD A;  1DV9 A;  4YGG A;  3G71 E;  2MWH A;  1K3B A;  3MBT A;  1LDO A;  1KC8 G;  4LZV A;  4Z6J A;  1JIW I;  3ZUI A;  4AZQ A;  4CPH A;  2LA7 A;  1VQP E;  1SWL A;  4A1H A;  4MVI A;  3RDO A;  4CDE A;  3O22 A;  4NW4 A;  4ZCB A;  1VPR A;  3CCS E;  1LIC A;  3L4R A;  3NQK A;  1SWP A;  1VQN E;  3UAQ A;  3IA8 A;  2RCT A;  2POA A;  1VWI B;  2VFB A;  1URE A;  2ZJR E;  2QCB A;  4CPE A;  2RTA A;  2W2B A;  2L9C A;  2P8G A;  5IO7 A;  1U17 A;  1E02 A;  4TJZ A;  1HMT A;  1S72 E;  3F6Z B;  1WBI A;  4GDZ A;  1TOW A;  1SWG A;  5F1E A;  3FLL A;  2QO6 A;  5H1S I;  4GRJ A;  5LJH A;  4YCH A;  3ELX A;  4QYP A;  3WYQ A;  1YJN E;  3U0D A;  3TGB A;  3MVF A;  4AZR A;  2Y3E A;  1L6M A;  2WR6 A;  1D2U A;  1KXO A;  5DG4 A;  2OY5 O;  1VQL E;  2BS5 A;  3EW2 A;  5JVH E;  1I04 A;  4U67 E;  4O9S A;  4U8U O;  3K3L A;  3TZS A;  4ZH6 A;  1EAL A;  3PPT A;  1YIT E;  4M6S A;  1GX8 A;  2OF8 A;  3APV A;  2QMI A;  2PY1 A;  4L3R A;  4Y59 A;  1A2D A;  1SXY A;  4YFQ A;  3SOT A;  4GUZ A;  4NP1 A;  1KQW A;  4QAE A;  4WF9 E;  4MIR A;  4U3Q A;  3P24 A;  1DZJ A;  4GD9 A;  2OVS A;  1DFV A;  1OEK A;  3WZN A;  2UZ2 A;  5LJB A;  5EDC A;  2L67 A;  4BX7 A;  4NNS A;  3LV4 A;  2HZQ A;  5JR8 A;  5IRA A;  4UY8 G;  1NQM A;  4DQ3 A;  2IZE B;  4N7C A;  3WZQ A;  5LKE A;  5K67 A;  2GTL M;  4O4X A;  1AVE A;  3WBG A;  3IGE A;  1PTS A;  3ZW0 B;  3D95 A;  3SZH A;  5LJK A;  2I5V O;  2OY1 O;  3BLG A;  3PDF A;  2FS6 A;  2OFM X;  3SLO A;  3DTQ A;  2F73 A;  1G74 A;  1KQX A;  3F9D A;  3LHN A;  4HWM A;  4A1Y A;  4BOE A;  1E5P A;  4KC8 A;  4ORR A;  4QQ1 A;  4D6B A;  4DNE A;  1VQ8 E;  4EEJ A;  2FS7 A;  2Q9S A;  3MX7 A;  1BWY A;  3P6C A;  5CSE A;  3PEC A;  1EW3 A;  2GTL O;  5L8O A;  3WVM A;  3D96 A;  4IAX A;  5CHK A;  1OBU A;  1VWG B;  2IFB A;  3WJB A;  3D97 A;  5HTE A;  1X8U A;  1YIJ E;  3EBK A;  4QRL A;  2N93 A;  3MG5 A;  4Y0Q A;  4I3D A;  3FA6 A;  2JOZ A;  5L8N A;  1GX3 A;  2CAM A;  2F01 A;  2CBS A;  1T0V A;  1QY0 A;  2G79 A;  1SY2 A;  1VWF B;  2X34 A;  2GH7 A;  2X4M A;  4ORW A;  1YJW E;  4COT A;  2C4I A;  2C1Q A;  5HCD C;  4GU8 A;  3CF5 E;  1S44 A;  3RE6 A;  3FA8 A;  3SZJ A;  1PMP A;  1CBS A;  1OEE A;  4CV7 A;  1VQ4 E;  4RUU A;  1VWL B;  3BU1 A;  3AEH A;  4YMY A;  1N0S A;  5EZ2 A;  1X8O A;  4MVE A;  5B27 A;  4QNI A;  1TXL A;  1ERX A;  1O1U A;  1YUP A;  1GM6 A;  1B0O A;  3FEP A;  3JSQ A;  4OKA A;  1MUP A;  2OL6 O;  3HOE A;  4NNT A;  1B56 A;  3J7Z G;  2IZI A;  1JMZ A;  3PIP E;  1TOU A;  1Q81 G;  3IFB A;  4MIS A;  4EDE A;  4WFN E;  2RTB B;  3VGW A;  1YP6 A;  3RY2 A;  1P4P A;  1UYN X;  3HK1 A;  3EW1 A;  4IB6 A;  2IZC B;  3NR3 A;  1X71 A;  3T6F A;  5EED A;  1PBY A;  1FEM A;  4U46 A;  1VWR B;  3IG9 A;  3RZY A;  4QZU A;  2Q2M A;  4MVL A;  5B2A O;  5HZ8 A;  2AL0 X;  2MHD A;  2RN4 A;  1SLD B;  4OEM A;  3DLL E;  4HPC A;  1QG5 A;  1FJ1 E;  4NYR A;  2VDF A;  4LZU A;  4CPF A;  1IIU A;  3GE2 A;  1VWC B;  4QYN A;  4TKH A;  1VWJ B;  3HPE A;  1SY0 A;  2HNX A;  3STK A;  3JS1 A;  3G4S E;  3P02 A;  4AW8 A;  4QGV A;  4ZFX A;  5HCC C;  1G7N A;  5MLC H;  3PH5 A;  3ZW2 A;  1VWN B;  5B5F A;  1VQ7 E;  2FR2 A;  1ICM A;  3X00 A;  1MVG A;  3P6E A;  5GAH G;  5H8T A;  4Z28 A;  1XCA A;  1DC9 A;  5AQ6 A;  5K06 A;  2JN3 A;  4KCA A;  3WJC A;  1GKA B;  5FEN A;  3TGA A;  4XMH A;  1N43 A;  2A2U A;  1SRE A;  1SWA A;  4WBK A;  3ZW0 A;  1IFB A;  3E3C A;  2WQ9 A;  1LF7 A;  3OW2 E;  2NND A;  1KZW A;  2RCQ A;  5CYB A;  1GGL A;  4XMD A;  1OPB A;  2JU3 A;  1KQS E; 
#chains in the Genus database with same CATH homology
 1OSP O;  5B10 O;  3EC5 A;  3IGE A;  5B11 O;  2OL6 O;  1FJ1 E;  2G8C O;  5B3M O;  2OY5 O;  2HKD A;  2OY8 A;  3AUM O;  2FKG A;  2I5V O;  2OY1 O;  1P4P A;  2AF5 A;  2FKJ A;  2OY7 A;  2OYB O;  3IG9 A;  2OL8 O;  3CKG A;  3CKF A;  2OL7 A;  2PI3 O;  2I5Z O;  5B2A O;  1RJL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...