2FKIA

Nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
b'MTISELLQYCMAKPGAEQSVHNDWKATQIKVEDVLFAMVKEVENRPAVSLKTSPELAELLRQQHSDVRPSRHLNKAHWSTVYLDGSLPDSQIYYLVDASYQQAVNLLPEEKRKLLVQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein yjbR
publication title NMR structure of protein yjbR from Escherichia coli reveals 'double-wing' DNA binding motif.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2006-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04237 YjbR YjbR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1150.30 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2fkiA00
2FKIA 2A1VA 2KFPA 3H9XA
chains in the Genus database with same CATH superfamily
4BA4A 2VGUA 2R0TA 4F5GA 3ASAA 3KKIA 4AH3A 3NRAA 1QJ5A 2D5YA 3AEJA 1CQ7A 1TOIA 3WCNA 4MKKA 2QLRA 1SZUA 3FDBA 3RBLA 1D7UA 1OHVA 1AHXA 1VJOA 1WYTB 1T3IA 3QM2A 3H7FA 4RKCA 3E2FA 3E2ZA 1WKHA 4IY7A 3IHJA 1J32A 2Z1ZA 3FCRA 1QISA 3MC6C 4KXKA 3AENB 3ELEA 2BIAA 2WB6A 4EB7A 2VMNA 3NYSA 5G4JA 4OMAA 5C6UA 1DKAA 3LV2A 4K05A 3N0LA 1G7WA 4PIWA 2VGTA 3PD6B 3RUYA 1O69A 2OKJA 3E6GA 3AENA 2CTZA 3ASBA 1MDZA 1QGNA 2EYQA 2VGWA 3JWBA 1ARTA 3VK3A 1LS3A 4E77A 1KAFA 1MLZA 4DGTA 1ZODA 1MAPA 3DR7A 4ZAHA 5E3KA 3PD6A 4Q6RA 4PVFA 2DGLA 1P3WA 5M46A 2YKXA 2JJHA 4RJ0A 5EUDA 2VMUA 3VAXA 4JF0A 3RQ1A 2JISA 4U2HA 3B1EA 2FM1A 5G09A 4ZASA 1DJEA 1ASMA 1AMAA 1IJIA 3T32A 1IX8A 1CL1A 1TARA 2AY6A 1W7LA 2CJDA 2FNIA 1N2TA 3R4TA 4WYFA 4N0WA 1N31A 2JGTA 1EJIA 2W8VA 1E5FA 3B46A 3GZDA 4LNJA 3PPLA 1TPLA 2VMZA 5DJ9A 4I8AA 1TOEA 3WGBA 5E4ZA 4F5KA 1WYVB 4L0OA 3MAUA 4IW7A 2JG2A 3DRDA 1FG7A 4Y0IA 3ZRRA 2ZY2A 4H63Q 1AHYA 2AEUA 3G0TA 2W8WA 4TMRA 5F8VA 4ZWVA 1ASBA 3DODA 3GBXA 3LY1A 1AHFA 1SZKA 3NUIA 4OBUA 2DR1A 3A8UX 4XJPA 2OKKA 1W7NA 3WKRA 1I43A 2CB1A 1DTYA 1LK9A 1SFFA 3AEJC 2D66A 4ISYA 4OCAA 2VMOA 3FVXA 4ADEA 2C81A 1V2EA 4ITGA 4WLHA 1IBJA 4A6RA 4MKJA 3P1TA 4Q76A 3JW9A 3N4RA 4UHOA 1BQAA 2AATA 1RVUA 2ZY4A 1LKCA 4KAMA 1DFOA 3UAKA 2VI8A 3DZZA 5IWQA 4LNMA 4GDYA 2W7FA 3NU7A 1PFFA 5JAYA 3TFTA 3LVMA 2ZSMA 2Z1YA 2D7YA 1OATA 1ORDA 4WXFA 3PJ0A 2AY4A 1M0OA 1TOGA 3OKSA 2QMAA 1ECXA 4UHMA 1D2FA 5D95A 1ASCA 3WY7A 3H9XA 3AV7A 2BIGA 3BWNA 5J8QA 3FFHA 1X28A 4AO4A 1E5EA 2GSAA 1O4SA 4A00A 4ADDA 2BWNA 2CJHA 1SVVA 3DXWA 3NYUA 3UWCA 1KMKA 4J8LA 2CANA 2VYCA 2BWOA 3QN6A 3QBOA 3FVSA 4A6TA 1Z7DA 2YKUA 2GB3A 2HUIA 4RIZA 2ZP7A 5M49A 2E54A 1I29A 3I16A 4W8IA 4WP0A 2DOUA 1I48A 2OGAA 4F5MA 1M0NA 2YKVA 3G7QA 2R5CB 4RJYA 1AJRA 4CBRA 2OQXA 3D6KA 3WZFA 1BW0A 1TOJA 3GZDC 2Z9UA 2VGVA 4NOGA 3A9XA 4M2MA 5I92A 3FQAA 4WB0B 2OATA 4U1TA 2R5CA 1AY8A 3BV0A 3FVUA 1S0AA 2CH2A 1WYUB 3HLMA 1GEXA 2X8UA 1G4XA 3QI6A 2YRIA 1UU0A 1BJWA 2QA3A 4FFCA 4CVQA 1KMJA 4F5FA 4WYDA 1ELUA 3F0HA 2HOYA 2ORDA 4A0FA 2WKAA 2WK9A 2GMUA 4WB0A 2F8JA 3WCOA 5K8BA 4ZDPA 3LWSA 1B9IA 3NX3A 3ATHA 1WYUA 1C9CA 4R8DA 3TCMA 2BYJA 2VMTA 4P3MA 1ARSA 1G7XA 1W7MA 2CSTA 3W1HA 3AEMA 4JF1A 1ZC9A 4LNLA 1GC0A 2JJFA 1AIBA 3PAAA 4A6UA 1VP4A 1IVRA 3FZ7A 4JEXA 4JEYA 3A2BA 2W7EA 4IXZA 4ATQA 3B1CA 2AY5A 2G7JA 4BA5A 1BQDA 4F4EA 8AATA 1WYTA 2PB0A 2AY7A 2YCNA 1GC4A 3DC1A 1DGEA 3I4JA 5DJ1A 2NMPA 4WYCA 1IUGA 3F6TA 3A9ZA 3OP7A 4XJOA 2Z9VA 3COGA 5EAAA 5EFSA 4CXRA 4EMYA 3CBFA 1YJYA 2E7UA 2ZUKA 3M5UA 4HF8A 1D7VA 4MY5A 4UHNA 2AY9A 4Q31A 4ADBA 2VI9A 4F5LA 1BKGA 3BWNC 1O61A 1C0NA 1WKGA 4AO9A 3G8MA 4JEWA 4IXSA 4ATPA 2CH1A 2HUUA 2X5DA 3II0A 3E77A 1AMSA 1B8GA 1YNUA 3NNKA 1PMOA 2A1VA 1AICA 3ZRQA 2X5FA 3TQXA 1RVYA 1XEYA 2VLHA 1UKJA 1XI9A 2BI5A 3ZZKA 4W91A 3ZZJA 5AX8A 2WK7A 1H1CA 4AOAA 2VGSA 4GE9A 4ZDLA 9AATA 5G0AA 3HDOA 2FKIA 2HUFA 4LW2A 2DKJA 4GSAA 1O62A 4IX8A 1YIZA 3EI5A 4BMKA 1LC5A 3PDBB 4PFFA 1GEWA 4GRXA 5FT4A 4EB5A 3FFRA 1WYVA 1S07A 4MQPA 3WKSA 2BKWA 3EI8A 3NYTA 2YCPA 2PO3A 4F5HA 5EUNA 3PDBA 2VMVA 3DYDA 3VOMA 1BS0A 2YHKA 5G2PA 1TATA 2ZC0A 2RFVA 2FNUA 1YOOA 1M0PA 2ZY3A 3ACZA 3HMUA 1MDOA 1MGVA 4MSOA 1M32A 7AATA 3AEMC 2EZ1A 1AY5A 1KL2A 2D61A 2AY2A 2JJGA 4H51A 2D7ZA 2EO5A 4RKDA 1C7OA 1DGDA 2C44A 3GWPA 5EUEA 1CZEA 5E5IA 1GC2A 2BWPA 1PG8A 2VLFA 1C4KA 1JS6A 4JEVA 4EFFA 2EGYA 3LVJA 1S08A 5FT5A 1LW4A 3GZCA 4A72A 3N7NA 4LC3A 2CY8A 2O0RA 1VEFA 3CQ6A 3ECDA 5G2QA 4XQ2A 2Z61A 4WYEA 1GEYA 1BJ4A 1UU2A 4E3RA 2VMXA 2ZJGA 3BC8A 4W1WA 1AY4A 1ASGA 2W8TA 3MBBA 1GBNA 2GMSA 4WLJA 2VMPA 4XJMA 5TF5A 2HZPA 4XAUA 2R2NA 3L44A 5HHYA 1GD9A 1OXPA 2VGZA 4E1OA 3CQ4A 3FRKA 4O6ZA 2VIBA 1RV3A 1CZCA 3LVLB 1AIAA 2HP1A 3DXVA 4F5IA 3GSBA 4K2BA 4A0HA 1X0MA 1KKJA 3FQ8A 3MAFB 4M2JA 4P7YA 4EU1A 1MDXA 3PIUA 1M4NA 1V2FA 1AAMA 3AOWA 1CQ8A 2YKYA 3MADA 3WGCA 5F9SA 4IXOA 1MLYA 1JS3A 3FD0A 1QIRA 3BWOA 3RBFA 3MAFA 1SF2A 1GCKA 3F9TA 2BI1A 2YOBA 3N75A 2VIAA 3FKDA 1ASFA 1Z3ZA 5FT8A 3BCXA 4ZLVA 2R5EA 1QJ3A 4M2KA 2DKBA 4J5UA 1V72A 3NTJA 3GJUA 2W8JA 1YIYA 1B9HA 1QITA 3UE8A 2G6WA 4BQ0A 1ZOBA 2W7KA 3I5TA 1U08A 1I41A 4UQVA 3WLXA 3PA9A 4K2MA 2TPLA 2Z9WA 1AJSB 1D7SA 2BHXA 4OTLA 4WD2A 2AY3A 4OBVA 1ELQA 1AHGA 5G4IA 2FYFA 1EG5A 3EI7A 4GE4A 2ZSLA 4K2IA 1IAXA 3E2ZB 3EZ1A 1TOKA 2EPJA 5M4BA 2EH6A 3KGXA 3DR4A 3BS8A 2AY1A 1AJSA 3QGUA 2O7CA 3BB8A 3BCAA 3MKJA 1IAYA 3NU8A 3FQ7A 4A0GA 4XEWA 2E7JA 2VMSA 3E2YA 2C0RA 4W5KA 3PDXA 1B4XA 2CINA 2XH1A 3NUBA 3FSLA 3QPGA 2BI9A 5HDMA 1S06A 1ASLA 3AOVA 3N4SA 1AMQA 2QB2A 4PFNA 3FZ6A 4AZKA 4MQQA 1AKCA 1AHEA 2Q7WA 2V0YA 4ZM4A 4QGRA 3W1IA 3EI6A 1GC3A 4F5JA 4LW4A 1DJUA 3WX9A 1S09A 1AAWA 2ZYJA 3AATA 4RAEA 3DU4A 5FT6A 3VK2A 4GE7A 3HT4A 3N5MA 2AEVA 1M7YA 1CS1A 2QBTA 4ZWMA 4XK1A 2XBNA 3JZLA 3RCHB 3EZSA 3A9YA 4R5FA 3RI6A 2W7JA 5KTBA 1B5PA 4W1VA 1ARHA 4RLGA 3K40A 3K7YA 1QZ9A 1G4VA 3USFA 1SZSA 1BJOB 2W8UA 4JEZA 3RCHA 3CQ5A 3MEBA 1PMMA 2HP2A 3B8XA 2W7LA 2ZY5A 3E9KA 1JG8A 2Z9XA 1DJ9A 4R2NA 4XJLA 1AKAA 3FZ8A 5BJ3A 3GETA 3BN1A 1D7RA 2VMYA 2GQNA 3KGWA 1BJOA 1GDEA 4B98A 1OHYA 3HBXA 1RV4A 4W1XA 1KKPA 1SPAA 1TASA 2Z20A 5HXXA 1ARIA 1H0CA 3KE3A 4WXGA 2QB3A 2D65A 4E3QA 3FDDA 2DGMA 3TFUA 2C7TA 2D63A 2E7IA 4OYTA 4RITA 4AZJA 5EQCA 4A0RA 2AY8A 2W7MA 1EQBA 1CJ0A 3Q8NA 4OT8A 4RM1A 1C7GA 2W7DA 2YCTA 2CFBA 3NDNA 3P6KA 4CXQA 2YRRA 5DB5A 4BHDA 1ASEA 1FG3A 4IYOB 5EIGB 3QHXA 3JTXA 3LVKA 3PGYA 1CQ6A 2V1PA 1OHWA 3LG0A 1AX4A 2W7GA 3EIBA 3L8AA 4Q75A 4ZSWA 3GR9A 2VMRA 2BI2A 5DX5A 1ASDA 3MC6A 1X2AA 3FTBA 1YJSA 2DGKA 3AELA 4R5ZA 1JF9A 1CL2A 2CJGA 4Y0HA 4IYOA 5EIGA 1IX6A 3BCBA 3EI9A 4Y0DA 3CAIA 2QSRA 1ASAA 2FQ6A 4WBTA 3AEOA 3EUCA 4DQ6A 1FC4A 4ZM3A 3R9AA 1KL1A 1YAAA 2BIEA 2WK8A 5D5SA 1N8PA 5EAVA 1B5OA 1W23A 3JWAA 4ZSYA 3VK4A 4ADCA 4CBSA 3N4XA 4WYGA 4FL0A 5M4DA 1C7NA 2PB2A 1LC8A 3EIAA 2BI3A 1IX7A 2OGEA 4GEBA 2HOZA 4DBCA 1UU1A 4ZDOA 4KYOA 1M6SA 2VMQA 4HVKA 1LW5A 2KFPA 1AMRA 1BJNA 2O1BA 4B9BA 1BT4A 1V2DA 3TATA 1Y4IA 1WSTA 2HOXA 4OC9A 1M0QA 2BYLA 1J04A 1OXOA 2VMWA 3AEPA 3ELPA 2W7IA 2D64A 2X3LA 3HL2A 3K28A 1AKBA 3VP6A 3ZRPA 3HVYA 2W7HA 4MQRA 3HQTA 4WXBA 1W3UA 2HORA 2FN6A 3ISLA 1LC7A 1MAQA 1YJZA 3B1DA 5BJ4A 4TN4A 1X29A 3W1JA 1ARGA 4ITXA 1ASNA 4UOYA 4WYAA 2JJEA 2EZ2A
chains in the Genus database with same CATH topology
4BA4A 2VGUA 2R0TA 4F5GA 3ASAA 3KKIA 4AH3A 3NRAA 1QJ5A 2D5YA 3AEJA 1CQ7A 1TOIA 3WCNA 4MKKA 2QLRA 1SZUA 3FDBA 3RBLA 1D7UA 1OHVA 1AHXA 1VJOA 1WYTB 1T3IA 3QM2A 3H7FA 4RKCA 3E2FA 3E2ZA 1WKHA 4IY7A 3IHJA 1J32A 2Z1ZA 3FCRA 1QISA 3MC6C 4KXKA 3AENB 3ELEA 2BIAA 2WB6A 4EB7A 2VMNA 3NYSA 5G4JA 4OMAA 5C6UA 1DKAA 3LV2A 4K05A 3N0LA 1G7WA 4PIWA 2VGTA 3PD6B 3RUYA 1O69A 2OKJA 3E6GA 3AENA 2CTZA 3ASBA 1MDZA 1QGNA 2EYQA 2VGWA 3JWBA 1ARTA 3VK3A 1LS3A 4E77A 1MLZA 4DGTA 1ZODA 1MAPA 3DR7A 4ZAHA 5E3KA 3PD6A 4Q6RA 4PVFA 2DGLA 1P3WA 5M46A 2YKXA 2JJHA 4RJ0A 5EUDA 2VMUA 3VAXA 4JF0A 3RQ1A 2JISA 4U2HA 3B1EA 2FM1A 5G09A 4ZASA 1DJEA 1ASMA 1AMAA 1IJIA 3T32A 1IX8A 1CL1A 1TARA 2AY6A 1W7LA 2CJDA 2FNIA 1N2TA 3R4TA 4WYFA 4N0WA 1N31A 2JGTA 1EJIA 2W8VA 1E5FA 3B46A 3GZDA 4LNJA 3PPLA 1TPLA 2VMZA 5DJ9A 4I8AA 1TOEA 3WGBA 5E4ZA 4F5KA 1WYVB 4L0OA 3MAUA 4IW7A 2JG2A 3DRDA 1FG7A 4Y0IA 3ZRRA 2ZY2A 4H63Q 1AHYA 2AEUA 3G0TA 2W8WA 4TMRA 5F8VA 4ZWVA 1ASBA 3DODA 3GBXA 3LY1A 1AHFA 1SZKA 3NUIA 4OBUA 2DR1A 3A8UX 4XJPA 2OKKA 1W7NA 3WKRA 1I43A 2CB1A 1DTYA 1LK9A 1SFFA 3AEJC 2D66A 4ISYA 4OCAA 2VMOA 3FVXA 4ADEA 2C81A 1V2EA 4ITGA 4WLHA 1IBJA 4A6RA 4MKJA 3P1TA 4Q76A 3JW9A 3N4RA 4UHOA 1BQAA 2AATA 1RVUA 2ZY4A 1LKCA 4KAMA 1DFOA 3UAKA 2VI8A 3DZZA 5IWQA 4LNMA 4GDYA 2W7FA 3NU7A 1PFFA 5JAYA 3TFTA 3LVMA 2ZSMA 2Z1YA 2D7YA 1OATA 1ORDA 4WXFA 3PJ0A 2AY4A 1M0OA 1TOGA 3OKSA 2QMAA 1ECXA 4UHMA 1D2FA 5D95A 1ASCA 3WY7A 3H9XA 3AV7A 2BIGA 3BWNA 5J8QA 3FFHA 1X28A 4AO4A 1E5EA 2GSAA 1O4SA 4A00A 4ADDA 2BWNA 2CJHA 1SVVA 3DXWA 3NYUA 3UWCA 1KMKA 4J8LA 2CANA 2VYCA 2BWOA 3QN6A 3QBOA 3FVSA 4A6TA 1Z7DA 2YKUA 2GB3A 2HUIA 4RIZA 2ZP7A 5M49A 2E54A 1I29A 3I16A 4W8IA 4WP0A 2DOUA 1I48A 2OGAA 4F5MA 1M0NA 2YKVA 3G7QA 2R5CB 4RJYA 1AJRA 4CBRA 2OQXA 3D6KA 3WZFA 1BW0A 1TOJA 3GZDC 2Z9UA 2VGVA 4NOGA 3A9XA 4M2MA 5I92A 3FQAA 4WB0B 2OATA 4U1TA 2R5CA 1AY8A 3BV0A 3FVUA 1S0AA 2CH2A 1WYUB 3HLMA 1GEXA 2X8UA 1G4XA 3QI6A 2YRIA 1UU0A 1BJWA 2QA3A 4FFCA 4CVQA 1KMJA 4F5FA 4WYDA 1ELUA 3F0HA 2HOYA 2ORDA 4A0FA 2WKAA 2WK9A 2GMUA 4WB0A 2F8JA 3WCOA 5K8BA 4ZDPA 3LWSA 1B9IA 3NX3A 3ATHA 1WYUA 1C9CA 4R8DA 3TCMA 2BYJA 2VMTA 4P3MA 1ARSA 1G7XA 1W7MA 2CSTA 3W1HA 3AEMA 4JF1A 1ZC9A 4LNLA 1GC0A 2JJFA 1AIBA 3PAAA 4A6UA 1VP4A 1IVRA 3FZ7A 4JEXA 4JEYA 3A2BA 2W7EA 4IXZA 4ATQA 3B1CA 2AY5A 2G7JA 4BA5A 1BQDA 4F4EA 8AATA 1WYTA 2PB0A 2AY7A 2YCNA 1GC4A 3DC1A 1DGEA 3I4JA 5DJ1A 2NMPA 4WYCA 1IUGA 3F6TA 3A9ZA 3OP7A 4XJOA 2Z9VA 3COGA 5EAAA 5EFSA 4CXRA 4EMYA 3CBFA 1YJYA 2E7UA 2ZUKA 3M5UA 4HF8A 1D7VA 4MY5A 4UHNA 2AY9A 4Q31A 4ADBA 2VI9A 4F5LA 1BKGA 3BWNC 1O61A 1C0NA 1WKGA 4AO9A 3G8MA 4JEWA 4IXSA 4ATPA 2CH1A 2HUUA 2X5DA 3II0A 3E77A 1AMSA 1B8GA 1YNUA 3NNKA 1PMOA 2A1VA 1AICA 3ZRQA 2X5FA 3TQXA 1RVYA 1XEYA 2VLHA 1UKJA 1XI9A 2BI5A 3ZZKA 4W91A 3ZZJA 5AX8A 2WK7A 1H1CA 4AOAA 2VGSA 4GE9A 4ZDLA 9AATA 5G0AA 3HDOA 2FKIA 2HUFA 4LW2A 2DKJA 4GSAA 1O62A 4IX8A 1YIZA 3EI5A 4BMKA 1LC5A 3PDBB 4PFFA 1GEWA 4GRXA 5FT4A 4EB5A 3FFRA 1WYVA 1S07A 4MQPA 3WKSA 2BKWA 3EI8A 3NYTA 2YCPA 2PO3A 4F5HA 5EUNA 3PDBA 2VMVA 3DYDA 3VOMA 1BS0A 2YHKA 5G2PA 1TATA 2ZC0A 2RFVA 2FNUA 1YOOA 1M0PA 2ZY3A 3ACZA 3HMUA 1MDOA 1MGVA 4MSOA 1M32A 7AATA 3AEMC 2EZ1A 1AY5A 1KL2A 2D61A 2AY2A 2JJGA 4H51A 2D7ZA 2EO5A 4RKDA 1C7OA 1DGDA 2C44A 3GWPA 5EUEA 1CZEA 5E5IA 1GC2A 2BWPA 1PG8A 2VLFA 1C4KA 1JS6A 4JEVA 4EFFA 2EGYA 3LVJA 1S08A 5FT5A 1LW4A 3GZCA 4A72A 3N7NA 4LC3A 2CY8A 2O0RA 1VEFA 3CQ6A 3ECDA 5G2QA 4XQ2A 2Z61A 4WYEA 1GEYA 1BJ4A 1UU2A 4E3RA 2VMXA 2ZJGA 3BC8A 4W1WA 1AY4A 1ASGA 2W8TA 3MBBA 1GBNA 2GMSA 4WLJA 2VMPA 4XJMA 5TF5A 2HZPA 4XAUA 2R2NA 3L44A 5HHYA 1GD9A 1OXPA 2VGZA 4E1OA 3CQ4A 3FRKA 4O6ZA 2VIBA 1RV3A 1CZCA 3LVLB 1AIAA 2HP1A 3DXVA 4F5IA 3GSBA 4K2BA 4A0HA 1X0MA 1KKJA 3FQ8A 3MAFB 4M2JA 4P7YA 4EU1A 1MDXA 3PIUA 1M4NA 1V2FA 1AAMA 3AOWA 1CQ8A 2YKYA 3MADA 3WGCA 5F9SA 4IXOA 1MLYA 1JS3A 3FD0A 1QIRA 3BWOA 3RBFA 3MAFA 1SF2A 1GCKA 3F9TA 2BI1A 2YOBA 3N75A 2VIAA 3FKDA 1ASFA 1Z3ZA 5FT8A 3BCXA 4ZLVA 2R5EA 1QJ3A 4M2KA 2DKBA 4J5UA 1V72A 3NTJA 3GJUA 2W8JA 1YIYA 1B9HA 1QITA 3UE8A 2G6WA 4BQ0A 1ZOBA 2W7KA 3I5TA 1U08A 1I41A 4UQVA 3WLXA 3PA9A 4K2MA 2TPLA 2Z9WA 1AJSB 1D7SA 2BHXA 4OTLA 4WD2A 2AY3A 4OBVA 1ELQA 1AHGA 5G4IA 2FYFA 1EG5A 3EI7A 4GE4A 2ZSLA 4K2IA 1IAXA 3E2ZB 3EZ1A 1TOKA 2EPJA 5M4BA 2EH6A 3KGXA 3DR4A 3BS8A 2AY1A 1AJSA 3QGUA 2O7CA 3BB8A 3BCAA 3MKJA 1IAYA 3NU8A 3FQ7A 4A0GA 4XEWA 2E7JA 2VMSA 3E2YA 2C0RA 4W5KA 3PDXA 1B4XA 2CINA 2XH1A 3NUBA 3FSLA 3QPGA 2BI9A 5HDMA 1S06A 1ASLA 3AOVA 3N4SA 1AMQA 2QB2A 4PFNA 3FZ6A 4AZKA 4MQQA 1AKCA 1AHEA 2Q7WA 2V0YA 4ZM4A 4QGRA 3W1IA 3EI6A 1GC3A 4F5JA 4LW4A 1DJUA 3WX9A 1S09A 1AAWA 2ZYJA 3AATA 4RAEA 3DU4A 5FT6A 3VK2A 4GE7A 3HT4A 3N5MA 2AEVA 1M7YA 1CS1A 2QBTA 4ZWMA 4XK1A 2XBNA 3JZLA 3RCHB 3EZSA 3A9YA 4R5FA 3RI6A 2W7JA 5KTBA 1B5PA 4W1VA 1ARHA 4RLGA 3K40A 3K7YA 1QZ9A 1G4VA 3USFA 1SZSA 1BJOB 2W8UA 4JEZA 3RCHA 3CQ5A 3MEBA 1PMMA 2HP2A 3B8XA 2W7LA 2ZY5A 3E9KA 1JG8A 2Z9XA 1DJ9A 4R2NA 4XJLA 1AKAA 3FZ8A 5BJ3A 3GETA 3BN1A 1D7RA 2VMYA 2GQNA 3KGWA 1BJOA 1GDEA 4B98A 1OHYA 3HBXA 1RV4A 4W1XA 1KKPA 1SPAA 1TASA 2Z20A 5HXXA 1ARIA 1H0CA 3KE3A 4WXGA 2QB3A 2D65A 4E3QA 3FDDA 2DGMA 3TFUA 2C7TA 2D63A 2E7IA 4OYTA 4RITA 4AZJA 5EQCA 4A0RA 2AY8A 2W7MA 1EQBA 1CJ0A 3Q8NA 4OT8A 4RM1A 1C7GA 2W7DA 2YCTA 2CFBA 3NDNA 3P6KA 4CXQA 2YRRA 5DB5A 4BHDA 1ASEA 1FG3A 4IYOB 5EIGB 3QHXA 3JTXA 3LVKA 3PGYA 1CQ6A 2V1PA 1OHWA 3LG0A 1AX4A 2W7GA 3EIBA 3L8AA 4Q75A 4ZSWA 3GR9A 2VMRA 2BI2A 5DX5A 1ASDA 3MC6A 1X2AA 3FTBA 1YJSA 2DGKA 3AELA 4R5ZA 1JF9A 1CL2A 2CJGA 4Y0HA 4IYOA 5EIGA 1IX6A 3BCBA 3EI9A 4Y0DA 3CAIA 2QSRA 1ASAA 2FQ6A 4WBTA 3AEOA 3EUCA 4DQ6A 1FC4A 4ZM3A 3R9AA 1KL1A 1YAAA 2BIEA 2WK8A 5D5SA 1N8PA 5EAVA 1B5OA 1W23A 3JWAA 4ZSYA 3VK4A 4ADCA 4CBSA 3N4XA 4WYGA 4FL0A 5M4DA 1C7NA 2PB2A 1LC8A 3EIAA 2BI3A 1IX7A 2OGEA 4GEBA 2HOZA 4DBCA 1UU1A 4ZDOA 4KYOA 1M6SA 2VMQA 4HVKA 1LW5A 2KFPA 1AMRA 1BJNA 2O1BA 4B9BA 1BT4A 1V2DA 3TATA 1Y4IA 1WSTA 2HOXA 4OC9A 1M0QA 2BYLA 1J04A 1OXOA 2VMWA 3AEPA 3ELPA 2W7IA 2D64A 2X3LA 3HL2A 3K28A 1AKBA 3VP6A 3ZRPA 3HVYA 2W7HA 4MQRA 3HQTA 4WXBA 1W3UA 2HORA 2FN6A 3ISLA 1LC7A 1MAQA 1YJZA 3B1DA 5BJ4A 4TN4A 1X29A 3W1JA 1ARGA 4ITXA 1ASNA 4UOYA 4WYAA 2JJEA 2EZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKI A;  2A1V A;  2KFP A;  3H9X A; 
#chains in the Genus database with same CATH topology
 4BA4 A;  2VGU A;  2R0T A;  4F5G A;  3ASA A;  3KKI A;  4AH3 A;  3NRA A;  1QJ5 A;  2D5Y A;  3AEJ A;  1CQ7 A;  1TOI A;  3WCN A;  4MKK A;  2QLR A;  1SZU A;  3FDB A;  3RBL A;  1D7U A;  1OHV A;  1AHX A;  1VJO A;  1WYT B;  1T3I A;  3QM2 A;  3H7F A;  4RKC A;  3E2F A;  3E2Z A;  1WKH A;  4IY7 A;  3IHJ A;  1J32 A;  2Z1Z A;  3FCR A;  1QIS A;  3MC6 C;  4KXK A;  3AEN B;  3ELE A;  2BIA A;  2WB6 A;  4EB7 A;  2VMN A;  3NYS A;  5G4J A;  4OMA A;  5C6U A;  1DKA A;  3LV2 A;  4K05 A;  3N0L A;  1G7W A;  4PIW A;  2VGT A;  3PD6 B;  3RUY A;  1O69 A;  2OKJ A;  3E6G A;  3AEN A;  2CTZ A;  3ASB A;  1MDZ A;  1QGN A;  2EYQ A;  2VGW A;  3JWB A;  1ART A;  3VK3 A;  1LS3 A;  4E77 A;  1KAF A;  1MLZ A;  4DGT A;  1ZOD A;  1MAP A;  3DR7 A;  4ZAH A;  5E3K A;  3PD6 A;  4Q6R A;  4PVF A;  2DGL A;  1P3W A;  5M46 A;  2YKX A;  2JJH A;  4RJ0 A;  5EUD A;  2VMU A;  3VAX A;  4JF0 A;  3RQ1 A;  2JIS A;  4U2H A;  3B1E A;  2FM1 A;  5G09 A;  4ZAS A;  1DJE A;  1ASM A;  1AMA A;  1IJI A;  3T32 A;  1IX8 A;  1CL1 A;  1TAR A;  2AY6 A;  1W7L A;  2CJD A;  2FNI A;  1N2T A;  3R4T A;  4WYF A;  4N0W A;  1N31 A;  2JGT A;  1EJI A;  2W8V A;  1E5F A;  3B46 A;  3GZD A;  4LNJ A;  3PPL A;  1TPL A;  2VMZ A;  5DJ9 A;  4I8A A;  1TOE A;  3WGB A;  5E4Z A;  4F5K A;  1WYV B;  4L0O A;  3MAU A;  4IW7 A;  2JG2 A;  3DRD A;  1FG7 A;  4Y0I A;  3ZRR A;  2ZY2 A;  4H63 Q;  1AHY A;  2AEU A;  3G0T A;  2W8W A;  4TMR A;  5F8V A;  4ZWV A;  1ASB A;  3DOD A;  3GBX A;  3LY1 A;  1AHF A;  1SZK A;  3NUI A;  4OBU A;  2DR1 A;  3A8U X;  4XJP A;  2OKK A;  1W7N A;  3WKR A;  1I43 A;  2CB1 A;  1DTY A;  1LK9 A;  1SFF A;  3AEJ C;  2D66 A;  4ISY A;  4OCA A;  2VMO A;  3FVX A;  4ADE A;  2C81 A;  1V2E A;  4ITG A;  4WLH A;  1IBJ A;  4A6R A;  4MKJ A;  3P1T A;  4Q76 A;  3JW9 A;  3N4R A;  4UHO A;  1BQA A;  2AAT A;  1RVU A;  2ZY4 A;  1LKC A;  4KAM A;  1DFO A;  3UAK A;  2VI8 A;  3DZZ A;  5IWQ A;  4LNM A;  4GDY A;  2W7F A;  3NU7 A;  1PFF A;  5JAY A;  3TFT A;  3LVM A;  2ZSM A;  2Z1Y A;  2D7Y A;  1OAT A;  1ORD A;  4WXF A;  3PJ0 A;  2AY4 A;  1M0O A;  1TOG A;  3OKS A;  2QMA A;  1ECX A;  4UHM A;  1D2F A;  5D95 A;  1ASC A;  3WY7 A;  3H9X A;  3AV7 A;  2BIG A;  3BWN A;  5J8Q A;  3FFH A;  1X28 A;  4AO4 A;  1E5E A;  2GSA A;  1O4S A;  4A00 A;  4ADD A;  2BWN A;  2CJH A;  1SVV A;  3DXW A;  3NYU A;  3UWC A;  1KMK A;  4J8L A;  2CAN A;  2VYC A;  2BWO A;  3QN6 A;  3QBO A;  3FVS A;  4A6T A;  1Z7D A;  2YKU A;  2GB3 A;  2HUI A;  4RIZ A;  2ZP7 A;  5M49 A;  2E54 A;  1I29 A;  3I16 A;  4W8I A;  4WP0 A;  2DOU A;  1I48 A;  2OGA A;  4F5M A;  1M0N A;  2YKV A;  3G7Q A;  2R5C B;  4RJY A;  1AJR A;  4CBR A;  2OQX A;  3D6K A;  3WZF A;  1BW0 A;  1TOJ A;  3GZD C;  2Z9U A;  2VGV A;  4NOG A;  3A9X A;  4M2M A;  5I92 A;  3FQA A;  4WB0 B;  2OAT A;  4U1T A;  2R5C A;  1AY8 A;  3BV0 A;  3FVU A;  1S0A A;  2CH2 A;  1WYU B;  3HLM A;  1GEX A;  2X8U A;  1G4X A;  3QI6 A;  2YRI A;  1UU0 A;  1BJW A;  2QA3 A;  4FFC A;  4CVQ A;  1KMJ A;  4F5F A;  4WYD A;  1ELU A;  3F0H A;  2HOY A;  2ORD A;  4A0F A;  2WKA A;  2WK9 A;  2GMU A;  4WB0 A;  2F8J A;  3WCO A;  5K8B A;  4ZDP A;  3LWS A;  1B9I A;  3NX3 A;  3ATH A;  1WYU A;  1C9C A;  4R8D A;  3TCM A;  2BYJ A;  2VMT A;  4P3M A;  1ARS A;  1G7X A;  1W7M A;  2CST A;  3W1H A;  3AEM A;  4JF1 A;  1ZC9 A;  4LNL A;  1GC0 A;  2JJF A;  1AIB A;  3PAA A;  4A6U A;  1VP4 A;  1IVR A;  3FZ7 A;  4JEX A;  4JEY A;  3A2B A;  2W7E A;  4IXZ A;  4ATQ A;  3B1C A;  2AY5 A;  2G7J A;  4BA5 A;  1BQD A;  4F4E A;  8AAT A;  1WYT A;  2PB0 A;  2AY7 A;  2YCN A;  1GC4 A;  3DC1 A;  1DGE A;  3I4J A;  5DJ1 A;  2NMP A;  4WYC A;  1IUG A;  3F6T A;  3A9Z A;  3OP7 A;  4XJO A;  2Z9V A;  3COG A;  5EAA A;  5EFS A;  4CXR A;  4EMY A;  3CBF A;  1YJY A;  2E7U A;  2ZUK A;  3M5U A;  4HF8 A;  1D7V A;  4MY5 A;  4UHN A;  2AY9 A;  4Q31 A;  4ADB A;  2VI9 A;  4F5L A;  1BKG A;  3BWN C;  1O61 A;  1C0N A;  1WKG A;  4AO9 A;  3G8M A;  4JEW A;  4IXS A;  4ATP A;  2CH1 A;  2HUU A;  2X5D A;  3II0 A;  3E77 A;  1AMS A;  1B8G A;  1YNU A;  3NNK A;  1PMO A;  2A1V A;  1AIC A;  3ZRQ A;  2X5F A;  3TQX A;  1RVY A;  1XEY A;  2VLH A;  1UKJ A;  1XI9 A;  2BI5 A;  3ZZK A;  4W91 A;  3ZZJ A;  5AX8 A;  2WK7 A;  1H1C A;  4AOA A;  2VGS A;  4GE9 A;  4ZDL A;  9AAT A;  5G0A A;  3HDO A;  2FKI A;  2HUF A;  4LW2 A;  2DKJ A;  4GSA A;  1O62 A;  4IX8 A;  1YIZ A;  3EI5 A;  4BMK A;  1LC5 A;  3PDB B;  4PFF A;  1GEW A;  4GRX A;  5FT4 A;  4EB5 A;  3FFR A;  1WYV A;  1S07 A;  4MQP A;  3WKS A;  2BKW A;  3EI8 A;  3NYT A;  2YCP A;  2PO3 A;  4F5H A;  5EUN A;  3PDB A;  2VMV A;  3DYD A;  3VOM A;  1BS0 A;  2YHK A;  5G2P A;  1TAT A;  2ZC0 A;  2RFV A;  2FNU A;  1YOO A;  1M0P A;  2ZY3 A;  3ACZ A;  3HMU A;  1MDO A;  1MGV A;  4MSO A;  1M32 A;  7AAT A;  3AEM C;  2EZ1 A;  1AY5 A;  1KL2 A;  2D61 A;  2AY2 A;  2JJG A;  4H51 A;  2D7Z A;  2EO5 A;  4RKD A;  1C7O A;  1DGD A;  2C44 A;  3GWP A;  5EUE A;  1CZE A;  5E5I A;  1GC2 A;  2BWP A;  1PG8 A;  2VLF A;  1C4K A;  1JS6 A;  4JEV A;  4EFF A;  2EGY A;  3LVJ A;  1S08 A;  5FT5 A;  1LW4 A;  3GZC A;  4A72 A;  3N7N A;  4LC3 A;  2CY8 A;  2O0R A;  1VEF A;  3CQ6 A;  3ECD A;  5G2Q A;  4XQ2 A;  2Z61 A;  4WYE A;  1GEY A;  1BJ4 A;  1UU2 A;  4E3R A;  2VMX A;  2ZJG A;  3BC8 A;  4W1W A;  1AY4 A;  1ASG A;  2W8T A;  3MBB A;  1GBN A;  2GMS A;  4WLJ A;  2VMP A;  4XJM A;  5TF5 A;  2HZP A;  4XAU A;  2R2N A;  3L44 A;  5HHY A;  1GD9 A;  1OXP A;  2VGZ A;  4E1O A;  3CQ4 A;  3FRK A;  4O6Z A;  2VIB A;  1RV3 A;  1CZC A;  3LVL B;  1AIA A;  2HP1 A;  3DXV A;  4F5I A;  3GSB A;  4K2B A;  4A0H A;  1X0M A;  1KKJ A;  3FQ8 A;  3MAF B;  4M2J A;  4P7Y A;  4EU1 A;  1MDX A;  3PIU A;  1M4N A;  1V2F A;  1AAM A;  3AOW A;  1CQ8 A;  2YKY A;  3MAD A;  3WGC A;  5F9S A;  4IXO A;  1MLY A;  1JS3 A;  3FD0 A;  1QIR A;  3BWO A;  3RBF A;  3MAF A;  1SF2 A;  1GCK A;  3F9T A;  2BI1 A;  2YOB A;  3N75 A;  2VIA A;  3FKD A;  1ASF A;  1Z3Z A;  5FT8 A;  3BCX A;  4ZLV A;  2R5E A;  1QJ3 A;  4M2K A;  2DKB A;  4J5U A;  1V72 A;  3NTJ A;  3GJU A;  2W8J A;  1YIY A;  1B9H A;  1QIT A;  3UE8 A;  2G6W A;  4BQ0 A;  1ZOB A;  2W7K A;  3I5T A;  1U08 A;  1I41 A;  4UQV A;  3WLX A;  3PA9 A;  4K2M A;  2TPL A;  2Z9W A;  1AJS B;  1D7S A;  2BHX A;  4OTL A;  4WD2 A;  2AY3 A;  4OBV A;  1ELQ A;  1AHG A;  5G4I A;  2FYF A;  1EG5 A;  3EI7 A;  4GE4 A;  2ZSL A;  4K2I A;  1IAX A;  3E2Z B;  3EZ1 A;  1TOK A;  2EPJ A;  5M4B A;  2EH6 A;  3KGX A;  3DR4 A;  3BS8 A;  2AY1 A;  1AJS A;  3QGU A;  2O7C A;  3BB8 A;  3BCA A;  3MKJ A;  1IAY A;  3NU8 A;  3FQ7 A;  4A0G A;  4XEW A;  2E7J A;  2VMS A;  3E2Y A;  2C0R A;  4W5K A;  3PDX A;  1B4X A;  2CIN A;  2XH1 A;  3NUB A;  3FSL A;  3QPG A;  2BI9 A;  5HDM A;  1S06 A;  1ASL A;  3AOV A;  3N4S A;  1AMQ A;  2QB2 A;  4PFN A;  3FZ6 A;  4AZK A;  4MQQ A;  1AKC A;  1AHE A;  2Q7W A;  2V0Y A;  4ZM4 A;  4QGR A;  3W1I A;  3EI6 A;  1GC3 A;  4F5J A;  4LW4 A;  1DJU A;  3WX9 A;  1S09 A;  1AAW A;  2ZYJ A;  3AAT A;  4RAE A;  3DU4 A;  5FT6 A;  3VK2 A;  4GE7 A;  3HT4 A;  3N5M A;  2AEV A;  1M7Y A;  1CS1 A;  2QBT A;  4ZWM A;  4XK1 A;  2XBN A;  3JZL A;  3RCH B;  3EZS A;  3A9Y A;  4R5F A;  3RI6 A;  2W7J A;  5KTB A;  1B5P A;  4W1V A;  1ARH A;  4RLG A;  3K40 A;  3K7Y A;  1QZ9 A;  1G4V A;  3USF A;  1SZS A;  1BJO B;  2W8U A;  4JEZ A;  3RCH A;  3CQ5 A;  3MEB A;  1PMM A;  2HP2 A;  3B8X A;  2W7L A;  2ZY5 A;  3E9K A;  1JG8 A;  2Z9X A;  1DJ9 A;  4R2N A;  4XJL A;  1AKA A;  3FZ8 A;  5BJ3 A;  3GET A;  3BN1 A;  1D7R A;  2VMY A;  2GQN A;  3KGW A;  1BJO A;  1GDE A;  4B98 A;  1OHY A;  3HBX A;  1RV4 A;  4W1X A;  1KKP A;  1SPA A;  1TAS A;  2Z20 A;  5HXX A;  1ARI A;  1H0C A;  3KE3 A;  4WXG A;  2QB3 A;  2D65 A;  4E3Q A;  3FDD A;  2DGM A;  3TFU A;  2C7T A;  2D63 A;  2E7I A;  4OYT A;  4RIT A;  4AZJ A;  5EQC A;  4A0R A;  2AY8 A;  2W7M A;  1EQB A;  1CJ0 A;  3Q8N A;  4OT8 A;  4RM1 A;  1C7G A;  2W7D A;  2YCT A;  2CFB A;  3NDN A;  3P6K A;  4CXQ A;  2YRR A;  5DB5 A;  4BHD A;  1ASE A;  1FG3 A;  4IYO B;  5EIG B;  3QHX A;  3JTX A;  3LVK A;  3PGY A;  1CQ6 A;  2V1P A;  1OHW A;  3LG0 A;  1AX4 A;  2W7G A;  3EIB A;  3L8A A;  4Q75 A;  4ZSW A;  3GR9 A;  2VMR A;  2BI2 A;  5DX5 A;  1ASD A;  3MC6 A;  1X2A A;  3FTB A;  1YJS A;  2DGK A;  3AEL A;  4R5Z A;  1JF9 A;  1CL2 A;  2CJG A;  4Y0H A;  4IYO A;  5EIG A;  1IX6 A;  3BCB A;  3EI9 A;  4Y0D A;  3CAI A;  2QSR A;  1ASA A;  2FQ6 A;  4WBT A;  3AEO A;  3EUC A;  4DQ6 A;  1FC4 A;  4ZM3 A;  3R9A A;  1KL1 A;  1YAA A;  2BIE A;  2WK8 A;  5D5S A;  1N8P A;  5EAV A;  1B5O A;  1W23 A;  3JWA A;  4ZSY A;  3VK4 A;  4ADC A;  4CBS A;  3N4X A;  4WYG A;  4FL0 A;  5M4D A;  1C7N A;  2PB2 A;  1LC8 A;  3EIA A;  2BI3 A;  1IX7 A;  2OGE A;  4GEB A;  2HOZ A;  4DBC A;  1UU1 A;  4ZDO A;  4KYO A;  1M6S A;  2VMQ A;  4HVK A;  1LW5 A;  2KFP A;  1AMR A;  1BJN A;  2O1B A;  4B9B A;  1BT4 A;  1V2D A;  3TAT A;  1Y4I A;  1WST A;  2HOX A;  4OC9 A;  1M0Q A;  2BYL A;  1J04 A;  1OXO A;  2VMW A;  3AEP A;  3ELP A;  2W7I A;  2D64 A;  2X3L A;  3HL2 A;  3K28 A;  1AKB A;  3VP6 A;  3ZRP A;  3HVY A;  2W7H A;  4MQR A;  3HQT A;  4WXB A;  1W3U A;  2HOR A;  2FN6 A;  3ISL A;  1LC7 A;  1MAQ A;  1YJZ A;  3B1D A;  5BJ4 A;  4TN4 A;  1X29 A;  3W1J A;  1ARG A;  4ITX A;  1ASN A;  4UOY A;  4WYA A;  2JJE A;  2EZ2 A; 
#chains in the Genus database with same CATH homology
 4BA4 A;  2VGU A;  2R0T A;  4F5G A;  3ASA A;  3KKI A;  4AH3 A;  3NRA A;  1QJ5 A;  2D5Y A;  3AEJ A;  1CQ7 A;  1TOI A;  3WCN A;  4MKK A;  2QLR A;  1SZU A;  3FDB A;  3RBL A;  1D7U A;  1OHV A;  1AHX A;  1VJO A;  1WYT B;  1T3I A;  3QM2 A;  3H7F A;  4RKC A;  3E2F A;  3E2Z A;  1WKH A;  4IY7 A;  3IHJ A;  1J32 A;  2Z1Z A;  3FCR A;  1QIS A;  3MC6 C;  4KXK A;  3AEN B;  3ELE A;  2BIA A;  2WB6 A;  4EB7 A;  2VMN A;  3NYS A;  5G4J A;  4OMA A;  5C6U A;  1DKA A;  3LV2 A;  4K05 A;  3N0L A;  1G7W A;  4PIW A;  2VGT A;  3PD6 B;  3RUY A;  1O69 A;  2OKJ A;  3E6G A;  3AEN A;  2CTZ A;  3ASB A;  1MDZ A;  1QGN A;  2EYQ A;  2VGW A;  3JWB A;  1ART A;  3VK3 A;  1LS3 A;  4E77 A;  1MLZ A;  4DGT A;  1ZOD A;  1MAP A;  3DR7 A;  4ZAH A;  5E3K A;  3PD6 A;  4Q6R A;  4PVF A;  2DGL A;  1P3W A;  5M46 A;  2YKX A;  2JJH A;  4RJ0 A;  5EUD A;  2VMU A;  3VAX A;  4JF0 A;  3RQ1 A;  2JIS A;  4U2H A;  3B1E A;  2FM1 A;  5G09 A;  4ZAS A;  1DJE A;  1ASM A;  1AMA A;  1IJI A;  3T32 A;  1IX8 A;  1CL1 A;  1TAR A;  2AY6 A;  1W7L A;  2CJD A;  2FNI A;  1N2T A;  3R4T A;  4WYF A;  4N0W A;  1N31 A;  2JGT A;  1EJI A;  2W8V A;  1E5F A;  3B46 A;  3GZD A;  4LNJ A;  3PPL A;  1TPL A;  2VMZ A;  5DJ9 A;  4I8A A;  1TOE A;  3WGB A;  5E4Z A;  4F5K A;  1WYV B;  4L0O A;  3MAU A;  4IW7 A;  2JG2 A;  3DRD A;  1FG7 A;  4Y0I A;  3ZRR A;  2ZY2 A;  4H63 Q;  1AHY A;  2AEU A;  3G0T A;  2W8W A;  4TMR A;  5F8V A;  4ZWV A;  1ASB A;  3DOD A;  3GBX A;  3LY1 A;  1AHF A;  1SZK A;  3NUI A;  4OBU A;  2DR1 A;  3A8U X;  4XJP A;  2OKK A;  1W7N A;  3WKR A;  1I43 A;  2CB1 A;  1DTY A;  1LK9 A;  1SFF A;  3AEJ C;  2D66 A;  4ISY A;  4OCA A;  2VMO A;  3FVX A;  4ADE A;  2C81 A;  1V2E A;  4ITG A;  4WLH A;  1IBJ A;  4A6R A;  4MKJ A;  3P1T A;  4Q76 A;  3JW9 A;  3N4R A;  4UHO A;  1BQA A;  2AAT A;  1RVU A;  2ZY4 A;  1LKC A;  4KAM A;  1DFO A;  3UAK A;  2VI8 A;  3DZZ A;  5IWQ A;  4LNM A;  4GDY A;  2W7F A;  3NU7 A;  1PFF A;  5JAY A;  3TFT A;  3LVM A;  2ZSM A;  2Z1Y A;  2D7Y A;  1OAT A;  1ORD A;  4WXF A;  3PJ0 A;  2AY4 A;  1M0O A;  1TOG A;  3OKS A;  2QMA A;  1ECX A;  4UHM A;  1D2F A;  5D95 A;  1ASC A;  3WY7 A;  3H9X A;  3AV7 A;  2BIG A;  3BWN A;  5J8Q A;  3FFH A;  1X28 A;  4AO4 A;  1E5E A;  2GSA A;  1O4S A;  4A00 A;  4ADD A;  2BWN A;  2CJH A;  1SVV A;  3DXW A;  3NYU A;  3UWC A;  1KMK A;  4J8L A;  2CAN A;  2VYC A;  2BWO A;  3QN6 A;  3QBO A;  3FVS A;  4A6T A;  1Z7D A;  2YKU A;  2GB3 A;  2HUI A;  4RIZ A;  2ZP7 A;  5M49 A;  2E54 A;  1I29 A;  3I16 A;  4W8I A;  4WP0 A;  2DOU A;  1I48 A;  2OGA A;  4F5M A;  1M0N A;  2YKV A;  3G7Q A;  2R5C B;  4RJY A;  1AJR A;  4CBR A;  2OQX A;  3D6K A;  3WZF A;  1BW0 A;  1TOJ A;  3GZD C;  2Z9U A;  2VGV A;  4NOG A;  3A9X A;  4M2M A;  5I92 A;  3FQA A;  4WB0 B;  2OAT A;  4U1T A;  2R5C A;  1AY8 A;  3BV0 A;  3FVU A;  1S0A A;  2CH2 A;  1WYU B;  3HLM A;  1GEX A;  2X8U A;  1G4X A;  3QI6 A;  2YRI A;  1UU0 A;  1BJW A;  2QA3 A;  4FFC A;  4CVQ A;  1KMJ A;  4F5F A;  4WYD A;  1ELU A;  3F0H A;  2HOY A;  2ORD A;  4A0F A;  2WKA A;  2WK9 A;  2GMU A;  4WB0 A;  2F8J A;  3WCO A;  5K8B A;  4ZDP A;  3LWS A;  1B9I A;  3NX3 A;  3ATH A;  1WYU A;  1C9C A;  4R8D A;  3TCM A;  2BYJ A;  2VMT A;  4P3M A;  1ARS A;  1G7X A;  1W7M A;  2CST A;  3W1H A;  3AEM A;  4JF1 A;  1ZC9 A;  4LNL A;  1GC0 A;  2JJF A;  1AIB A;  3PAA A;  4A6U A;  1VP4 A;  1IVR A;  3FZ7 A;  4JEX A;  4JEY A;  3A2B A;  2W7E A;  4IXZ A;  4ATQ A;  3B1C A;  2AY5 A;  2G7J A;  4BA5 A;  1BQD A;  4F4E A;  8AAT A;  1WYT A;  2PB0 A;  2AY7 A;  2YCN A;  1GC4 A;  3DC1 A;  1DGE A;  3I4J A;  5DJ1 A;  2NMP A;  4WYC A;  1IUG A;  3F6T A;  3A9Z A;  3OP7 A;  4XJO A;  2Z9V A;  3COG A;  5EAA A;  5EFS A;  4CXR A;  4EMY A;  3CBF A;  1YJY A;  2E7U A;  2ZUK A;  3M5U A;  4HF8 A;  1D7V A;  4MY5 A;  4UHN A;  2AY9 A;  4Q31 A;  4ADB A;  2VI9 A;  4F5L A;  1BKG A;  3BWN C;  1O61 A;  1C0N A;  1WKG A;  4AO9 A;  3G8M A;  4JEW A;  4IXS A;  4ATP A;  2CH1 A;  2HUU A;  2X5D A;  3II0 A;  3E77 A;  1AMS A;  1B8G A;  1YNU A;  3NNK A;  1PMO A;  2A1V A;  1AIC A;  3ZRQ A;  2X5F A;  3TQX A;  1RVY A;  1XEY A;  2VLH A;  1UKJ A;  1XI9 A;  2BI5 A;  3ZZK A;  4W91 A;  3ZZJ A;  5AX8 A;  2WK7 A;  1H1C A;  4AOA A;  2VGS A;  4GE9 A;  4ZDL A;  9AAT A;  5G0A A;  3HDO A;  2FKI A;  2HUF A;  4LW2 A;  2DKJ A;  4GSA A;  1O62 A;  4IX8 A;  1YIZ A;  3EI5 A;  4BMK A;  1LC5 A;  3PDB B;  4PFF A;  1GEW A;  4GRX A;  5FT4 A;  4EB5 A;  3FFR A;  1WYV A;  1S07 A;  4MQP A;  3WKS A;  2BKW A;  3EI8 A;  3NYT A;  2YCP A;  2PO3 A;  4F5H A;  5EUN A;  3PDB A;  2VMV A;  3DYD A;  3VOM A;  1BS0 A;  2YHK A;  5G2P A;  1TAT A;  2ZC0 A;  2RFV A;  2FNU A;  1YOO A;  1M0P A;  2ZY3 A;  3ACZ A;  3HMU A;  1MDO A;  1MGV A;  4MSO A;  1M32 A;  7AAT A;  3AEM C;  2EZ1 A;  1AY5 A;  1KL2 A;  2D61 A;  2AY2 A;  2JJG A;  4H51 A;  2D7Z A;  2EO5 A;  4RKD A;  1C7O A;  1DGD A;  2C44 A;  3GWP A;  5EUE A;  1CZE A;  5E5I A;  1GC2 A;  2BWP A;  1PG8 A;  2VLF A;  1C4K A;  1JS6 A;  4JEV A;  4EFF A;  2EGY A;  3LVJ A;  1S08 A;  5FT5 A;  1LW4 A;  3GZC A;  4A72 A;  3N7N A;  4LC3 A;  2CY8 A;  2O0R A;  1VEF A;  3CQ6 A;  3ECD A;  5G2Q A;  4XQ2 A;  2Z61 A;  4WYE A;  1GEY A;  1BJ4 A;  1UU2 A;  4E3R A;  2VMX A;  2ZJG A;  3BC8 A;  4W1W A;  1AY4 A;  1ASG A;  2W8T A;  3MBB A;  1GBN A;  2GMS A;  4WLJ A;  2VMP A;  4XJM A;  5TF5 A;  2HZP A;  4XAU A;  2R2N A;  3L44 A;  5HHY A;  1GD9 A;  1OXP A;  2VGZ A;  4E1O A;  3CQ4 A;  3FRK A;  4O6Z A;  2VIB A;  1RV3 A;  1CZC A;  3LVL B;  1AIA A;  2HP1 A;  3DXV A;  4F5I A;  3GSB A;  4K2B A;  4A0H A;  1X0M A;  1KKJ A;  3FQ8 A;  3MAF B;  4M2J A;  4P7Y A;  4EU1 A;  1MDX A;  3PIU A;  1M4N A;  1V2F A;  1AAM A;  3AOW A;  1CQ8 A;  2YKY A;  3MAD A;  3WGC A;  5F9S A;  4IXO A;  1MLY A;  1JS3 A;  3FD0 A;  1QIR A;  3BWO A;  3RBF A;  3MAF A;  1SF2 A;  1GCK A;  3F9T A;  2BI1 A;  2YOB A;  3N75 A;  2VIA A;  3FKD A;  1ASF A;  1Z3Z A;  5FT8 A;  3BCX A;  4ZLV A;  2R5E A;  1QJ3 A;  4M2K A;  2DKB A;  4J5U A;  1V72 A;  3NTJ A;  3GJU A;  2W8J A;  1YIY A;  1B9H A;  1QIT A;  3UE8 A;  2G6W A;  4BQ0 A;  1ZOB A;  2W7K A;  3I5T A;  1U08 A;  1I41 A;  4UQV A;  3WLX A;  3PA9 A;  4K2M A;  2TPL A;  2Z9W A;  1AJS B;  1D7S A;  2BHX A;  4OTL A;  4WD2 A;  2AY3 A;  4OBV A;  1ELQ A;  1AHG A;  5G4I A;  2FYF A;  1EG5 A;  3EI7 A;  4GE4 A;  2ZSL A;  4K2I A;  1IAX A;  3E2Z B;  3EZ1 A;  1TOK A;  2EPJ A;  5M4B A;  2EH6 A;  3KGX A;  3DR4 A;  3BS8 A;  2AY1 A;  1AJS A;  3QGU A;  2O7C A;  3BB8 A;  3BCA A;  3MKJ A;  1IAY A;  3NU8 A;  3FQ7 A;  4A0G A;  4XEW A;  2E7J A;  2VMS A;  3E2Y A;  2C0R A;  4W5K A;  3PDX A;  1B4X A;  2CIN A;  2XH1 A;  3NUB A;  3FSL A;  3QPG A;  2BI9 A;  5HDM A;  1S06 A;  1ASL A;  3AOV A;  3N4S A;  1AMQ A;  2QB2 A;  4PFN A;  3FZ6 A;  4AZK A;  4MQQ A;  1AKC A;  1AHE A;  2Q7W A;  2V0Y A;  4ZM4 A;  4QGR A;  3W1I A;  3EI6 A;  1GC3 A;  4F5J A;  4LW4 A;  1DJU A;  3WX9 A;  1S09 A;  1AAW A;  2ZYJ A;  3AAT A;  4RAE A;  3DU4 A;  5FT6 A;  3VK2 A;  4GE7 A;  3HT4 A;  3N5M A;  2AEV A;  1M7Y A;  1CS1 A;  2QBT A;  4ZWM A;  4XK1 A;  2XBN A;  3JZL A;  3RCH B;  3EZS A;  3A9Y A;  4R5F A;  3RI6 A;  2W7J A;  5KTB A;  1B5P A;  4W1V A;  1ARH A;  4RLG A;  3K40 A;  3K7Y A;  1QZ9 A;  1G4V A;  3USF A;  1SZS A;  1BJO B;  2W8U A;  4JEZ A;  3RCH A;  3CQ5 A;  3MEB A;  1PMM A;  2HP2 A;  3B8X A;  2W7L A;  2ZY5 A;  3E9K A;  1JG8 A;  2Z9X A;  1DJ9 A;  4R2N A;  4XJL A;  1AKA A;  3FZ8 A;  5BJ3 A;  3GET A;  3BN1 A;  1D7R A;  2VMY A;  2GQN A;  3KGW A;  1BJO A;  1GDE A;  4B98 A;  1OHY A;  3HBX A;  1RV4 A;  4W1X A;  1KKP A;  1SPA A;  1TAS A;  2Z20 A;  5HXX A;  1ARI A;  1H0C A;  3KE3 A;  4WXG A;  2QB3 A;  2D65 A;  4E3Q A;  3FDD A;  2DGM A;  3TFU A;  2C7T A;  2D63 A;  2E7I A;  4OYT A;  4RIT A;  4AZJ A;  5EQC A;  4A0R A;  2AY8 A;  2W7M A;  1EQB A;  1CJ0 A;  3Q8N A;  4OT8 A;  4RM1 A;  1C7G A;  2W7D A;  2YCT A;  2CFB A;  3NDN A;  3P6K A;  4CXQ A;  2YRR A;  5DB5 A;  4BHD A;  1ASE A;  1FG3 A;  4IYO B;  5EIG B;  3QHX A;  3JTX A;  3LVK A;  3PGY A;  1CQ6 A;  2V1P A;  1OHW A;  3LG0 A;  1AX4 A;  2W7G A;  3EIB A;  3L8A A;  4Q75 A;  4ZSW A;  3GR9 A;  2VMR A;  2BI2 A;  5DX5 A;  1ASD A;  3MC6 A;  1X2A A;  3FTB A;  1YJS A;  2DGK A;  3AEL A;  4R5Z A;  1JF9 A;  1CL2 A;  2CJG A;  4Y0H A;  4IYO A;  5EIG A;  1IX6 A;  3BCB A;  3EI9 A;  4Y0D A;  3CAI A;  2QSR A;  1ASA A;  2FQ6 A;  4WBT A;  3AEO A;  3EUC A;  4DQ6 A;  1FC4 A;  4ZM3 A;  3R9A A;  1KL1 A;  1YAA A;  2BIE A;  2WK8 A;  5D5S A;  1N8P A;  5EAV A;  1B5O A;  1W23 A;  3JWA A;  4ZSY A;  3VK4 A;  4ADC A;  4CBS A;  3N4X A;  4WYG A;  4FL0 A;  5M4D A;  1C7N A;  2PB2 A;  1LC8 A;  3EIA A;  2BI3 A;  1IX7 A;  2OGE A;  4GEB A;  2HOZ A;  4DBC A;  1UU1 A;  4ZDO A;  4KYO A;  1M6S A;  2VMQ A;  4HVK A;  1LW5 A;  2KFP A;  1AMR A;  1BJN A;  2O1B A;  4B9B A;  1BT4 A;  1V2D A;  3TAT A;  1Y4I A;  1WST A;  2HOX A;  4OC9 A;  1M0Q A;  2BYL A;  1J04 A;  1OXO A;  2VMW A;  3AEP A;  3ELP A;  2W7I A;  2D64 A;  2X3L A;  3HL2 A;  3K28 A;  1AKB A;  3VP6 A;  3ZRP A;  3HVY A;  2W7H A;  4MQR A;  3HQT A;  4WXB A;  1W3U A;  2HOR A;  2FN6 A;  3ISL A;  1LC7 A;  1MAQ A;  1YJZ A;  3B1D A;  5BJ4 A;  4TN4 A;  1X29 A;  3W1J A;  1ARG A;  4ITX A;  1ASN A;  4UOY A;  4WYA A;  2JJE A;  2EZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...