2FKIA

Nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
MTISELLQYCMAKPGAEQSVHNDWKATQIKVEDVLFAMVKEVENRPAVSLKTSPELAELLRQQHSDVRPSRHLNKAHWSTVYLDGSLPDSQIYYLVDASYQQAVNLLPEEKRKLLVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of protein yjbR from Escherichia coli reveals 'double-wing' DNA binding motif.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords Protein yjbR
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2006-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04237 YjbR YjbR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1150.30 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2fkiA00
2FKIA 2A1VA 2KFPA 3H9XA
chains in the Genus database with same CATH superfamily
1ORDA 2ZJGA 4EFFA 4E1OA 2CFBA 5M49A 1ASEA 4EMYA 2HUIA 3BS8A 1ASDA 3EIBA 3MC6C 2BIGA 2R5CA 1AAMA 2CANA 2FN6A 1D7SA 1RVYA 1W7NA 2VMSA 1X28A 3MC6A 4E3QA 4B98A 1M0OA 4AOAA 3OKSA 1N8PA 4IW7A 1WYUA 3EZSA 3GWPA 1DJUA 1WYUB 2R0TA 3HL2A 5HDMA 1X29A 1G4XA 1GC4A 3JW9A 4OMAA 1AICA 4B9BA 3VK3A 1KMJA 1ZODA 4MQPA 4OC9A 1N2TA 2CSTA 2OGAA 2FQ6A 1IAYA 2R5CB 1MDXA 2BI2A 2VI8A 4MKJA 4BA4A 2Q7WA 4Q31A 2W7IA 2HORA 1TATA 3WCNA 2AY7A 4QGRA 5E4ZA 3PD6A 2X3LA 3FCRA 2VI9A 2Z61A 2AY6A 4HVKA 1ASMA 4ADBA 2AY4A 1TOEA 1AMQA 3DYDA 1SVVA 2HZPA 3MAFA 2X5DA 1GBNA 2C44A 1O4SA 2YKYA 2ZUKA 2VMUA 1B4XA 1B9HA 3L8AA 2BI9A 3E6GA 4W5KA 3AENB 2VGUA 4BMKA 2E7IA 2W7KA 3GJUA 2CJDA 1DGEA 3AENA 2TPLA 3DR7A 1X0MA 3H9XA 1ARHA 3NTJA 1JS6A 2YHKA 3B1EA 3MAFB 2Z9WA 3F9TA 4ITXA 4R8DA 1AIAA 5DB5A 2E7JA 2BIAA 3AOVA 2EPJA 4PIWA 3NYTA 4DGTA 3BWNA 5AX8A 3PD6B 3II0A 2BHXA 3BV0A 3FDDA 4F5GA 1TOKA 3R4TA 4F5FA 3QI6A 1UU1A 1GD9A 2BKWA 3FZ8A 1ASFA 1WKGA 3AEPA 1YOOA 2AY2A 1ARSA 4ZSYA 1UKJA 3ASBA 4KAMA 3NDNA 4IXOA 5E5IA 3CAIA 3DXWA 1JS3A 2OKKA 2CH2A 2GMSA 4J8LA 4ZWMA 1N31A 4K2MA 4FFCA 1RV4A 1OATA 4ZDOA 3E77A 1YAAA 3FVSA 3GSBA 2YCPA 1V2EA 3AV7A 3PIUA 2KFPA 3AELA 1AHEA 2ZY3A 3GETA 4LNMA 1WKHA 1GEWA 1OXPA 2EO5A 1O61A 3ELEA 3N4RA 1S06A 1CZCA 5J8QA 4BQ0A 2GSAA 3HMUA 5BJ3A 1E5FA 1CQ7A 1SZSA 2GB3A 3LVMA 4E77A 2W7JA 1KL1A 2JJGA 4BA5A 4CBSA 5JAYA 2W8TA 1Y4IA 5I92A 4K2IA 1C4KA 2R5EA 2ZSMA 1VEFA 3RCHA 1GDEA 3K28A 3BCXA 3FQ8A 9AATA 1CJ0A 3W1HA 1CL1A 3QN6A 3N4SA 4KYOA 3HBXA 3RBFA 1UU2A 3PAAA 1BJNA 2W7EA 1CQ6A 2D7YA 2JJFA 2VIAA 3E2FA 2EGYA 4WP0A 1JG8A 4PFNA 3COGA 3NUIA 2D64A 3WCOA 3P1TA 3LVLB 3LVJA 4IXSA 3WGCA 3E2YA 1FC4A 3I5TA 3FD0A 4ADCA 4ZWVA 3VOMA 1BW0A 1GEYA 1DGDA 4RJ0A 4BHDA 1AHFA 1VJOA 3ZZJA 1J32A 3GZDC 3N7NA 4ADDA 1B8GA 2C7TA 3CQ6A 3JZLA 1RVUA 2AEUA 3JWAA 1UU0A 5EIGB 2VGZA 3FKDA 3WGBA 4U1TA 3ECDA 3GZDA 3FRKA 4IYOB 3AEOA 1ASBA 1XEYA 2E54A 3B8XA 1ASAA 1IX7A 2CH1A 4ISYA 4RIZA 2VGVA 4Q75A 2QB2A 3VK2A 4F5MA 1BT4A 1IAXA 1LK9A 3FTBA 3DXVA 1M32A 5FT4A 1QJ5A 4A6UA 2FKIA 2ZY2A 2CINA 3E2ZB 4WBTA 4M2MA 4ZDLA 3HT4A 3WKSA 1BJWA 4WXBA 3VK4A 4K2BA 4RLGA 2W7LA 2DGKA 1AJSB 3N0LA 2AY5A 3TATA 3ZZKA 3EIAA 4AZJA 1M0PA 5FT8A 1U08A 1SF2A 4A6RA 1T3IA 1PFFA 3VAXA 5G0AA 4Y0HA 3BCBA 1I48A 2V1PA 3NU8A 1E5EA 1GC0A 1SPAA 2JGTA 3H7FA 1TARA 3LVKA 5G09A 3ZRQA 3A2BA 2E7UA 2RFVA 2W8JA 2BWPA 4A72A 1AKAA 1D2FA 4TMRA 3ELPA 5M4DA 5DX5A 2AY8A 2W7HA 1WYTB 2Z1YA 2VLHA 3ISLA 4M2JA 4GE9A 4WB0A 2JISA 4AO9A 3EI9A 3NUBA 4WXFA 5FT5A 5K8BA 4OYTA 1VP4A 4JEYA 4NOGA 4F5JA 4ZM3A 2DGMA 1ZC9A 5EUDA 2VGTA 4MQQA 1P3WA 2X8UA 1TOGA 4UHOA 2HP1A 3RUYA 3PPLA 3DZZA 3FZ6A 1MDZA 2Z9UA 1IBJA 1LC5A 3AEMA 4H51A 2D5YA 2CY8A 4Q6RA 1AKCA 1S0AA 4ADEA 2GQNA 2VMYA 2VMVA 1B5PA 4RM1A 4F5IA 1OHVA 4WYCA 2WKAA 1YIZA 4ZSWA 3BB8A 3UWCA 1IX8A 2CJGA 3Q8NA 1BKGA 1ASNA 4N0WA 2C81A 1WYVB 3LWSA 2ZP7A 1ARIA 4GE7A 4LW4A 3RBLA 2ZY5A 1QISA 1KMKA 1LKCA 2BI1A 4WYFA 3A9ZA 4P7YA 2OATA 4W1WA 2Z9XA 4L0OA 1V72A 3UE8A 2ZYJA 1Z7DA 4CBRA 2ORDA 2ZY4A 2YOBA 1LW4A 3EZ1A 4WLHA 1I29A 3MADA 4W1VA 2G6WA 4WLJA 2VMQA 4F4EA 3EI7A 2BI5A 3WY7A 4ZLVA 2D61A 4F5HA 2W7GA 4UQVA 4PFFA 4WXGA 4WD2A 4CXQA 1IJIA 3CBFA 1G7XA 1G4VA 4O6ZA 4ATPA 4IXZA 5G2QA 1EG5A 1C7NA 4ZDPA 2FYFA 5EUEA 2BWOA 1I43A 2VMNA 2CTZA 2VGWA 3FVXA 3M5UA 3PDBA 4GRXA 3RQ1A 1M7YA 2HUUA 5IWQA 1M0NA 1MDOA 2R2NA 4ATQA 2QLRA 1ZOBA 4OBVA 1CZEA 3FQAA 4M2KA 1YNUA 4EB7A 4H63Q 2XBNA 2HOYA 2BYLA 4W1XA 1QIRA 4RJYA 4EU1A 2JJHA 3PDBB 3WKRA 1X2AA 1AJRA 1I41A 1PMMA 2AEVA 2YRIA 3GR9A 3BN1A 3MBBA 3AATA 4A00A 5TF5A 1ASGA 1BQDA 1KAFA 1BJOB 2Z20A 3KGWA 2YKXA 4W91A 4I8AA 5EQCA 2VMTA 3E9KA 1YJYA 3K7YA 3F0HA 4LNLA 2PB2A 3LY1A 4A0RA 3G7QA 3PDXA 2V0YA 1IUGA 4W8IA 4A0GA 3HLMA 4LC3A 2BYJA 2AY3A 3ASAA 4XQ2A 4EB5A 3TCMA 1C7GA 4XJPA 4J5UA 2ZC0A 1W3UA 1O69A 4XK1A 3JTXA 2XH1A 1O62A 2DGLA 3PA9A 2C0RA 2OQXA 5EUNA 1GC2A 2A1VA 1QGNA 1PMOA 2QMAA 4ZAHA 3QHXA 1EQBA 3G8MA 3HVYA 4KXKA 4UHMA 3A9XA 2W7MA 2YKVA 1KKPA 3WX9A 4F5KA 3N5MA 1KL2A 1AMAA 3R9AA 3B1CA 2WK8A 3D6KA 4MY5A 1V2DA 3TFUA 3DODA 1MLZA 1YJSA 1BJ4A 1AHXA 2AY9A 3L44A 5DJ9A 4ZASA 4ITGA 3BWNC 1C0NA 1SZKA 2GMUA 3ACZA 4Y0DA 3BCAA 3NU7A 3NYUA 3WZFA 2VMWA 5FT6A 4JEWA 1CQ8A 1BJOA 1RV3A 3FFRA 1SFFA 3MKJA 3OP7A 4DBCA 4XEWA 3NX3A 2QBTA 4MQRA 1M4NA 4RKCA 3F6TA 2G7JA 4Y0IA 3AOWA 3CQ5A 1W7MA 4A0FA 4OCAA 3VP6A 2EZ2A 1FG7A 2JJEA 1QJ3A 1S08A 3NNKA 3HDOA 5M4BA 2D63A 1DJ9A 2DR1A 2BWNA 1FG3A 3LV2A 3NYSA 3W1JA 1G7WA 1AMRA 4RAEA 4XJOA 4CVQA 4OT8A 1H1CA 4AO4A 1AHGA 3N4XA 4WYGA 1BQAA 3FZ7A 3AEJC 3FFHA 4XJMA 2FM1A 2NMPA 3KE3A 2D66A 3PGYA 4JEXA 2QSRA 1AJSA 1YJZA 3NRAA 2O0RA 1ARGA 2WK7A 1AY4A 2DKJA 3EUCA 3E2ZA 4R5ZA 3RI6A 3K40A 2O7CA 1W7LA 5F9SA 1D7VA 1TOJA 2YRRA 4UHNA 3ATHA 3FSLA 7AATA 5DJ1A 2EYQA 2HOXA 1BS0A 1AKBA 4XAUA 5M46A 2Z9VA 2PB0A 4K05A 2ZSLA 2VYCA 4IYOA 4XJLA 1WYVA 2DOUA 4UOYA 3KGXA 3UAKA 1ELQA 3B1DA 1CS1A 4AZKA 2VMPA 2W7FA 3KKIA 3QBOA 1W23A 1YIYA 1C7OA 1LC8A 2CB1A 8AATA 1EJIA 2AY1A 2VMZA 1QZ9A 1OXOA 2DKBA 1C9CA 2JG2A 2VMRA 2WK9A 4E3RA 3TFTA 3ZRPA 2VGSA 3BC8A 5D95A 3A9YA 3QM2A 3BWOA 4JEVA 1TPLA 2WB6A 4GE4A 4TN4A 4JF0A 5HHYA 5EFSA 1DTYA 1ELUA 2HOZA 4WYEA 1IX6A 1JF9A 1V2FA 3PJ0A 3N75A 4JF1A 3FDBA 4F5LA 2F8JA 2VLFA 1MGVA 2BIEA 2EZ1A 5C6UA 4PVFA 2YCTA 2QA3A 2O1BA 4U2HA 2OGEA 4RITA 3AEJA 2OKJA 4WB0B 2PO3A 2Z1ZA 3AEMC 4IY7A 4RKDA 3EI8A 1ECXA 4OBUA 1WYTA 5G4JA 2W8WA 1XI9A 3P6KA 1MAPA 2X5FA 3GZCA 3ZRRA 2D7ZA 3FVUA 1AY8A 4LNJA 1ASLA 4ZM4A 3FQ7A 3W1IA 3B46A 1MLYA 1AAWA 4WYDA 3T32A 1LW5A 2CJHA 4LW2A 2VIBA 3HQTA 5BJ4A 1AX4A 3QGUA 5G2PA 1B5OA 1OHYA 2VMXA 1DFOA 3I4JA 4JEZA 4MSOA 1CL2A 4P3MA 1GC3A 3CQ4A 3TQXA 1AY5A 1M6SA 3USFA 3G0TA 1OHWA 1TOIA 5G4IA 2YCNA 1B9IA 2YKUA 1PG8A 4R5FA 2HUFA 5F8VA 2VMOA 4AH3A 3A8UX 4OTLA 5D5SA 1S07A 2FNUA 1Z3ZA 2W7DA 1DKAA 5EIGA 1TASA 1D7RA 3JWBA 2HP2A 4Q76A 1AMSA 3EI6A 2FNIA 1D7UA 1S09A 3MAUA 3IHJA 3DRDA 1M0QA 1MAQA 2EH6A 1IVRA 4A6TA 1GEXA 5E3KA 1J04A 3EI5A 4GDYA 4IX8A 2AATA 4CXRA 3MEBA 1LC7A 4GEBA 1WSTA 4MKKA 5EAAA 4FL0A 3LG0A 3DR4A 5EAVA 2D65A 4DQ6A 1LS3A 1AIBA 4GSAA 4WYAA 5KTBA 4HF8A 3GBXA 3QPGA 1QITA 2QB3A 1KKJA 2BI3A 5HXXA 4A0HA 1H0CA 1ASCA 3DC1A 3I16A 3WLXA 3RCHB 2W8VA 2W8UA 1ARTA 4R2NA 1DJEA 1SZUA 1GCKA 3DU4A 1AHYA
chains in the Genus database with same CATH topology
1ORDA 2ZJGA 4EFFA 4E1OA 2CFBA 5M49A 1ASEA 4EMYA 2HUIA 3BS8A 1ASDA 3EIBA 3MC6C 2BIGA 2R5CA 1AAMA 2CANA 2FN6A 1D7SA 1RVYA 1W7NA 2VMSA 1X28A 3MC6A 4E3QA 4B98A 1M0OA 4AOAA 3OKSA 1N8PA 4IW7A 1WYUA 3EZSA 3GWPA 1DJUA 1WYUB 2R0TA 3HL2A 5HDMA 1X29A 1G4XA 1GC4A 3JW9A 4OMAA 1AICA 4B9BA 3VK3A 1KMJA 1ZODA 4MQPA 4OC9A 1N2TA 2CSTA 2OGAA 2FQ6A 1IAYA 2R5CB 1MDXA 2BI2A 2VI8A 4MKJA 4BA4A 2Q7WA 4Q31A 2W7IA 2HORA 1TATA 3WCNA 2AY7A 4QGRA 5E4ZA 3PD6A 2X3LA 3FCRA 2VI9A 2Z61A 2AY6A 4HVKA 1ASMA 4ADBA 2AY4A 1TOEA 1AMQA 3DYDA 1SVVA 2HZPA 3MAFA 2X5DA 1GBNA 2C44A 1O4SA 2YKYA 2ZUKA 2VMUA 1B4XA 1B9HA 3L8AA 2BI9A 3E6GA 4W5KA 3AENB 2VGUA 4BMKA 2E7IA 2W7KA 3GJUA 2CJDA 1DGEA 3AENA 2TPLA 3DR7A 1X0MA 3H9XA 1ARHA 3NTJA 1JS6A 2YHKA 3B1EA 3MAFB 2Z9WA 3F9TA 4ITXA 4R8DA 1AIAA 5DB5A 2E7JA 2BIAA 3AOVA 2EPJA 4PIWA 3NYTA 4DGTA 3BWNA 5AX8A 3PD6B 3II0A 2BHXA 3BV0A 3FDDA 4F5GA 1TOKA 3R4TA 4F5FA 3QI6A 1UU1A 1GD9A 2BKWA 3FZ8A 1ASFA 1WKGA 3AEPA 1YOOA 2AY2A 1ARSA 4ZSYA 1UKJA 3ASBA 4KAMA 3NDNA 4IXOA 5E5IA 3CAIA 3DXWA 1JS3A 2OKKA 2CH2A 2GMSA 4J8LA 4ZWMA 1N31A 4K2MA 4FFCA 1RV4A 1OATA 4ZDOA 3E77A 1YAAA 3FVSA 3GSBA 2YCPA 1V2EA 3AV7A 3PIUA 2KFPA 3AELA 1AHEA 2ZY3A 3GETA 4LNMA 1WKHA 1GEWA 1OXPA 2EO5A 1O61A 3ELEA 3N4RA 1S06A 1CZCA 5J8QA 4BQ0A 2GSAA 3HMUA 5BJ3A 1E5FA 1CQ7A 1SZSA 2GB3A 3LVMA 4E77A 2W7JA 1KL1A 2JJGA 4BA5A 4CBSA 5JAYA 2W8TA 1Y4IA 5I92A 4K2IA 1C4KA 2R5EA 2ZSMA 1VEFA 3RCHA 1GDEA 3K28A 3BCXA 3FQ8A 9AATA 1CJ0A 3W1HA 1CL1A 3QN6A 3N4SA 4KYOA 3HBXA 3RBFA 1UU2A 3PAAA 1BJNA 2W7EA 1CQ6A 2D7YA 2JJFA 2VIAA 3E2FA 2EGYA 4WP0A 1JG8A 4PFNA 3COGA 3NUIA 2D64A 3WCOA 3P1TA 3LVLB 3LVJA 4IXSA 3WGCA 3E2YA 1FC4A 3I5TA 3FD0A 4ADCA 4ZWVA 3VOMA 1BW0A 1GEYA 1DGDA 4RJ0A 4BHDA 1AHFA 1VJOA 3ZZJA 1J32A 3GZDC 3N7NA 4ADDA 1B8GA 2C7TA 3CQ6A 3JZLA 1RVUA 2AEUA 3JWAA 1UU0A 5EIGB 2VGZA 3FKDA 3WGBA 4U1TA 3ECDA 3GZDA 3FRKA 4IYOB 3AEOA 1ASBA 1XEYA 2E54A 3B8XA 1ASAA 1IX7A 2CH1A 4ISYA 4RIZA 2VGVA 4Q75A 2QB2A 3VK2A 4F5MA 1BT4A 1IAXA 1LK9A 3FTBA 3DXVA 1M32A 5FT4A 1QJ5A 4A6UA 2FKIA 2ZY2A 2CINA 3E2ZB 4WBTA 4M2MA 4ZDLA 3HT4A 3WKSA 1BJWA 4WXBA 3VK4A 4K2BA 4RLGA 2W7LA 2DGKA 1AJSB 3N0LA 2AY5A 3TATA 3ZZKA 3EIAA 4AZJA 1M0PA 5FT8A 1U08A 1SF2A 4A6RA 1T3IA 1PFFA 3VAXA 5G0AA 4Y0HA 3BCBA 1I48A 2V1PA 3NU8A 1E5EA 1GC0A 1SPAA 2JGTA 3H7FA 1TARA 3LVKA 5G09A 3ZRQA 3A2BA 2E7UA 2RFVA 2W8JA 2BWPA 4A72A 1AKAA 1D2FA 4TMRA 3ELPA 5M4DA 5DX5A 2AY8A 2W7HA 1WYTB 2Z1YA 2VLHA 3ISLA 4M2JA 4GE9A 4WB0A 2JISA 4AO9A 3EI9A 3NUBA 4WXFA 5FT5A 5K8BA 4OYTA 1VP4A 4JEYA 4NOGA 4F5JA 4ZM3A 2DGMA 1ZC9A 5EUDA 2VGTA 4MQQA 1P3WA 2X8UA 1TOGA 4UHOA 2HP1A 3RUYA 3PPLA 3DZZA 3FZ6A 1MDZA 2Z9UA 1IBJA 1LC5A 3AEMA 4H51A 2D5YA 2CY8A 4Q6RA 1AKCA 1S0AA 4ADEA 2GQNA 2VMYA 2VMVA 1B5PA 4RM1A 4F5IA 1OHVA 4WYCA 2WKAA 1YIZA 4ZSWA 3BB8A 3UWCA 1IX8A 2CJGA 3Q8NA 1BKGA 1ASNA 4N0WA 2C81A 1WYVB 3LWSA 2ZP7A 1ARIA 4GE7A 4LW4A 3RBLA 2ZY5A 1QISA 1KMKA 1LKCA 2BI1A 4WYFA 3A9ZA 4P7YA 2OATA 4W1WA 2Z9XA 4L0OA 1V72A 3UE8A 2ZYJA 1Z7DA 4CBRA 2ORDA 2ZY4A 2YOBA 1LW4A 3EZ1A 4WLHA 1I29A 3MADA 4W1VA 2G6WA 4WLJA 2VMQA 4F4EA 3EI7A 2BI5A 3WY7A 4ZLVA 2D61A 4F5HA 2W7GA 4UQVA 4PFFA 4WXGA 4WD2A 4CXQA 1IJIA 3CBFA 1G7XA 1G4VA 4O6ZA 4ATPA 4IXZA 5G2QA 1EG5A 1C7NA 4ZDPA 2FYFA 5EUEA 2BWOA 1I43A 2VMNA 2CTZA 2VGWA 3FVXA 3M5UA 3PDBA 4GRXA 3RQ1A 1M7YA 2HUUA 5IWQA 1M0NA 1MDOA 2R2NA 4ATQA 2QLRA 1ZOBA 4OBVA 1CZEA 3FQAA 4M2KA 1YNUA 4EB7A 4H63Q 2XBNA 2HOYA 2BYLA 4W1XA 1QIRA 4RJYA 4EU1A 2JJHA 3PDBB 3WKRA 1X2AA 1AJRA 1I41A 1PMMA 2AEVA 2YRIA 3GR9A 3BN1A 3MBBA 3AATA 4A00A 5TF5A 1ASGA 1BQDA 3KGWA 1BJOB 2Z20A 4W91A 2YKXA 5EQCA 4I8AA 2VMTA 3E9KA 1YJYA 3K7YA 3F0HA 4LNLA 2PB2A 3LY1A 4A0RA 3G7QA 3PDXA 2V0YA 1IUGA 4W8IA 4A0GA 3HLMA 4LC3A 2BYJA 2AY3A 3ASAA 4XQ2A 4EB5A 3TCMA 1C7GA 4XJPA 4J5UA 2ZC0A 1W3UA 1O69A 4XK1A 3JTXA 2XH1A 1O62A 2DGLA 3PA9A 2C0RA 2OQXA 5EUNA 1GC2A 2A1VA 1QGNA 1PMOA 2QMAA 4ZAHA 3QHXA 1EQBA 3G8MA 3HVYA 4KXKA 4UHMA 3A9XA 2W7MA 2YKVA 1KKPA 3WX9A 4F5KA 3N5MA 1KL2A 1AMAA 3R9AA 3B1CA 2WK8A 3D6KA 4MY5A 1V2DA 3TFUA 3DODA 1MLZA 1YJSA 1BJ4A 1AHXA 2AY9A 3L44A 5DJ9A 4ZASA 4ITGA 3BWNC 1C0NA 1SZKA 2GMUA 3ACZA 4Y0DA 3BCAA 3NU7A 3NYUA 3WZFA 2VMWA 5FT6A 4JEWA 1CQ8A 1BJOA 1RV3A 3FFRA 1SFFA 3MKJA 3OP7A 4DBCA 4XEWA 3NX3A 2QBTA 4MQRA 1M4NA 4RKCA 3F6TA 2G7JA 4Y0IA 3AOWA 3CQ5A 1W7MA 4A0FA 4OCAA 3VP6A 2EZ2A 1FG7A 2JJEA 1QJ3A 1S08A 3NNKA 3HDOA 5M4BA 2D63A 1DJ9A 2DR1A 2BWNA 1FG3A 3LV2A 3NYSA 3W1JA 1G7WA 1AMRA 4RAEA 4XJOA 4CVQA 4OT8A 1H1CA 4AO4A 1AHGA 3N4XA 4WYGA 1BQAA 3FZ7A 3AEJC 3FFHA 4XJMA 2FM1A 2NMPA 3KE3A 2D66A 3PGYA 4JEXA 2QSRA 1AJSA 1YJZA 3NRAA 2O0RA 1ARGA 2WK7A 1AY4A 2DKJA 3EUCA 3E2ZA 4R5ZA 3RI6A 3K40A 2O7CA 1W7LA 5F9SA 1D7VA 1TOJA 2YRRA 4UHNA 3ATHA 3FSLA 7AATA 5DJ1A 2EYQA 2HOXA 1BS0A 1AKBA 4XAUA 5M46A 2Z9VA 2PB0A 4K05A 2ZSLA 2VYCA 4IYOA 4XJLA 1WYVA 2DOUA 4UOYA 3KGXA 3UAKA 1ELQA 3B1DA 1CS1A 4AZKA 2VMPA 2W7FA 3KKIA 3QBOA 1W23A 1YIYA 1C7OA 1LC8A 2CB1A 8AATA 1EJIA 2AY1A 2VMZA 1QZ9A 1OXOA 2DKBA 1C9CA 2JG2A 2VMRA 2WK9A 4E3RA 3TFTA 3ZRPA 2VGSA 3BC8A 5D95A 3A9YA 3QM2A 3BWOA 4JEVA 1TPLA 2WB6A 4GE4A 4TN4A 4JF0A 5HHYA 5EFSA 1DTYA 1ELUA 2HOZA 4WYEA 1IX6A 1JF9A 1V2FA 3PJ0A 3N75A 4JF1A 3FDBA 4F5LA 2F8JA 2VLFA 1MGVA 2BIEA 2EZ1A 5C6UA 4PVFA 2YCTA 2QA3A 2O1BA 4U2HA 2OGEA 4RITA 3AEJA 2OKJA 4WB0B 2PO3A 2Z1ZA 3AEMC 4IY7A 4RKDA 3EI8A 1ECXA 4OBUA 1WYTA 5G4JA 2W8WA 1XI9A 3P6KA 1MAPA 2X5FA 3GZCA 3ZRRA 2D7ZA 3FVUA 1AY8A 4LNJA 1ASLA 4ZM4A 3FQ7A 3W1IA 3B46A 1MLYA 1AAWA 4WYDA 3T32A 1LW5A 2CJHA 4LW2A 2VIBA 3HQTA 5BJ4A 1AX4A 3QGUA 5G2PA 1B5OA 1OHYA 2VMXA 1DFOA 3I4JA 4JEZA 4MSOA 1CL2A 4P3MA 1GC3A 3CQ4A 3TQXA 1AY5A 1M6SA 3USFA 3G0TA 1OHWA 1TOIA 5G4IA 2YCNA 1B9IA 2YKUA 1PG8A 4R5FA 2HUFA 5F8VA 2VMOA 4AH3A 3A8UX 4OTLA 5D5SA 1S07A 2FNUA 1Z3ZA 2W7DA 1DKAA 5EIGA 1TASA 1D7RA 3JWBA 2HP2A 4Q76A 1AMSA 3EI6A 2FNIA 1D7UA 1S09A 3MAUA 3IHJA 3DRDA 1M0QA 1MAQA 2EH6A 1IVRA 4A6TA 1GEXA 5E3KA 1J04A 3EI5A 4GDYA 4IX8A 2AATA 4CXRA 3MEBA 1LC7A 4GEBA 1WSTA 4MKKA 5EAAA 4FL0A 3LG0A 3DR4A 5EAVA 2D65A 4DQ6A 1LS3A 1AIBA 4GSAA 4WYAA 5KTBA 4HF8A 3GBXA 3QPGA 1QITA 2QB3A 1KKJA 2BI3A 5HXXA 4A0HA 1H0CA 1ASCA 3DC1A 3I16A 3WLXA 3RCHB 2W8VA 2W8UA 1ARTA 4R2NA 1DJEA 1SZUA 1GCKA 3DU4A 1AHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKI A;  2A1V A;  2KFP A;  3H9X A; 
#chains in the Genus database with same CATH topology
 1ORD A;  2ZJG A;  4EFF A;  4E1O A;  2CFB A;  5M49 A;  1ASE A;  4EMY A;  2HUI A;  3BS8 A;  1ASD A;  3EIB A;  3MC6 C;  2BIG A;  2R5C A;  1AAM A;  2CAN A;  2FN6 A;  1D7S A;  1RVY A;  1W7N A;  2VMS A;  1X28 A;  3MC6 A;  4E3Q A;  4B98 A;  1M0O A;  4AOA A;  3OKS A;  1N8P A;  4IW7 A;  1WYU A;  3EZS A;  3GWP A;  1DJU A;  1WYU B;  2R0T A;  3HL2 A;  5HDM A;  1X29 A;  1G4X A;  1GC4 A;  3JW9 A;  4OMA A;  1AIC A;  4B9B A;  3VK3 A;  1KMJ A;  1ZOD A;  4MQP A;  4OC9 A;  1N2T A;  2CST A;  2OGA A;  2FQ6 A;  1IAY A;  2R5C B;  1MDX A;  2BI2 A;  2VI8 A;  4MKJ A;  4BA4 A;  2Q7W A;  4Q31 A;  2W7I A;  2HOR A;  1TAT A;  3WCN A;  2AY7 A;  4QGR A;  5E4Z A;  3PD6 A;  2X3L A;  3FCR A;  2VI9 A;  2Z61 A;  2AY6 A;  4HVK A;  1ASM A;  4ADB A;  2AY4 A;  1TOE A;  1AMQ A;  3DYD A;  1SVV A;  2HZP A;  3MAF A;  2X5D A;  1GBN A;  2C44 A;  1O4S A;  2YKY A;  2ZUK A;  2VMU A;  1B4X A;  1B9H A;  3L8A A;  2BI9 A;  3E6G A;  4W5K A;  3AEN B;  2VGU A;  4BMK A;  2E7I A;  2W7K A;  3GJU A;  2CJD A;  1DGE A;  3AEN A;  2TPL A;  3DR7 A;  1X0M A;  3H9X A;  1ARH A;  3NTJ A;  1JS6 A;  2YHK A;  3B1E A;  3MAF B;  2Z9W A;  3F9T A;  4ITX A;  4R8D A;  1AIA A;  5DB5 A;  2E7J A;  2BIA A;  3AOV A;  2EPJ A;  4PIW A;  3NYT A;  4DGT A;  3BWN A;  5AX8 A;  3PD6 B;  3II0 A;  2BHX A;  3BV0 A;  3FDD A;  4F5G A;  1TOK A;  3R4T A;  4F5F A;  3QI6 A;  1UU1 A;  1GD9 A;  2BKW A;  3FZ8 A;  1ASF A;  1WKG A;  3AEP A;  1YOO A;  2AY2 A;  1ARS A;  4ZSY A;  1UKJ A;  3ASB A;  4KAM A;  3NDN A;  4IXO A;  5E5I A;  3CAI A;  3DXW A;  1JS3 A;  2OKK A;  2CH2 A;  2GMS A;  4J8L A;  4ZWM A;  1N31 A;  4K2M A;  4FFC A;  1RV4 A;  1OAT A;  4ZDO A;  3E77 A;  1YAA A;  3FVS A;  3GSB A;  2YCP A;  1V2E A;  3AV7 A;  3PIU A;  2KFP A;  3AEL A;  1AHE A;  2ZY3 A;  3GET A;  4LNM A;  1WKH A;  1GEW A;  1OXP A;  2EO5 A;  1O61 A;  3ELE A;  3N4R A;  1S06 A;  1CZC A;  5J8Q A;  4BQ0 A;  2GSA A;  3HMU A;  5BJ3 A;  1E5F A;  1CQ7 A;  1SZS A;  2GB3 A;  3LVM A;  4E77 A;  2W7J A;  1KL1 A;  2JJG A;  4BA5 A;  4CBS A;  5JAY A;  2W8T A;  1Y4I A;  5I92 A;  4K2I A;  1C4K A;  2R5E A;  2ZSM A;  1VEF A;  3RCH A;  1GDE A;  3K28 A;  3BCX A;  3FQ8 A;  9AAT A;  1CJ0 A;  3W1H A;  1CL1 A;  3QN6 A;  3N4S A;  4KYO A;  3HBX A;  3RBF A;  1UU2 A;  3PAA A;  1BJN A;  2W7E A;  1CQ6 A;  2D7Y A;  2JJF A;  2VIA A;  3E2F A;  2EGY A;  4WP0 A;  1JG8 A;  4PFN A;  3COG A;  3NUI A;  2D64 A;  3WCO A;  3P1T A;  3LVL B;  3LVJ A;  4IXS A;  3WGC A;  3E2Y A;  1FC4 A;  3I5T A;  3FD0 A;  4ADC A;  4ZWV A;  3VOM A;  1BW0 A;  1GEY A;  1DGD A;  4RJ0 A;  4BHD A;  1AHF A;  1VJO A;  3ZZJ A;  1J32 A;  3GZD C;  3N7N A;  4ADD A;  1B8G A;  2C7T A;  3CQ6 A;  3JZL A;  1RVU A;  2AEU A;  3JWA A;  1UU0 A;  5EIG B;  2VGZ A;  3FKD A;  3WGB A;  4U1T A;  3ECD A;  3GZD A;  3FRK A;  4IYO B;  3AEO A;  1ASB A;  1XEY A;  2E54 A;  3B8X A;  1ASA A;  1IX7 A;  2CH1 A;  4ISY A;  4RIZ A;  2VGV A;  4Q75 A;  2QB2 A;  3VK2 A;  4F5M A;  1BT4 A;  1IAX A;  1LK9 A;  3FTB A;  3DXV A;  1M32 A;  5FT4 A;  1QJ5 A;  4A6U A;  2FKI A;  2ZY2 A;  2CIN A;  3E2Z B;  4WBT A;  4M2M A;  4ZDL A;  3HT4 A;  3WKS A;  1BJW A;  4WXB A;  3VK4 A;  4K2B A;  4RLG A;  2W7L A;  2DGK A;  1AJS B;  3N0L A;  2AY5 A;  3TAT A;  3ZZK A;  3EIA A;  4AZJ A;  1M0P A;  5FT8 A;  1U08 A;  1SF2 A;  4A6R A;  1T3I A;  1PFF A;  3VAX A;  5G0A A;  4Y0H A;  3BCB A;  1I48 A;  2V1P A;  3NU8 A;  1E5E A;  1GC0 A;  1SPA A;  2JGT A;  3H7F A;  1TAR A;  3LVK A;  5G09 A;  3ZRQ A;  3A2B A;  2E7U A;  2RFV A;  2W8J A;  2BWP A;  4A72 A;  1AKA A;  1D2F A;  4TMR A;  3ELP A;  5M4D A;  5DX5 A;  2AY8 A;  2W7H A;  1WYT B;  2Z1Y A;  2VLH A;  3ISL A;  4M2J A;  4GE9 A;  4WB0 A;  2JIS A;  4AO9 A;  3EI9 A;  3NUB A;  4WXF A;  5FT5 A;  5K8B A;  4OYT A;  1VP4 A;  4JEY A;  4NOG A;  4F5J A;  4ZM3 A;  2DGM A;  1ZC9 A;  5EUD A;  2VGT A;  4MQQ A;  1P3W A;  2X8U A;  1TOG A;  4UHO A;  2HP1 A;  3RUY A;  3PPL A;  3DZZ A;  3FZ6 A;  1MDZ A;  2Z9U A;  1IBJ A;  1LC5 A;  3AEM A;  4H51 A;  2D5Y A;  2CY8 A;  4Q6R A;  1AKC A;  1S0A A;  4ADE A;  2GQN A;  2VMY A;  2VMV A;  1B5P A;  4RM1 A;  4F5I A;  1OHV A;  4WYC A;  2WKA A;  1YIZ A;  4ZSW A;  3BB8 A;  3UWC A;  1IX8 A;  2CJG A;  3Q8N A;  1BKG A;  1ASN A;  4N0W A;  2C81 A;  1WYV B;  3LWS A;  2ZP7 A;  1ARI A;  4GE7 A;  4LW4 A;  3RBL A;  2ZY5 A;  1QIS A;  1KMK A;  1LKC A;  2BI1 A;  4WYF A;  3A9Z A;  4P7Y A;  2OAT A;  4W1W A;  2Z9X A;  4L0O A;  1V72 A;  3UE8 A;  2ZYJ A;  1Z7D A;  4CBR A;  2ORD A;  2ZY4 A;  2YOB A;  1LW4 A;  3EZ1 A;  4WLH A;  1I29 A;  3MAD A;  4W1V A;  2G6W A;  4WLJ A;  2VMQ A;  4F4E A;  3EI7 A;  2BI5 A;  3WY7 A;  4ZLV A;  2D61 A;  4F5H A;  2W7G A;  4UQV A;  4PFF A;  4WXG A;  4WD2 A;  4CXQ A;  1IJI A;  3CBF A;  1G7X A;  1G4V A;  4O6Z A;  4ATP A;  4IXZ A;  5G2Q A;  1EG5 A;  1C7N A;  4ZDP A;  2FYF A;  5EUE A;  2BWO A;  1I43 A;  2VMN A;  2CTZ A;  2VGW A;  3FVX A;  3M5U A;  3PDB A;  4GRX A;  3RQ1 A;  1M7Y A;  2HUU A;  5IWQ A;  1M0N A;  1MDO A;  2R2N A;  4ATQ A;  2QLR A;  1ZOB A;  4OBV A;  1CZE A;  3FQA A;  4M2K A;  1YNU A;  4EB7 A;  4H63 Q;  2XBN A;  2HOY A;  2BYL A;  4W1X A;  1QIR A;  4RJY A;  4EU1 A;  2JJH A;  3PDB B;  3WKR A;  1X2A A;  1AJR A;  1I41 A;  1PMM A;  2AEV A;  2YRI A;  3GR9 A;  3BN1 A;  3MBB A;  3AAT A;  4A00 A;  5TF5 A;  1ASG A;  1BQD A;  1KAF A;  1BJO B;  2Z20 A;  3KGW A;  2YKX A;  4W91 A;  4I8A A;  5EQC A;  2VMT A;  3E9K A;  1YJY A;  3K7Y A;  3F0H A;  4LNL A;  2PB2 A;  3LY1 A;  4A0R A;  3G7Q A;  3PDX A;  2V0Y A;  1IUG A;  4W8I A;  4A0G A;  3HLM A;  4LC3 A;  2BYJ A;  2AY3 A;  3ASA A;  4XQ2 A;  4EB5 A;  3TCM A;  1C7G A;  4XJP A;  4J5U A;  2ZC0 A;  1W3U A;  1O69 A;  4XK1 A;  3JTX A;  2XH1 A;  1O62 A;  2DGL A;  3PA9 A;  2C0R A;  2OQX A;  5EUN A;  1GC2 A;  2A1V A;  1QGN A;  1PMO A;  2QMA A;  4ZAH A;  3QHX A;  1EQB A;  3G8M A;  3HVY A;  4KXK A;  4UHM A;  3A9X A;  2W7M A;  2YKV A;  1KKP A;  3WX9 A;  4F5K A;  3N5M A;  1KL2 A;  1AMA A;  3R9A A;  3B1C A;  2WK8 A;  3D6K A;  4MY5 A;  1V2D A;  3TFU A;  3DOD A;  1MLZ A;  1YJS A;  1BJ4 A;  1AHX A;  2AY9 A;  3L44 A;  5DJ9 A;  4ZAS A;  4ITG A;  3BWN C;  1C0N A;  1SZK A;  2GMU A;  3ACZ A;  4Y0D A;  3BCA A;  3NU7 A;  3NYU A;  3WZF A;  2VMW A;  5FT6 A;  4JEW A;  1CQ8 A;  1BJO A;  1RV3 A;  3FFR A;  1SFF A;  3MKJ A;  3OP7 A;  4DBC A;  4XEW A;  3NX3 A;  2QBT A;  4MQR A;  1M4N A;  4RKC A;  3F6T A;  2G7J A;  4Y0I A;  3AOW A;  3CQ5 A;  1W7M A;  4A0F A;  4OCA A;  3VP6 A;  2EZ2 A;  1FG7 A;  2JJE A;  1QJ3 A;  1S08 A;  3NNK A;  3HDO A;  5M4B A;  2D63 A;  1DJ9 A;  2DR1 A;  2BWN A;  1FG3 A;  3LV2 A;  3NYS A;  3W1J A;  1G7W A;  1AMR A;  4RAE A;  4XJO A;  4CVQ A;  4OT8 A;  1H1C A;  4AO4 A;  1AHG A;  3N4X A;  4WYG A;  1BQA A;  3FZ7 A;  3AEJ C;  3FFH A;  4XJM A;  2FM1 A;  2NMP A;  3KE3 A;  2D66 A;  3PGY A;  4JEX A;  2QSR A;  1AJS A;  1YJZ A;  3NRA A;  2O0R A;  1ARG A;  2WK7 A;  1AY4 A;  2DKJ A;  3EUC A;  3E2Z A;  4R5Z A;  3RI6 A;  3K40 A;  2O7C A;  1W7L A;  5F9S A;  1D7V A;  1TOJ A;  2YRR A;  4UHN A;  3ATH A;  3FSL A;  7AAT A;  5DJ1 A;  2EYQ A;  2HOX A;  1BS0 A;  1AKB A;  4XAU A;  5M46 A;  2Z9V A;  2PB0 A;  4K05 A;  2ZSL A;  2VYC A;  4IYO A;  4XJL A;  1WYV A;  2DOU A;  4UOY A;  3KGX A;  3UAK A;  1ELQ A;  3B1D A;  1CS1 A;  4AZK A;  2VMP A;  2W7F A;  3KKI A;  3QBO A;  1W23 A;  1YIY A;  1C7O A;  1LC8 A;  2CB1 A;  8AAT A;  1EJI A;  2AY1 A;  2VMZ A;  1QZ9 A;  1OXO A;  2DKB A;  1C9C A;  2JG2 A;  2VMR A;  2WK9 A;  4E3R A;  3TFT A;  3ZRP A;  2VGS A;  3BC8 A;  5D95 A;  3A9Y A;  3QM2 A;  3BWO A;  4JEV A;  1TPL A;  2WB6 A;  4GE4 A;  4TN4 A;  4JF0 A;  5HHY A;  5EFS A;  1DTY A;  1ELU A;  2HOZ A;  4WYE A;  1IX6 A;  1JF9 A;  1V2F A;  3PJ0 A;  3N75 A;  4JF1 A;  3FDB A;  4F5L A;  2F8J A;  2VLF A;  1MGV A;  2BIE A;  2EZ1 A;  5C6U A;  4PVF A;  2YCT A;  2QA3 A;  2O1B A;  4U2H A;  2OGE A;  4RIT A;  3AEJ A;  2OKJ A;  4WB0 B;  2PO3 A;  2Z1Z A;  3AEM C;  4IY7 A;  4RKD A;  3EI8 A;  1ECX A;  4OBU A;  1WYT A;  5G4J A;  2W8W A;  1XI9 A;  3P6K A;  1MAP A;  2X5F A;  3GZC A;  3ZRR A;  2D7Z A;  3FVU A;  1AY8 A;  4LNJ A;  1ASL A;  4ZM4 A;  3FQ7 A;  3W1I A;  3B46 A;  1MLY A;  1AAW A;  4WYD A;  3T32 A;  1LW5 A;  2CJH A;  4LW2 A;  2VIB A;  3HQT A;  5BJ4 A;  1AX4 A;  3QGU A;  5G2P A;  1B5O A;  1OHY A;  2VMX A;  1DFO A;  3I4J A;  4JEZ A;  4MSO A;  1CL2 A;  4P3M A;  1GC3 A;  3CQ4 A;  3TQX A;  1AY5 A;  1M6S A;  3USF A;  3G0T A;  1OHW A;  1TOI A;  5G4I A;  2YCN A;  1B9I A;  2YKU A;  1PG8 A;  4R5F A;  2HUF A;  5F8V A;  2VMO A;  4AH3 A;  3A8U X;  4OTL A;  5D5S A;  1S07 A;  2FNU A;  1Z3Z A;  2W7D A;  1DKA A;  5EIG A;  1TAS A;  1D7R A;  3JWB A;  2HP2 A;  4Q76 A;  1AMS A;  3EI6 A;  2FNI A;  1D7U A;  1S09 A;  3MAU A;  3IHJ A;  3DRD A;  1M0Q A;  1MAQ A;  2EH6 A;  1IVR A;  4A6T A;  1GEX A;  5E3K A;  1J04 A;  3EI5 A;  4GDY A;  4IX8 A;  2AAT A;  4CXR A;  3MEB A;  1LC7 A;  4GEB A;  1WST A;  4MKK A;  5EAA A;  4FL0 A;  3LG0 A;  3DR4 A;  5EAV A;  2D65 A;  4DQ6 A;  1LS3 A;  1AIB A;  4GSA A;  4WYA A;  5KTB A;  4HF8 A;  3GBX A;  3QPG A;  1QIT A;  2QB3 A;  1KKJ A;  2BI3 A;  5HXX A;  4A0H A;  1H0C A;  1ASC A;  3DC1 A;  3I16 A;  3WLX A;  3RCH B;  2W8V A;  2W8U A;  1ART A;  4R2N A;  1DJE A;  1SZU A;  1GCK A;  3DU4 A;  1AHY A; 
#chains in the Genus database with same CATH homology
 1ORD A;  2ZJG A;  4EFF A;  4E1O A;  2CFB A;  5M49 A;  1ASE A;  4EMY A;  2HUI A;  3BS8 A;  1ASD A;  3EIB A;  3MC6 C;  2BIG A;  2R5C A;  1AAM A;  2CAN A;  2FN6 A;  1D7S A;  1RVY A;  1W7N A;  2VMS A;  1X28 A;  3MC6 A;  4E3Q A;  4B98 A;  1M0O A;  4AOA A;  3OKS A;  1N8P A;  4IW7 A;  1WYU A;  3EZS A;  3GWP A;  1DJU A;  1WYU B;  2R0T A;  3HL2 A;  5HDM A;  1X29 A;  1G4X A;  1GC4 A;  3JW9 A;  4OMA A;  1AIC A;  4B9B A;  3VK3 A;  1KMJ A;  1ZOD A;  4MQP A;  4OC9 A;  1N2T A;  2CST A;  2OGA A;  2FQ6 A;  1IAY A;  2R5C B;  1MDX A;  2BI2 A;  2VI8 A;  4MKJ A;  4BA4 A;  2Q7W A;  4Q31 A;  2W7I A;  2HOR A;  1TAT A;  3WCN A;  2AY7 A;  4QGR A;  5E4Z A;  3PD6 A;  2X3L A;  3FCR A;  2VI9 A;  2Z61 A;  2AY6 A;  4HVK A;  1ASM A;  4ADB A;  2AY4 A;  1TOE A;  1AMQ A;  3DYD A;  1SVV A;  2HZP A;  3MAF A;  2X5D A;  1GBN A;  2C44 A;  1O4S A;  2YKY A;  2ZUK A;  2VMU A;  1B4X A;  1B9H A;  3L8A A;  2BI9 A;  3E6G A;  4W5K A;  3AEN B;  2VGU A;  4BMK A;  2E7I A;  2W7K A;  3GJU A;  2CJD A;  1DGE A;  3AEN A;  2TPL A;  3DR7 A;  1X0M A;  3H9X A;  1ARH A;  3NTJ A;  1JS6 A;  2YHK A;  3B1E A;  3MAF B;  2Z9W A;  3F9T A;  4ITX A;  4R8D A;  1AIA A;  5DB5 A;  2E7J A;  2BIA A;  3AOV A;  2EPJ A;  4PIW A;  3NYT A;  4DGT A;  3BWN A;  5AX8 A;  3PD6 B;  3II0 A;  2BHX A;  3BV0 A;  3FDD A;  4F5G A;  1TOK A;  3R4T A;  4F5F A;  3QI6 A;  1UU1 A;  1GD9 A;  2BKW A;  3FZ8 A;  1ASF A;  1WKG A;  3AEP A;  1YOO A;  2AY2 A;  1ARS A;  4ZSY A;  1UKJ A;  3ASB A;  4KAM A;  3NDN A;  4IXO A;  5E5I A;  3CAI A;  3DXW A;  1JS3 A;  2OKK A;  2CH2 A;  2GMS A;  4J8L A;  4ZWM A;  1N31 A;  4K2M A;  4FFC A;  1RV4 A;  1OAT A;  4ZDO A;  3E77 A;  1YAA A;  3FVS A;  3GSB A;  2YCP A;  1V2E A;  3AV7 A;  3PIU A;  2KFP A;  3AEL A;  1AHE A;  2ZY3 A;  3GET A;  4LNM A;  1WKH A;  1GEW A;  1OXP A;  2EO5 A;  1O61 A;  3ELE A;  3N4R A;  1S06 A;  1CZC A;  5J8Q A;  4BQ0 A;  2GSA A;  3HMU A;  5BJ3 A;  1E5F A;  1CQ7 A;  1SZS A;  2GB3 A;  3LVM A;  4E77 A;  2W7J A;  1KL1 A;  2JJG A;  4BA5 A;  4CBS A;  5JAY A;  2W8T A;  1Y4I A;  5I92 A;  4K2I A;  1C4K A;  2R5E A;  2ZSM A;  1VEF A;  3RCH A;  1GDE A;  3K28 A;  3BCX A;  3FQ8 A;  9AAT A;  1CJ0 A;  3W1H A;  1CL1 A;  3QN6 A;  3N4S A;  4KYO A;  3HBX A;  3RBF A;  1UU2 A;  3PAA A;  1BJN A;  2W7E A;  1CQ6 A;  2D7Y A;  2JJF A;  2VIA A;  3E2F A;  2EGY A;  4WP0 A;  1JG8 A;  4PFN A;  3COG A;  3NUI A;  2D64 A;  3WCO A;  3P1T A;  3LVL B;  3LVJ A;  4IXS A;  3WGC A;  3E2Y A;  1FC4 A;  3I5T A;  3FD0 A;  4ADC A;  4ZWV A;  3VOM A;  1BW0 A;  1GEY A;  1DGD A;  4RJ0 A;  4BHD A;  1AHF A;  1VJO A;  3ZZJ A;  1J32 A;  3GZD C;  3N7N A;  4ADD A;  1B8G A;  2C7T A;  3CQ6 A;  3JZL A;  1RVU A;  2AEU A;  3JWA A;  1UU0 A;  5EIG B;  2VGZ A;  3FKD A;  3WGB A;  4U1T A;  3ECD A;  3GZD A;  3FRK A;  4IYO B;  3AEO A;  1ASB A;  1XEY A;  2E54 A;  3B8X A;  1ASA A;  1IX7 A;  2CH1 A;  4ISY A;  4RIZ A;  2VGV A;  4Q75 A;  2QB2 A;  3VK2 A;  4F5M A;  1BT4 A;  1IAX A;  1LK9 A;  3FTB A;  3DXV A;  1M32 A;  5FT4 A;  1QJ5 A;  4A6U A;  2FKI A;  2ZY2 A;  2CIN A;  3E2Z B;  4WBT A;  4M2M A;  4ZDL A;  3HT4 A;  3WKS A;  1BJW A;  4WXB A;  3VK4 A;  4K2B A;  4RLG A;  2W7L A;  2DGK A;  1AJS B;  3N0L A;  2AY5 A;  3TAT A;  3ZZK A;  3EIA A;  4AZJ A;  1M0P A;  5FT8 A;  1U08 A;  1SF2 A;  4A6R A;  1T3I A;  1PFF A;  3VAX A;  5G0A A;  4Y0H A;  3BCB A;  1I48 A;  2V1P A;  3NU8 A;  1E5E A;  1GC0 A;  1SPA A;  2JGT A;  3H7F A;  1TAR A;  3LVK A;  5G09 A;  3ZRQ A;  3A2B A;  2E7U A;  2RFV A;  2W8J A;  2BWP A;  4A72 A;  1AKA A;  1D2F A;  4TMR A;  3ELP A;  5M4D A;  5DX5 A;  2AY8 A;  2W7H A;  1WYT B;  2Z1Y A;  2VLH A;  3ISL A;  4M2J A;  4GE9 A;  4WB0 A;  2JIS A;  4AO9 A;  3EI9 A;  3NUB A;  4WXF A;  5FT5 A;  5K8B A;  4OYT A;  1VP4 A;  4JEY A;  4NOG A;  4F5J A;  4ZM3 A;  2DGM A;  1ZC9 A;  5EUD A;  2VGT A;  4MQQ A;  1P3W A;  2X8U A;  1TOG A;  4UHO A;  2HP1 A;  3RUY A;  3PPL A;  3DZZ A;  3FZ6 A;  1MDZ A;  2Z9U A;  1IBJ A;  1LC5 A;  3AEM A;  4H51 A;  2D5Y A;  2CY8 A;  4Q6R A;  1AKC A;  1S0A A;  4ADE A;  2GQN A;  2VMY A;  2VMV A;  1B5P A;  4RM1 A;  4F5I A;  1OHV A;  4WYC A;  2WKA A;  1YIZ A;  4ZSW A;  3BB8 A;  3UWC A;  1IX8 A;  2CJG A;  3Q8N A;  1BKG A;  1ASN A;  4N0W A;  2C81 A;  1WYV B;  3LWS A;  2ZP7 A;  1ARI A;  4GE7 A;  4LW4 A;  3RBL A;  2ZY5 A;  1QIS A;  1KMK A;  1LKC A;  2BI1 A;  4WYF A;  3A9Z A;  4P7Y A;  2OAT A;  4W1W A;  2Z9X A;  4L0O A;  1V72 A;  3UE8 A;  2ZYJ A;  1Z7D A;  4CBR A;  2ORD A;  2ZY4 A;  2YOB A;  1LW4 A;  3EZ1 A;  4WLH A;  1I29 A;  3MAD A;  4W1V A;  2G6W A;  4WLJ A;  2VMQ A;  4F4E A;  3EI7 A;  2BI5 A;  3WY7 A;  4ZLV A;  2D61 A;  4F5H A;  2W7G A;  4UQV A;  4PFF A;  4WXG A;  4WD2 A;  4CXQ A;  1IJI A;  3CBF A;  1G7X A;  1G4V A;  4O6Z A;  4ATP A;  4IXZ A;  5G2Q A;  1EG5 A;  1C7N A;  4ZDP A;  2FYF A;  5EUE A;  2BWO A;  1I43 A;  2VMN A;  2CTZ A;  2VGW A;  3FVX A;  3M5U A;  3PDB A;  4GRX A;  3RQ1 A;  1M7Y A;  2HUU A;  5IWQ A;  1M0N A;  1MDO A;  2R2N A;  4ATQ A;  2QLR A;  1ZOB A;  4OBV A;  1CZE A;  3FQA A;  4M2K A;  1YNU A;  4EB7 A;  4H63 Q;  2XBN A;  2HOY A;  2BYL A;  4W1X A;  1QIR A;  4RJY A;  4EU1 A;  2JJH A;  3PDB B;  3WKR A;  1X2A A;  1AJR A;  1I41 A;  1PMM A;  2AEV A;  2YRI A;  3GR9 A;  3BN1 A;  3MBB A;  3AAT A;  4A00 A;  5TF5 A;  1ASG A;  1BQD A;  3KGW A;  1BJO B;  2Z20 A;  4W91 A;  2YKX A;  5EQC A;  4I8A A;  2VMT A;  3E9K A;  1YJY A;  3K7Y A;  3F0H A;  4LNL A;  2PB2 A;  3LY1 A;  4A0R A;  3G7Q A;  3PDX A;  2V0Y A;  1IUG A;  4W8I A;  4A0G A;  3HLM A;  4LC3 A;  2BYJ A;  2AY3 A;  3ASA A;  4XQ2 A;  4EB5 A;  3TCM A;  1C7G A;  4XJP A;  4J5U A;  2ZC0 A;  1W3U A;  1O69 A;  4XK1 A;  3JTX A;  2XH1 A;  1O62 A;  2DGL A;  3PA9 A;  2C0R A;  2OQX A;  5EUN A;  1GC2 A;  2A1V A;  1QGN A;  1PMO A;  2QMA A;  4ZAH A;  3QHX A;  1EQB A;  3G8M A;  3HVY A;  4KXK A;  4UHM A;  3A9X A;  2W7M A;  2YKV A;  1KKP A;  3WX9 A;  4F5K A;  3N5M A;  1KL2 A;  1AMA A;  3R9A A;  3B1C A;  2WK8 A;  3D6K A;  4MY5 A;  1V2D A;  3TFU A;  3DOD A;  1MLZ A;  1YJS A;  1BJ4 A;  1AHX A;  2AY9 A;  3L44 A;  5DJ9 A;  4ZAS A;  4ITG A;  3BWN C;  1C0N A;  1SZK A;  2GMU A;  3ACZ A;  4Y0D A;  3BCA A;  3NU7 A;  3NYU A;  3WZF A;  2VMW A;  5FT6 A;  4JEW A;  1CQ8 A;  1BJO A;  1RV3 A;  3FFR A;  1SFF A;  3MKJ A;  3OP7 A;  4DBC A;  4XEW A;  3NX3 A;  2QBT A;  4MQR A;  1M4N A;  4RKC A;  3F6T A;  2G7J A;  4Y0I A;  3AOW A;  3CQ5 A;  1W7M A;  4A0F A;  4OCA A;  3VP6 A;  2EZ2 A;  1FG7 A;  2JJE A;  1QJ3 A;  1S08 A;  3NNK A;  3HDO A;  5M4B A;  2D63 A;  1DJ9 A;  2DR1 A;  2BWN A;  1FG3 A;  3LV2 A;  3NYS A;  3W1J A;  1G7W A;  1AMR A;  4RAE A;  4XJO A;  4CVQ A;  4OT8 A;  1H1C A;  4AO4 A;  1AHG A;  3N4X A;  4WYG A;  1BQA A;  3FZ7 A;  3AEJ C;  3FFH A;  4XJM A;  2FM1 A;  2NMP A;  3KE3 A;  2D66 A;  3PGY A;  4JEX A;  2QSR A;  1AJS A;  1YJZ A;  3NRA A;  2O0R A;  1ARG A;  2WK7 A;  1AY4 A;  2DKJ A;  3EUC A;  3E2Z A;  4R5Z A;  3RI6 A;  3K40 A;  2O7C A;  1W7L A;  5F9S A;  1D7V A;  1TOJ A;  2YRR A;  4UHN A;  3ATH A;  3FSL A;  7AAT A;  5DJ1 A;  2EYQ A;  2HOX A;  1BS0 A;  1AKB A;  4XAU A;  5M46 A;  2Z9V A;  2PB0 A;  4K05 A;  2ZSL A;  2VYC A;  4IYO A;  4XJL A;  1WYV A;  2DOU A;  4UOY A;  3KGX A;  3UAK A;  1ELQ A;  3B1D A;  1CS1 A;  4AZK A;  2VMP A;  2W7F A;  3KKI A;  3QBO A;  1W23 A;  1YIY A;  1C7O A;  1LC8 A;  2CB1 A;  8AAT A;  1EJI A;  2AY1 A;  2VMZ A;  1QZ9 A;  1OXO A;  2DKB A;  1C9C A;  2JG2 A;  2VMR A;  2WK9 A;  4E3R A;  3TFT A;  3ZRP A;  2VGS A;  3BC8 A;  5D95 A;  3A9Y A;  3QM2 A;  3BWO A;  4JEV A;  1TPL A;  2WB6 A;  4GE4 A;  4TN4 A;  4JF0 A;  5HHY A;  5EFS A;  1DTY A;  1ELU A;  2HOZ A;  4WYE A;  1IX6 A;  1JF9 A;  1V2F A;  3PJ0 A;  3N75 A;  4JF1 A;  3FDB A;  4F5L A;  2F8J A;  2VLF A;  1MGV A;  2BIE A;  2EZ1 A;  5C6U A;  4PVF A;  2YCT A;  2QA3 A;  2O1B A;  4U2H A;  2OGE A;  4RIT A;  3AEJ A;  2OKJ A;  4WB0 B;  2PO3 A;  2Z1Z A;  3AEM C;  4IY7 A;  4RKD A;  3EI8 A;  1ECX A;  4OBU A;  1WYT A;  5G4J A;  2W8W A;  1XI9 A;  3P6K A;  1MAP A;  2X5F A;  3GZC A;  3ZRR A;  2D7Z A;  3FVU A;  1AY8 A;  4LNJ A;  1ASL A;  4ZM4 A;  3FQ7 A;  3W1I A;  3B46 A;  1MLY A;  1AAW A;  4WYD A;  3T32 A;  1LW5 A;  2CJH A;  4LW2 A;  2VIB A;  3HQT A;  5BJ4 A;  1AX4 A;  3QGU A;  5G2P A;  1B5O A;  1OHY A;  2VMX A;  1DFO A;  3I4J A;  4JEZ A;  4MSO A;  1CL2 A;  4P3M A;  1GC3 A;  3CQ4 A;  3TQX A;  1AY5 A;  1M6S A;  3USF A;  3G0T A;  1OHW A;  1TOI A;  5G4I A;  2YCN A;  1B9I A;  2YKU A;  1PG8 A;  4R5F A;  2HUF A;  5F8V A;  2VMO A;  4AH3 A;  3A8U X;  4OTL A;  5D5S A;  1S07 A;  2FNU A;  1Z3Z A;  2W7D A;  1DKA A;  5EIG A;  1TAS A;  1D7R A;  3JWB A;  2HP2 A;  4Q76 A;  1AMS A;  3EI6 A;  2FNI A;  1D7U A;  1S09 A;  3MAU A;  3IHJ A;  3DRD A;  1M0Q A;  1MAQ A;  2EH6 A;  1IVR A;  4A6T A;  1GEX A;  5E3K A;  1J04 A;  3EI5 A;  4GDY A;  4IX8 A;  2AAT A;  4CXR A;  3MEB A;  1LC7 A;  4GEB A;  1WST A;  4MKK A;  5EAA A;  4FL0 A;  3LG0 A;  3DR4 A;  5EAV A;  2D65 A;  4DQ6 A;  1LS3 A;  1AIB A;  4GSA A;  4WYA A;  5KTB A;  4HF8 A;  3GBX A;  3QPG A;  1QIT A;  2QB3 A;  1KKJ A;  2BI3 A;  5HXX A;  4A0H A;  1H0C A;  1ASC A;  3DC1 A;  3I16 A;  3WLX A;  3RCH B;  2W8V A;  2W8U A;  1ART A;  4R2N A;  1DJE A;  1SZU A;  1GCK A;  3DU4 A;  1AHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...