2FKIA

Nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
MTISELLQYCMAKPGAEQSVHNDWKATQIKVEDVLFAMVKEVENRPAVSLKTSPELAELLRQQHSDVRPSRHLNKAHWSTVYLDGSLPDSQIYYLVDASYQQAVNLLPEEKRKLLVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein yjbR
publication title NMR structure of protein yjbR from Escherichia coli reveals 'double-wing' DNA binding motif.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2006-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04237 YjbR YjbR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1150.30 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2fkiA00
2A1VA 2KFPA 3H9XA 2FKIA
chains in the Genus database with same CATH superfamily
3I16A 4BQ0A 3AEMC 4ZSWA 4RKCA 3VK3A 4H51A 3I4JA 1RV3A 3UWCA 4F5GA 2VMXA 1VJOA 1XI9A 2YRRA 2QBTA 1AAMA 1BQDA 2ZYJA 1OXOA 3A9YA 3HLMA 2R0TA 3RBLA 1AY5A 1J32A 3FDBA 4JEXA 3E2YA 4JF0A 2R5CA 4Q75A 2R2NA 1GBNA 3WKRA 3AEJA 3BCBA 2ZY2A 3F0HA 2BI1A 3LY1A 3RUYA 4B98A 1AJSB 2X3LA 1UU2A 4OTLA 3FDDA 3DR4A 1QGNA 1AY4A 3II0A 3L8AA 5DB5A 1AIBA 2E7JA 4J8LA 5G2QA 3IHJA 2W7LA 1C7GA 2D7ZA 2WK7A 1ASLA 3EI7A 3NUIA 3AOVA 5E4ZA 1DGDA 1KL2A 3RI6A 3MADA 4ADBA 2V1PA 1E5FA 1AJRA 4PFNA 3ASBA 3E77A 4XJOA 1GD9A 2QB3A 3NDNA 4GE7A 2OQXA 4WYAA 2QMAA 3B46A 2VIBA 1LKCA 2YCTA 3ECDA 1I48A 1WYUB 3AENB 4IXZA 4DBCA 4QGRA 1CL1A 3GBXA 1ARSA 3HDOA 1ASFA 1WYVB 2ZY3A 5BJ3A 4RIZA 2VI8A 4A72A 1AHYA 2HZPA 1D7SA 2CJHA 3MC6A 4U1TA 1JG8A 3PDBB 2YCPA 4LW4A 4K2MA 2DKJA 3A8UX 1ARTA 3ZZJA 3GZDC 1D7UA 3BN1A 1C4KA 4CVQA 2ZC0A 2V0YA 2W7DA 2QLRA 2VGTA 3KKIA 1KMJA 4Y0IA 1MLZA 1O4SA 2EO5A 1LK9A 1TASA 4ITXA 5FT4A 4CBSA 2VYCA 1IJIA 3AELA 4Q31A 2ZSLA 2C0RA 1KAFA 1J04A 3GSBA 3HQTA 3EI8A 4MY5A 2ZY5A 4AZKA 3N0LA 1QISA 2VMWA 4W1VA 4IY7A 3DYDA 3GZCA 2GSAA 3WZFA 1FG7A 1SVVA 2E7UA 4MQQA 3VK4A 2BIAA 1TATA 3L44A 4OC9A 4TN4A 2O0RA 1ASEA 4F5IA 2FKIA 3FD0A 1CJ0A 4AO9A 4A6TA 1ELUA 3EI6A 2BYJA 1YAAA 2PB2A 3FQAA 3M5UA 1OHVA 4M2KA 2VLFA 3QBOA 2BI9A 2QB2A 1ORDA 2AEUA 3BCAA 4ADCA 5BJ4A 4I8AA 4A0RA 3AEMA 1IVRA 4MQPA 1B5OA 1BJNA 2JJEA 2JJGA 3N4SA 4RJ0A 4J5UA 3MAFA 4WXGA 1H0CA 2Z9XA 4ISYA 1BJOB 4XJMA 2D5YA 2OATA 3AEPA 4K05A 1ZOBA 4W5KA 1TOJA 2JJFA 2EZ1A 3B1DA 2Z1YA 2HUFA 4MKJA 4UHOA 1IX6A 1YJYA 2HOXA 1O62A 1RVUA 3BCXA 2DGMA 4LNLA 3HL2A 4DGTA 4LNJA 2Z20A 2ORDA 3AV7A 2VMNA 4WXFA 2AATA 4P3MA 3EZSA 3COGA 4F5JA 3RBFA 2W8TA 3AEOA 2VMTA 1QJ3A 2W7GA 1AHGA 2WK9A 2OGEA 4U2HA 3NYUA 1AHEA 1Z7DA 4KXKA 3FSLA 4WYDA 3FZ6A 1WSTA 3PPLA 5FT8A 3HT4A 3ATHA 4PFFA 1LS3A 5FT5A 4EB5A 4E3RA 5HDMA 1ZODA 3R4TA 3QPGA 3BS8A 4ZSYA 2WK8A 4E77A 1LC8A 3K7YA 1RVYA 4AOAA 4XEWA 4WP0A 2PB0A 2W7JA 3B1CA 4A0GA 4L0OA 1V2EA 4XQ2A 3GZDA 1TOKA 3QM2A 1MAPA 1PFFA 3CBFA 2D64A 3VOMA 2X5FA 3CQ4A 4FFCA 4WB0B 3PGYA 1DTYA 4XJLA 1YJSA 1AY8A 5DX5A 2VMQA 3GETA 1C9CA 2AEVA 3PJ0A 4K2BA 2ZSMA 4KAMA 1BW0A 8AATA 3N5MA 5TF5A 1W7NA 4Q76A 5G09A 1FC4A 1CS1A 3FTBA 1PG8A 1YIYA 4GRXA 1AMRA 1BKGA 2RFVA 3RCHA 3ASAA 2BI3A 3DODA 4OMAA 1GCKA 2BIEA 2CJGA 2DGLA 4K2IA 3N7NA 5DJ1A 2EGYA 1LC7A 4Y0DA 2AY8A 3DZZA 5G4JA 4RITA 1EG5A 4IXSA 1VP4A 1D7VA 1O69A 4JEYA 1YJZA 3WCOA 2AY4A 1LW4A 1SPAA 3UE8A 2D66A 3NU7A 2HUIA 3WLXA 2YKUA 1GEWA 4GE9A 3TFTA 2O1BA 1PMOA 2VI9A 2VMZA 3B1EA 2C44A 4R5FA 2BKWA 2DR1A 3ZRPA 4DQ6A 1ASCA 1FG3A 4ZM4A 1Y4IA 1KKPA 1TARA 1B9HA 1WYTA 2W7HA 2W7MA 4CXQA 3LWSA 1AIAA 5EIGB 1B9IA 1CZCA 1AMSA 4M2JA 3H9XA 2CH1A 3G8MA 4F4EA 1W23A 1BJ4A 2FN6A 3E2FA 1YIZA 3E9KA 3FKDA 1AKBA 1M7YA 2CINA 3N4RA 3PD6B 1DGEA 1JS3A 1CL2A 2VMUA 3Q8NA 3E2ZA 3MC6C 2X5DA 1M32A 2VGSA 1WKHA 4IYOB 2CH2A 2AY9A 2CB1A 4FL0A 3GR9A 5E5IA 4ADEA 3CAIA 3R9AA 3NUBA 3TCMA 3N75A 2CSTA 1AKCA 7AATA 2Q7WA 1UKJA 4E3QA 5G0AA 1YOOA 4WXBA 3A2BA 4GDYA 4IW7A 2O7CA 1AX4A 5EUEA 3VAXA 2HUUA 5M46A 1OHYA 1BJWA 1Z3ZA 3AATA 3ELPA 3AEJC 1UU0A 2KFPA 4F5KA 1SZSA 1AHXA 5EAAA 1M4NA 2BI2A 2R5CB 3FVXA 1X29A 4WLJA 1ARHA 4Q6RA 2CTZA 5G2PA 3UAKA 3FZ8A 1S09A 4RJYA 1JF9A 2G7JA 1ASDA 2VMVA 1ZC9A 2YOBA 3BWNC 4PIWA 1ECXA 4WLHA 1DFOA 4LW2A 3EIBA 1AJSA 5AX8A 2AY7A 4E1OA 4F5HA 5HXXA 1AICA 1AMAA 1TOIA 1B5PA 2A1VA 3FFRA 3RQ1A 3MAUA 1CQ8A 3DXWA 4LNMA 1DJ9A 2FM1A 3TATA 4UHMA 4UHNA 3LVKA 2AY5A 2ZY4A 2C81A 2X8UA 1CQ7A 1SZUA 1O61A 1C7OA 1LW5A 3CQ5A 1GEXA 2HORA 4UOYA 2W7KA 3WY7A 3EI5A 3A9XA 1D2FA 3LVJA 4ZDPA 1M0OA 1IX7A 4F5LA 5G4IA 3W1JA 1AHFA 1WYUA 3AENA 1YNUA 2OGAA 3CQ6A 3KE3A 1ASMA 2EYQA 5M49A 2DGKA 2Z61A 3LG0A 1TOGA 2CFBA 1I41A 1OXPA 1WYVA 1VEFA 4EU1A 4ZAHA 1IAYA 4A0HA 1QJ5A 4OBUA 3I5TA 3W1HA 1G7WA 2Z9VA 2GMUA 3JTXA 2QA3A 5EUNA 3JW9A 2DOUA 3PDBA 1LC5A 2CJDA 3TQXA 1I29A 3EUCA 4P7YA 4UQVA 4HF8A 2F8JA 5HHYA 4OCAA 1ASGA 2W8VA 1AKAA 3WX9A 1IX8A 2VGVA 2EZ2A 4EB7A 1KL1A 1S07A 4WYCA 3ZRQA 1ELQA 3WGCA 1ASNA 1M0QA 4W91A 2HP2A 3T32A 3ZRRA 3HVYA 1AMQA 1C0NA 4JF1A 4NOGA 4HVKA 3ELEA 3BV0A 3FZ7A 5E3KA 1MAQA 4LC3A 1RV4A 3FFHA 1MDXA 2AY3A 1KMKA 2ZUKA 4ITGA 2BWOA 3JWAA 2CY8A 2DKBA 2PO3A 1SF2A 4PVFA 3W1IA 1UU1A 2BIGA 4JEVA 3G7QA 3QN6A 1MLYA 3KGWA 5M4BA 3KGXA 2YKVA 3P6KA 1IAXA 4W8IA 1GC3A 2YKYA 3E6GA 3MAFB 1QIRA 2BWPA 4W1WA 1AAWA 3VK2A 4WYEA 1DJUA 1S08A 5DJ9A 2W8UA 3GJUA 4ZASA 4ZLVA 4CBRA 2VGZA 4WYFA 1C7NA 1G4VA 3OP7A 4ZM3A 1BJOA 1DKAA 4R5ZA 1SZKA 2WB6A 3F6TA 4GEBA 4BA5A 1B4XA 1TOEA 1D7RA 2Z9WA 2VMRA 4ZWVA 1MDZA 1M0PA 2GMSA 3BWNA 2W7EA 3NU8A 1ASBA 5EAVA 4W1XA 3VP6A 2FQ6A 3FQ8A 4H63Q 2OKKA 3D6KA 2JGTA 1GDEA 2VIAA 1W7MA 4MKKA 1M6SA 4BHDA 1N31A 3ISLA 2YHKA 3JZLA 5F9SA 4BA4A 1CZEA 2FNIA 3EI9A 3FVUA 3NNKA 3P1TA 1WKGA 3OKSA 2HOYA 3LVMA 5FT6A 1GC4A 3K28A 4IX8A 1MDOA 1V2DA 2BI5A 3HBXA 3K40A 4RLGA 2QSRA 1PMMA 4ADDA 5C6UA 2VMYA 3H7FA 1EJIA 4R8DA 3DRDA 1XEYA 4B9BA 5KTBA 1V2FA 4GE4A 1GEYA 4AO4A 5EQCA 4A6RA 4XAUA 3PIUA 3PAAA 2HP1A 1QITA 5D5SA 3MBBA 4A0FA 2Z1ZA 1JS6A 3FCRA 3PDXA 4WBTA 4M2MA 2VGUA 2GB3A 3F9TA 4CXRA 3PA9A 2BHXA 4EMYA 5JAYA 3EIAA 1ARGA 2D63A 2FYFA 3BWOA 2XH1A 1KKJA 2E7IA 4F5FA 3BC8A 2W7IA 4XJPA 3QHXA 2FNUA 3FRKA 4F5MA 2W8WA 3A9ZA 3EZ1A 5F8VA 3FQ7A 4R2NA 2G6WA 2W8JA 1OHWA 1W3UA 1P3WA 1T3IA 2D7YA 4XK1A 2C7TA 4RM1A 3RCHB 3NYTA 4ATPA 2AY2A 1M0NA 2HOZA 4OYTA 4OT8A 4RKDA 4WB0A 4WYGA 2CANA 3DR7A 5J8QA 3G0TA 2EH6A 1S0AA 3BB8A 4KYOA 2ZP7A 2BYLA 2YCNA 3GWPA 1IUGA 2VMPA 3QGUA 1GC2A 3NTJA 5K8BA 3NYSA 3LVLB 1G4XA 3ZZKA 4ZWMA 3HMUA 4JEZA 4JEWA 4A6UA 1BT4A 1X0MA 2W7FA 1E5EA 1G7XA 2VGWA 1BS0A 1X28A 9AATA 1CQ6A 2VLHA 5EUDA 4EFFA 1S06A 2NMPA 2TPLA 1TPLA 5D95A 4ATQA 3DU4A 4WD2A 1X2AA 1WYTB 2VMSA 3DXVA 3JWBA 4ZDOA 3B8XA 2AY1A 3QI6A 2OKJA 2WKAA 1B8GA 4TMRA 4IXOA 1ARIA 1H1CA 2R5EA 4OBVA 4ZDLA 2GQNA 1N8PA 5I92A 2JISA 1EQBA 2XBNA 1BQAA 4O6ZA 4Y0HA 3WKSA 4RAEA 1SFFA 2YKXA 3AOWA 3NX3A 3N4XA 4N0WA 1QZ9A 5IWQA 5EIGA 2D65A 4MQRA 2BWNA 5EFSA 3E2ZB 3MEBA 1IBJA 4MSOA 3USFA 2JJHA 3NRAA 1DJEA 1U08A 1MGVA 4BMKA 3PD6A 5M4DA 2JG2A 2AY6A 2D61A 3WCNA 3LV2A 2YRIA 3TFUA 4IYOA 4AH3A 1OATA 1W7LA 1V72A 4AZJA 2Z9UA 1I43A 1GC0A 2E54A 4A00A 3WGBA 3FVSA 2VMOA 2EPJA 3MKJA 3DC1A 1N2TA 3ACZA 2ZJGA 1ASAA 4GSAA
chains in the Genus database with same CATH topology
3I16A 4BQ0A 3AEMC 4ZSWA 4RKCA 3VK3A 4H51A 3I4JA 1RV3A 3UWCA 4F5GA 2VMXA 1VJOA 1XI9A 2YRRA 2QBTA 1AAMA 1BQDA 2ZYJA 1OXOA 3A9YA 3HLMA 2R0TA 3RBLA 1AY5A 1J32A 3FDBA 4JEXA 3E2YA 4JF0A 2R5CA 4Q75A 2R2NA 1GBNA 3WKRA 3AEJA 3BCBA 2ZY2A 3F0HA 2BI1A 3LY1A 3RUYA 4B98A 1AJSB 2X3LA 1UU2A 4OTLA 3FDDA 3DR4A 1QGNA 1AY4A 3II0A 3L8AA 5DB5A 1AIBA 2E7JA 4J8LA 5G2QA 3IHJA 2W7LA 1C7GA 2D7ZA 2WK7A 1ASLA 3EI7A 3NUIA 3AOVA 5E4ZA 1DGDA 1KL2A 3RI6A 3MADA 4ADBA 2V1PA 1E5FA 1AJRA 4PFNA 3ASBA 3E77A 4XJOA 1GD9A 2QB3A 3NDNA 4GE7A 2OQXA 4WYAA 2QMAA 3B46A 2VIBA 1LKCA 2YCTA 3ECDA 1I48A 1WYUB 3AENB 4IXZA 4DBCA 4QGRA 1CL1A 3GBXA 1ARSA 3HDOA 1ASFA 1WYVB 2ZY3A 5BJ3A 4RIZA 2VI8A 4A72A 1AHYA 2HZPA 1D7SA 2CJHA 3MC6A 4U1TA 1JG8A 3PDBB 2YCPA 4LW4A 4K2MA 2DKJA 3A8UX 1ARTA 3ZZJA 3GZDC 1D7UA 3BN1A 1C4KA 4CVQA 2ZC0A 2V0YA 2W7DA 2QLRA 2VGTA 3KKIA 1KMJA 4Y0IA 1MLZA 1O4SA 2EO5A 1LK9A 1TASA 4ITXA 5FT4A 4CBSA 2VYCA 1IJIA 3AELA 4Q31A 2ZSLA 2C0RA 1J04A 3GSBA 3HQTA 3EI8A 4MY5A 2ZY5A 4AZKA 3N0LA 1QISA 2VMWA 4W1VA 4IY7A 3DYDA 3GZCA 2GSAA 3WZFA 1FG7A 1SVVA 2E7UA 4MQQA 3VK4A 2BIAA 1TATA 3L44A 4OC9A 4TN4A 2O0RA 1ASEA 4F5IA 2FKIA 3FD0A 1CJ0A 4AO9A 4A6TA 1ELUA 3EI6A 2BYJA 1YAAA 2PB2A 3FQAA 3M5UA 1OHVA 4M2KA 2VLFA 3QBOA 2BI9A 2QB2A 1ORDA 2AEUA 3BCAA 4ADCA 5BJ4A 4I8AA 4A0RA 3AEMA 1IVRA 4MQPA 1B5OA 1BJNA 2JJEA 2JJGA 3N4SA 4RJ0A 4J5UA 3MAFA 4WXGA 1H0CA 2Z9XA 4ISYA 1BJOB 4XJMA 2D5YA 2OATA 3AEPA 4K05A 1ZOBA 4W5KA 1TOJA 2JJFA 2EZ1A 3B1DA 2Z1YA 2HUFA 4MKJA 4UHOA 1IX6A 1YJYA 2HOXA 1O62A 1RVUA 3BCXA 2DGMA 4LNLA 3HL2A 4DGTA 4LNJA 2Z20A 2ORDA 3AV7A 2VMNA 4WXFA 2AATA 4P3MA 3EZSA 3COGA 4F5JA 3RBFA 2W8TA 3AEOA 2VMTA 1QJ3A 2W7GA 1AHGA 2WK9A 2OGEA 4U2HA 3NYUA 1AHEA 1Z7DA 4KXKA 3FSLA 4WYDA 3FZ6A 1WSTA 3PPLA 5FT8A 3HT4A 3ATHA 4PFFA 1LS3A 5FT5A 4EB5A 4E3RA 5HDMA 1ZODA 3R4TA 3QPGA 3BS8A 4ZSYA 2WK8A 4E77A 1LC8A 3K7YA 1RVYA 4AOAA 4XEWA 4WP0A 2PB0A 2W7JA 3B1CA 4A0GA 4L0OA 1V2EA 4XQ2A 3GZDA 1TOKA 3QM2A 1MAPA 1PFFA 3CBFA 2D64A 3VOMA 2X5FA 3CQ4A 4FFCA 4WB0B 3PGYA 1DTYA 4XJLA 1YJSA 1AY8A 5DX5A 2VMQA 3GETA 1C9CA 2AEVA 3PJ0A 4K2BA 2ZSMA 4KAMA 1BW0A 8AATA 3N5MA 5TF5A 1W7NA 4Q76A 5G09A 1FC4A 1CS1A 3FTBA 1PG8A 1YIYA 4GRXA 1AMRA 1BKGA 2RFVA 3RCHA 3ASAA 2BI3A 3DODA 4OMAA 1GCKA 2BIEA 2CJGA 2DGLA 4K2IA 3N7NA 5DJ1A 2EGYA 1LC7A 4Y0DA 2AY8A 3DZZA 5G4JA 4RITA 1EG5A 4IXSA 1VP4A 1D7VA 1O69A 4JEYA 1YJZA 3WCOA 2AY4A 1LW4A 1SPAA 3UE8A 2D66A 3NU7A 2HUIA 3WLXA 2YKUA 1GEWA 4GE9A 3TFTA 2O1BA 1PMOA 2VI9A 2VMZA 3B1EA 2C44A 4R5FA 2BKWA 2DR1A 3ZRPA 4DQ6A 1ASCA 1FG3A 4ZM4A 1Y4IA 1KKPA 1TARA 1B9HA 1WYTA 2W7HA 2W7MA 4CXQA 3LWSA 1AIAA 5EIGB 1B9IA 1CZCA 1AMSA 4M2JA 3H9XA 2CH1A 3G8MA 4F4EA 1W23A 1BJ4A 2FN6A 3E2FA 1YIZA 3E9KA 3FKDA 1AKBA 1M7YA 2CINA 3N4RA 3PD6B 1DGEA 1JS3A 1CL2A 2VMUA 3Q8NA 3E2ZA 3MC6C 2X5DA 1M32A 2VGSA 1WKHA 4IYOB 2CH2A 2AY9A 2CB1A 4FL0A 3GR9A 5E5IA 4ADEA 3CAIA 3R9AA 3NUBA 3TCMA 3N75A 2CSTA 1AKCA 7AATA 2Q7WA 1UKJA 4E3QA 5G0AA 1YOOA 4WXBA 3A2BA 4GDYA 4IW7A 2O7CA 1AX4A 5EUEA 3VAXA 2HUUA 5M46A 1OHYA 1BJWA 1Z3ZA 3AATA 3ELPA 3AEJC 1UU0A 2KFPA 4F5KA 1SZSA 1AHXA 5EAAA 1M4NA 2BI2A 2R5CB 3FVXA 1X29A 4WLJA 1ARHA 4Q6RA 2CTZA 5G2PA 3UAKA 3FZ8A 1S09A 4RJYA 1JF9A 2G7JA 1ASDA 2VMVA 1ZC9A 2YOBA 3BWNC 4PIWA 1ECXA 4WLHA 1DFOA 4LW2A 3EIBA 1AJSA 5AX8A 2AY7A 4E1OA 4F5HA 5HXXA 1AICA 1AMAA 1TOIA 1B5PA 2A1VA 3FFRA 3RQ1A 3MAUA 1CQ8A 3DXWA 4LNMA 1DJ9A 2FM1A 3TATA 4UHMA 4UHNA 3LVKA 2AY5A 2ZY4A 2C81A 2X8UA 1CQ7A 1SZUA 1O61A 1C7OA 1LW5A 3CQ5A 1GEXA 2HORA 4UOYA 2W7KA 3WY7A 3EI5A 3A9XA 1D2FA 3LVJA 4ZDPA 1M0OA 1IX7A 4F5LA 5G4IA 3W1JA 1AHFA 1WYUA 3AENA 1YNUA 2OGAA 3CQ6A 3KE3A 1ASMA 2EYQA 5M49A 2DGKA 2Z61A 3LG0A 1TOGA 2CFBA 1I41A 1OXPA 1WYVA 1VEFA 4EU1A 4ZAHA 1IAYA 4A0HA 1QJ5A 4OBUA 3I5TA 3W1HA 1G7WA 2Z9VA 2GMUA 3JTXA 2QA3A 5EUNA 3JW9A 2DOUA 3PDBA 1LC5A 2CJDA 3TQXA 1I29A 3EUCA 4P7YA 4UQVA 4HF8A 2F8JA 5HHYA 4OCAA 1ASGA 2W8VA 1AKAA 3WX9A 1IX8A 2VGVA 2EZ2A 4EB7A 1KL1A 1S07A 4WYCA 3ZRQA 1ELQA 3WGCA 1ASNA 1M0QA 4W91A 2HP2A 3T32A 3ZRRA 3HVYA 1AMQA 1C0NA 4JF1A 4NOGA 4HVKA 3ELEA 3BV0A 3FZ7A 5E3KA 1MAQA 4LC3A 1RV4A 3FFHA 1MDXA 2AY3A 1KMKA 2ZUKA 4ITGA 2BWOA 3JWAA 2CY8A 2DKBA 2PO3A 1SF2A 4PVFA 3W1IA 1UU1A 2BIGA 4JEVA 3G7QA 3QN6A 1MLYA 3KGWA 5M4BA 3KGXA 2YKVA 3P6KA 1IAXA 4W8IA 1GC3A 2YKYA 3E6GA 3MAFB 1QIRA 2BWPA 4W1WA 1AAWA 3VK2A 4WYEA 1DJUA 1S08A 5DJ9A 2W8UA 3GJUA 4ZASA 4ZLVA 4CBRA 2VGZA 4WYFA 1C7NA 1G4VA 3OP7A 4ZM3A 1BJOA 1DKAA 4R5ZA 1SZKA 2WB6A 3F6TA 4GEBA 4BA5A 1B4XA 1TOEA 1D7RA 2Z9WA 2VMRA 4ZWVA 1MDZA 1M0PA 2GMSA 3BWNA 2W7EA 3NU8A 1ASBA 5EAVA 4W1XA 3VP6A 2FQ6A 3FQ8A 4H63Q 2OKKA 3D6KA 2JGTA 1GDEA 2VIAA 1W7MA 4MKKA 1M6SA 4BHDA 1N31A 3ISLA 2YHKA 3JZLA 5F9SA 4BA4A 1CZEA 2FNIA 3EI9A 3FVUA 3NNKA 3P1TA 1WKGA 3OKSA 2HOYA 3LVMA 5FT6A 1GC4A 3K28A 4IX8A 1MDOA 1V2DA 2BI5A 3HBXA 3K40A 4RLGA 2QSRA 1PMMA 4ADDA 5C6UA 2VMYA 3H7FA 1EJIA 4R8DA 3DRDA 1XEYA 4B9BA 5KTBA 1V2FA 4GE4A 1GEYA 4AO4A 5EQCA 4A6RA 4XAUA 3PIUA 3PAAA 2HP1A 1QITA 5D5SA 3MBBA 4A0FA 2Z1ZA 1JS6A 3FCRA 3PDXA 4WBTA 4M2MA 2VGUA 2GB3A 3F9TA 4CXRA 3PA9A 2BHXA 4EMYA 5JAYA 3EIAA 1ARGA 2D63A 2FYFA 3BWOA 2XH1A 1KKJA 2E7IA 4F5FA 3BC8A 2W7IA 4XJPA 3QHXA 2FNUA 3FRKA 4F5MA 2W8WA 3A9ZA 3EZ1A 5F8VA 3FQ7A 4R2NA 2G6WA 2W8JA 1OHWA 1W3UA 1P3WA 1T3IA 2D7YA 4XK1A 2C7TA 4RM1A 3RCHB 3NYTA 4ATPA 2AY2A 1M0NA 2HOZA 4OYTA 4OT8A 4RKDA 4WB0A 4WYGA 2CANA 3DR7A 5J8QA 3G0TA 2EH6A 1S0AA 3BB8A 4KYOA 2ZP7A 2BYLA 2YCNA 3GWPA 1IUGA 2VMPA 3QGUA 1GC2A 3NTJA 5K8BA 3NYSA 3LVLB 1G4XA 3ZZKA 4ZWMA 3HMUA 4JEZA 4JEWA 4A6UA 1BT4A 1X0MA 2W7FA 1E5EA 1G7XA 2VGWA 1BS0A 1X28A 9AATA 1CQ6A 2VLHA 5EUDA 4EFFA 1S06A 2NMPA 2TPLA 1TPLA 5D95A 4ATQA 3DU4A 4WD2A 1X2AA 1WYTB 2VMSA 3DXVA 3JWBA 4ZDOA 3B8XA 2AY1A 3QI6A 2OKJA 2WKAA 1B8GA 4TMRA 4IXOA 1ARIA 1H1CA 2R5EA 4OBVA 4ZDLA 2GQNA 1N8PA 5I92A 2JISA 1EQBA 2XBNA 1BQAA 4O6ZA 4Y0HA 3WKSA 4RAEA 1SFFA 2YKXA 3AOWA 3NX3A 3N4XA 4N0WA 1QZ9A 5IWQA 5EIGA 2D65A 4MQRA 2BWNA 5EFSA 3E2ZB 3MEBA 1IBJA 4MSOA 3USFA 2JJHA 3NRAA 1DJEA 1U08A 1MGVA 4BMKA 3PD6A 5M4DA 2JG2A 2AY6A 2D61A 3WCNA 3LV2A 2YRIA 3TFUA 4IYOA 4AH3A 1OATA 1W7LA 1V72A 4AZJA 2Z9UA 1I43A 1GC0A 2E54A 4A00A 3WGBA 3FVSA 2VMOA 2EPJA 3MKJA 3DC1A 1N2TA 3ACZA 2ZJGA 1ASAA 4GSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A1V A;  2KFP A;  3H9X A;  2FKI A; 
#chains in the Genus database with same CATH topology
 3I16 A;  4BQ0 A;  3AEM C;  4ZSW A;  4RKC A;  3VK3 A;  4H51 A;  3I4J A;  1RV3 A;  3UWC A;  4F5G A;  2VMX A;  1VJO A;  1XI9 A;  2YRR A;  2QBT A;  1AAM A;  1BQD A;  2ZYJ A;  1OXO A;  3A9Y A;  3HLM A;  2R0T A;  3RBL A;  1AY5 A;  1J32 A;  3FDB A;  4JEX A;  3E2Y A;  4JF0 A;  2R5C A;  4Q75 A;  2R2N A;  1GBN A;  3WKR A;  3AEJ A;  3BCB A;  2ZY2 A;  3F0H A;  2BI1 A;  3LY1 A;  3RUY A;  4B98 A;  1AJS B;  2X3L A;  1UU2 A;  4OTL A;  3FDD A;  3DR4 A;  1QGN A;  1AY4 A;  3II0 A;  3L8A A;  5DB5 A;  1AIB A;  2E7J A;  4J8L A;  5G2Q A;  3IHJ A;  2W7L A;  1C7G A;  2D7Z A;  2WK7 A;  1ASL A;  3EI7 A;  3NUI A;  3AOV A;  5E4Z A;  1DGD A;  1KL2 A;  3RI6 A;  3MAD A;  4ADB A;  2V1P A;  1E5F A;  1AJR A;  4PFN A;  3ASB A;  3E77 A;  4XJO A;  1GD9 A;  2QB3 A;  3NDN A;  4GE7 A;  2OQX A;  4WYA A;  2QMA A;  3B46 A;  2VIB A;  1LKC A;  2YCT A;  3ECD A;  1I48 A;  1WYU B;  3AEN B;  4IXZ A;  4DBC A;  4QGR A;  1CL1 A;  3GBX A;  1ARS A;  3HDO A;  1ASF A;  1WYV B;  2ZY3 A;  5BJ3 A;  4RIZ A;  2VI8 A;  4A72 A;  1AHY A;  2HZP A;  1D7S A;  2CJH A;  3MC6 A;  4U1T A;  1JG8 A;  3PDB B;  2YCP A;  4LW4 A;  4K2M A;  2DKJ A;  3A8U X;  1ART A;  3ZZJ A;  3GZD C;  1D7U A;  3BN1 A;  1C4K A;  4CVQ A;  2ZC0 A;  2V0Y A;  2W7D A;  2QLR A;  2VGT A;  3KKI A;  1KMJ A;  4Y0I A;  1MLZ A;  1O4S A;  2EO5 A;  1LK9 A;  1TAS A;  4ITX A;  5FT4 A;  4CBS A;  2VYC A;  1IJI A;  3AEL A;  4Q31 A;  2ZSL A;  2C0R A;  1KAF A;  1J04 A;  3GSB A;  3HQT A;  3EI8 A;  4MY5 A;  2ZY5 A;  4AZK A;  3N0L A;  1QIS A;  2VMW A;  4W1V A;  4IY7 A;  3DYD A;  3GZC A;  2GSA A;  3WZF A;  1FG7 A;  1SVV A;  2E7U A;  4MQQ A;  3VK4 A;  2BIA A;  1TAT A;  3L44 A;  4OC9 A;  4TN4 A;  2O0R A;  1ASE A;  4F5I A;  2FKI A;  3FD0 A;  1CJ0 A;  4AO9 A;  4A6T A;  1ELU A;  3EI6 A;  2BYJ A;  1YAA A;  2PB2 A;  3FQA A;  3M5U A;  1OHV A;  4M2K A;  2VLF A;  3QBO A;  2BI9 A;  2QB2 A;  1ORD A;  2AEU A;  3BCA A;  4ADC A;  5BJ4 A;  4I8A A;  4A0R A;  3AEM A;  1IVR A;  4MQP A;  1B5O A;  1BJN A;  2JJE A;  2JJG A;  3N4S A;  4RJ0 A;  4J5U A;  3MAF A;  4WXG A;  1H0C A;  2Z9X A;  4ISY A;  1BJO B;  4XJM A;  2D5Y A;  2OAT A;  3AEP A;  4K05 A;  1ZOB A;  4W5K A;  1TOJ A;  2JJF A;  2EZ1 A;  3B1D A;  2Z1Y A;  2HUF A;  4MKJ A;  4UHO A;  1IX6 A;  1YJY A;  2HOX A;  1O62 A;  1RVU A;  3BCX A;  2DGM A;  4LNL A;  3HL2 A;  4DGT A;  4LNJ A;  2Z20 A;  2ORD A;  3AV7 A;  2VMN A;  4WXF A;  2AAT A;  4P3M A;  3EZS A;  3COG A;  4F5J A;  3RBF A;  2W8T A;  3AEO A;  2VMT A;  1QJ3 A;  2W7G A;  1AHG A;  2WK9 A;  2OGE A;  4U2H A;  3NYU A;  1AHE A;  1Z7D A;  4KXK A;  3FSL A;  4WYD A;  3FZ6 A;  1WST A;  3PPL A;  5FT8 A;  3HT4 A;  3ATH A;  4PFF A;  1LS3 A;  5FT5 A;  4EB5 A;  4E3R A;  5HDM A;  1ZOD A;  3R4T A;  3QPG A;  3BS8 A;  4ZSY A;  2WK8 A;  4E77 A;  1LC8 A;  3K7Y A;  1RVY A;  4AOA A;  4XEW A;  4WP0 A;  2PB0 A;  2W7J A;  3B1C A;  4A0G A;  4L0O A;  1V2E A;  4XQ2 A;  3GZD A;  1TOK A;  3QM2 A;  1MAP A;  1PFF A;  3CBF A;  2D64 A;  3VOM A;  2X5F A;  3CQ4 A;  4FFC A;  4WB0 B;  3PGY A;  1DTY A;  4XJL A;  1YJS A;  1AY8 A;  5DX5 A;  2VMQ A;  3GET A;  1C9C A;  2AEV A;  3PJ0 A;  4K2B A;  2ZSM A;  4KAM A;  1BW0 A;  8AAT A;  3N5M A;  5TF5 A;  1W7N A;  4Q76 A;  5G09 A;  1FC4 A;  1CS1 A;  3FTB A;  1PG8 A;  1YIY A;  4GRX A;  1AMR A;  1BKG A;  2RFV A;  3RCH A;  3ASA A;  2BI3 A;  3DOD A;  4OMA A;  1GCK A;  2BIE A;  2CJG A;  2DGL A;  4K2I A;  3N7N A;  5DJ1 A;  2EGY A;  1LC7 A;  4Y0D A;  2AY8 A;  3DZZ A;  5G4J A;  4RIT A;  1EG5 A;  4IXS A;  1VP4 A;  1D7V A;  1O69 A;  4JEY A;  1YJZ A;  3WCO A;  2AY4 A;  1LW4 A;  1SPA A;  3UE8 A;  2D66 A;  3NU7 A;  2HUI A;  3WLX A;  2YKU A;  1GEW A;  4GE9 A;  3TFT A;  2O1B A;  1PMO A;  2VI9 A;  2VMZ A;  3B1E A;  2C44 A;  4R5F A;  2BKW A;  2DR1 A;  3ZRP A;  4DQ6 A;  1ASC A;  1FG3 A;  4ZM4 A;  1Y4I A;  1KKP A;  1TAR A;  1B9H A;  1WYT A;  2W7H A;  2W7M A;  4CXQ A;  3LWS A;  1AIA A;  5EIG B;  1B9I A;  1CZC A;  1AMS A;  4M2J A;  3H9X A;  2CH1 A;  3G8M A;  4F4E A;  1W23 A;  1BJ4 A;  2FN6 A;  3E2F A;  1YIZ A;  3E9K A;  3FKD A;  1AKB A;  1M7Y A;  2CIN A;  3N4R A;  3PD6 B;  1DGE A;  1JS3 A;  1CL2 A;  2VMU A;  3Q8N A;  3E2Z A;  3MC6 C;  2X5D A;  1M32 A;  2VGS A;  1WKH A;  4IYO B;  2CH2 A;  2AY9 A;  2CB1 A;  4FL0 A;  3GR9 A;  5E5I A;  4ADE A;  3CAI A;  3R9A A;  3NUB A;  3TCM A;  3N75 A;  2CST A;  1AKC A;  7AAT A;  2Q7W A;  1UKJ A;  4E3Q A;  5G0A A;  1YOO A;  4WXB A;  3A2B A;  4GDY A;  4IW7 A;  2O7C A;  1AX4 A;  5EUE A;  3VAX A;  2HUU A;  5M46 A;  1OHY A;  1BJW A;  1Z3Z A;  3AAT A;  3ELP A;  3AEJ C;  1UU0 A;  2KFP A;  4F5K A;  1SZS A;  1AHX A;  5EAA A;  1M4N A;  2BI2 A;  2R5C B;  3FVX A;  1X29 A;  4WLJ A;  1ARH A;  4Q6R A;  2CTZ A;  5G2P A;  3UAK A;  3FZ8 A;  1S09 A;  4RJY A;  1JF9 A;  2G7J A;  1ASD A;  2VMV A;  1ZC9 A;  2YOB A;  3BWN C;  4PIW A;  1ECX A;  4WLH A;  1DFO A;  4LW2 A;  3EIB A;  1AJS A;  5AX8 A;  2AY7 A;  4E1O A;  4F5H A;  5HXX A;  1AIC A;  1AMA A;  1TOI A;  1B5P A;  2A1V A;  3FFR A;  3RQ1 A;  3MAU A;  1CQ8 A;  3DXW A;  4LNM A;  1DJ9 A;  2FM1 A;  3TAT A;  4UHM A;  4UHN A;  3LVK A;  2AY5 A;  2ZY4 A;  2C81 A;  2X8U A;  1CQ7 A;  1SZU A;  1O61 A;  1C7O A;  1LW5 A;  3CQ5 A;  1GEX A;  2HOR A;  4UOY A;  2W7K A;  3WY7 A;  3EI5 A;  3A9X A;  1D2F A;  3LVJ A;  4ZDP A;  1M0O A;  1IX7 A;  4F5L A;  5G4I A;  3W1J A;  1AHF A;  1WYU A;  3AEN A;  1YNU A;  2OGA A;  3CQ6 A;  3KE3 A;  1ASM A;  2EYQ A;  5M49 A;  2DGK A;  2Z61 A;  3LG0 A;  1TOG A;  2CFB A;  1I41 A;  1OXP A;  1WYV A;  1VEF A;  4EU1 A;  4ZAH A;  1IAY A;  4A0H A;  1QJ5 A;  4OBU A;  3I5T A;  3W1H A;  1G7W A;  2Z9V A;  2GMU A;  3JTX A;  2QA3 A;  5EUN A;  3JW9 A;  2DOU A;  3PDB A;  1LC5 A;  2CJD A;  3TQX A;  1I29 A;  3EUC A;  4P7Y A;  4UQV A;  4HF8 A;  2F8J A;  5HHY A;  4OCA A;  1ASG A;  2W8V A;  1AKA A;  3WX9 A;  1IX8 A;  2VGV A;  2EZ2 A;  4EB7 A;  1KL1 A;  1S07 A;  4WYC A;  3ZRQ A;  1ELQ A;  3WGC A;  1ASN A;  1M0Q A;  4W91 A;  2HP2 A;  3T32 A;  3ZRR A;  3HVY A;  1AMQ A;  1C0N A;  4JF1 A;  4NOG A;  4HVK A;  3ELE A;  3BV0 A;  3FZ7 A;  5E3K A;  1MAQ A;  4LC3 A;  1RV4 A;  3FFH A;  1MDX A;  2AY3 A;  1KMK A;  2ZUK A;  4ITG A;  2BWO A;  3JWA A;  2CY8 A;  2DKB A;  2PO3 A;  1SF2 A;  4PVF A;  3W1I A;  1UU1 A;  2BIG A;  4JEV A;  3G7Q A;  3QN6 A;  1MLY A;  3KGW A;  5M4B A;  3KGX A;  2YKV A;  3P6K A;  1IAX A;  4W8I A;  1GC3 A;  2YKY A;  3E6G A;  3MAF B;  1QIR A;  2BWP A;  4W1W A;  1AAW A;  3VK2 A;  4WYE A;  1DJU A;  1S08 A;  5DJ9 A;  2W8U A;  3GJU A;  4ZAS A;  4ZLV A;  4CBR A;  2VGZ A;  4WYF A;  1C7N A;  1G4V A;  3OP7 A;  4ZM3 A;  1BJO A;  1DKA A;  4R5Z A;  1SZK A;  2WB6 A;  3F6T A;  4GEB A;  4BA5 A;  1B4X A;  1TOE A;  1D7R A;  2Z9W A;  2VMR A;  4ZWV A;  1MDZ A;  1M0P A;  2GMS A;  3BWN A;  2W7E A;  3NU8 A;  1ASB A;  5EAV A;  4W1X A;  3VP6 A;  2FQ6 A;  3FQ8 A;  4H63 Q;  2OKK A;  3D6K A;  2JGT A;  1GDE A;  2VIA A;  1W7M A;  4MKK A;  1M6S A;  4BHD A;  1N31 A;  3ISL A;  2YHK A;  3JZL A;  5F9S A;  4BA4 A;  1CZE A;  2FNI A;  3EI9 A;  3FVU A;  3NNK A;  3P1T A;  1WKG A;  3OKS A;  2HOY A;  3LVM A;  5FT6 A;  1GC4 A;  3K28 A;  4IX8 A;  1MDO A;  1V2D A;  2BI5 A;  3HBX A;  3K40 A;  4RLG A;  2QSR A;  1PMM A;  4ADD A;  5C6U A;  2VMY A;  3H7F A;  1EJI A;  4R8D A;  3DRD A;  1XEY A;  4B9B A;  5KTB A;  1V2F A;  4GE4 A;  1GEY A;  4AO4 A;  5EQC A;  4A6R A;  4XAU A;  3PIU A;  3PAA A;  2HP1 A;  1QIT A;  5D5S A;  3MBB A;  4A0F A;  2Z1Z A;  1JS6 A;  3FCR A;  3PDX A;  4WBT A;  4M2M A;  2VGU A;  2GB3 A;  3F9T A;  4CXR A;  3PA9 A;  2BHX A;  4EMY A;  5JAY A;  3EIA A;  1ARG A;  2D63 A;  2FYF A;  3BWO A;  2XH1 A;  1KKJ A;  2E7I A;  4F5F A;  3BC8 A;  2W7I A;  4XJP A;  3QHX A;  2FNU A;  3FRK A;  4F5M A;  2W8W A;  3A9Z A;  3EZ1 A;  5F8V A;  3FQ7 A;  4R2N A;  2G6W A;  2W8J A;  1OHW A;  1W3U A;  1P3W A;  1T3I A;  2D7Y A;  4XK1 A;  2C7T A;  4RM1 A;  3RCH B;  3NYT A;  4ATP A;  2AY2 A;  1M0N A;  2HOZ A;  4OYT A;  4OT8 A;  4RKD A;  4WB0 A;  4WYG A;  2CAN A;  3DR7 A;  5J8Q A;  3G0T A;  2EH6 A;  1S0A A;  3BB8 A;  4KYO A;  2ZP7 A;  2BYL A;  2YCN A;  3GWP A;  1IUG A;  2VMP A;  3QGU A;  1GC2 A;  3NTJ A;  5K8B A;  3NYS A;  3LVL B;  1G4X A;  3ZZK A;  4ZWM A;  3HMU A;  4JEZ A;  4JEW A;  4A6U A;  1BT4 A;  1X0M A;  2W7F A;  1E5E A;  1G7X A;  2VGW A;  1BS0 A;  1X28 A;  9AAT A;  1CQ6 A;  2VLH A;  5EUD A;  4EFF A;  1S06 A;  2NMP A;  2TPL A;  1TPL A;  5D95 A;  4ATQ A;  3DU4 A;  4WD2 A;  1X2A A;  1WYT B;  2VMS A;  3DXV A;  3JWB A;  4ZDO A;  3B8X A;  2AY1 A;  3QI6 A;  2OKJ A;  2WKA A;  1B8G A;  4TMR A;  4IXO A;  1ARI A;  1H1C A;  2R5E A;  4OBV A;  4ZDL A;  2GQN A;  1N8P A;  5I92 A;  2JIS A;  1EQB A;  2XBN A;  1BQA A;  4O6Z A;  4Y0H A;  3WKS A;  4RAE A;  1SFF A;  2YKX A;  3AOW A;  3NX3 A;  3N4X A;  4N0W A;  1QZ9 A;  5IWQ A;  5EIG A;  2D65 A;  4MQR A;  2BWN A;  5EFS A;  3E2Z B;  3MEB A;  1IBJ A;  4MSO A;  3USF A;  2JJH A;  3NRA A;  1DJE A;  1U08 A;  1MGV A;  4BMK A;  3PD6 A;  5M4D A;  2JG2 A;  2AY6 A;  2D61 A;  3WCN A;  3LV2 A;  2YRI A;  3TFU A;  4IYO A;  4AH3 A;  1OAT A;  1W7L A;  1V72 A;  4AZJ A;  2Z9U A;  1I43 A;  1GC0 A;  2E54 A;  4A00 A;  3WGB A;  3FVS A;  2VMO A;  2EPJ A;  3MKJ A;  3DC1 A;  1N2T A;  3ACZ A;  2ZJG A;  1ASA A;  4GSA A; 
#chains in the Genus database with same CATH homology
 3I16 A;  4BQ0 A;  3AEM C;  4ZSW A;  4RKC A;  3VK3 A;  4H51 A;  3I4J A;  1RV3 A;  3UWC A;  4F5G A;  2VMX A;  1VJO A;  1XI9 A;  2YRR A;  2QBT A;  1AAM A;  1BQD A;  2ZYJ A;  1OXO A;  3A9Y A;  3HLM A;  2R0T A;  3RBL A;  1AY5 A;  1J32 A;  3FDB A;  4JEX A;  3E2Y A;  4JF0 A;  2R5C A;  4Q75 A;  2R2N A;  1GBN A;  3WKR A;  3AEJ A;  3BCB A;  2ZY2 A;  3F0H A;  2BI1 A;  3LY1 A;  3RUY A;  4B98 A;  1AJS B;  2X3L A;  1UU2 A;  4OTL A;  3FDD A;  3DR4 A;  1QGN A;  1AY4 A;  3II0 A;  3L8A A;  5DB5 A;  1AIB A;  2E7J A;  4J8L A;  5G2Q A;  3IHJ A;  2W7L A;  1C7G A;  2D7Z A;  2WK7 A;  1ASL A;  3EI7 A;  3NUI A;  3AOV A;  5E4Z A;  1DGD A;  1KL2 A;  3RI6 A;  3MAD A;  4ADB A;  2V1P A;  1E5F A;  1AJR A;  4PFN A;  3ASB A;  3E77 A;  4XJO A;  1GD9 A;  2QB3 A;  3NDN A;  4GE7 A;  2OQX A;  4WYA A;  2QMA A;  3B46 A;  2VIB A;  1LKC A;  2YCT A;  3ECD A;  1I48 A;  1WYU B;  3AEN B;  4IXZ A;  4DBC A;  4QGR A;  1CL1 A;  3GBX A;  1ARS A;  3HDO A;  1ASF A;  1WYV B;  2ZY3 A;  5BJ3 A;  4RIZ A;  2VI8 A;  4A72 A;  1AHY A;  2HZP A;  1D7S A;  2CJH A;  3MC6 A;  4U1T A;  1JG8 A;  3PDB B;  2YCP A;  4LW4 A;  4K2M A;  2DKJ A;  3A8U X;  1ART A;  3ZZJ A;  3GZD C;  1D7U A;  3BN1 A;  1C4K A;  4CVQ A;  2ZC0 A;  2V0Y A;  2W7D A;  2QLR A;  2VGT A;  3KKI A;  1KMJ A;  4Y0I A;  1MLZ A;  1O4S A;  2EO5 A;  1LK9 A;  1TAS A;  4ITX A;  5FT4 A;  4CBS A;  2VYC A;  1IJI A;  3AEL A;  4Q31 A;  2ZSL A;  2C0R A;  1J04 A;  3GSB A;  3HQT A;  3EI8 A;  4MY5 A;  2ZY5 A;  4AZK A;  3N0L A;  1QIS A;  2VMW A;  4W1V A;  4IY7 A;  3DYD A;  3GZC A;  2GSA A;  3WZF A;  1FG7 A;  1SVV A;  2E7U A;  4MQQ A;  3VK4 A;  2BIA A;  1TAT A;  3L44 A;  4OC9 A;  4TN4 A;  2O0R A;  1ASE A;  4F5I A;  2FKI A;  3FD0 A;  1CJ0 A;  4AO9 A;  4A6T A;  1ELU A;  3EI6 A;  2BYJ A;  1YAA A;  2PB2 A;  3FQA A;  3M5U A;  1OHV A;  4M2K A;  2VLF A;  3QBO A;  2BI9 A;  2QB2 A;  1ORD A;  2AEU A;  3BCA A;  4ADC A;  5BJ4 A;  4I8A A;  4A0R A;  3AEM A;  1IVR A;  4MQP A;  1B5O A;  1BJN A;  2JJE A;  2JJG A;  3N4S A;  4RJ0 A;  4J5U A;  3MAF A;  4WXG A;  1H0C A;  2Z9X A;  4ISY A;  1BJO B;  4XJM A;  2D5Y A;  2OAT A;  3AEP A;  4K05 A;  1ZOB A;  4W5K A;  1TOJ A;  2JJF A;  2EZ1 A;  3B1D A;  2Z1Y A;  2HUF A;  4MKJ A;  4UHO A;  1IX6 A;  1YJY A;  2HOX A;  1O62 A;  1RVU A;  3BCX A;  2DGM A;  4LNL A;  3HL2 A;  4DGT A;  4LNJ A;  2Z20 A;  2ORD A;  3AV7 A;  2VMN A;  4WXF A;  2AAT A;  4P3M A;  3EZS A;  3COG A;  4F5J A;  3RBF A;  2W8T A;  3AEO A;  2VMT A;  1QJ3 A;  2W7G A;  1AHG A;  2WK9 A;  2OGE A;  4U2H A;  3NYU A;  1AHE A;  1Z7D A;  4KXK A;  3FSL A;  4WYD A;  3FZ6 A;  1WST A;  3PPL A;  5FT8 A;  3HT4 A;  3ATH A;  4PFF A;  1LS3 A;  5FT5 A;  4EB5 A;  4E3R A;  5HDM A;  1ZOD A;  3R4T A;  3QPG A;  3BS8 A;  4ZSY A;  2WK8 A;  4E77 A;  1LC8 A;  3K7Y A;  1RVY A;  4AOA A;  4XEW A;  4WP0 A;  2PB0 A;  2W7J A;  3B1C A;  4A0G A;  4L0O A;  1V2E A;  4XQ2 A;  3GZD A;  1TOK A;  3QM2 A;  1MAP A;  1PFF A;  3CBF A;  2D64 A;  3VOM A;  2X5F A;  3CQ4 A;  4FFC A;  4WB0 B;  3PGY A;  1DTY A;  4XJL A;  1YJS A;  1AY8 A;  5DX5 A;  2VMQ A;  3GET A;  1C9C A;  2AEV A;  3PJ0 A;  4K2B A;  2ZSM A;  4KAM A;  1BW0 A;  8AAT A;  3N5M A;  5TF5 A;  1W7N A;  4Q76 A;  5G09 A;  1FC4 A;  1CS1 A;  3FTB A;  1PG8 A;  1YIY A;  4GRX A;  1AMR A;  1BKG A;  2RFV A;  3RCH A;  3ASA A;  2BI3 A;  3DOD A;  4OMA A;  1GCK A;  2BIE A;  2CJG A;  2DGL A;  4K2I A;  3N7N A;  5DJ1 A;  2EGY A;  1LC7 A;  4Y0D A;  2AY8 A;  3DZZ A;  5G4J A;  4RIT A;  1EG5 A;  4IXS A;  1VP4 A;  1D7V A;  1O69 A;  4JEY A;  1YJZ A;  3WCO A;  2AY4 A;  1LW4 A;  1SPA A;  3UE8 A;  2D66 A;  3NU7 A;  2HUI A;  3WLX A;  2YKU A;  1GEW A;  4GE9 A;  3TFT A;  2O1B A;  1PMO A;  2VI9 A;  2VMZ A;  3B1E A;  2C44 A;  4R5F A;  2BKW A;  2DR1 A;  3ZRP A;  4DQ6 A;  1ASC A;  1FG3 A;  4ZM4 A;  1Y4I A;  1KKP A;  1TAR A;  1B9H A;  1WYT A;  2W7H A;  2W7M A;  4CXQ A;  3LWS A;  1AIA A;  5EIG B;  1B9I A;  1CZC A;  1AMS A;  4M2J A;  3H9X A;  2CH1 A;  3G8M A;  4F4E A;  1W23 A;  1BJ4 A;  2FN6 A;  3E2F A;  1YIZ A;  3E9K A;  3FKD A;  1AKB A;  1M7Y A;  2CIN A;  3N4R A;  3PD6 B;  1DGE A;  1JS3 A;  1CL2 A;  2VMU A;  3Q8N A;  3E2Z A;  3MC6 C;  2X5D A;  1M32 A;  2VGS A;  1WKH A;  4IYO B;  2CH2 A;  2AY9 A;  2CB1 A;  4FL0 A;  3GR9 A;  5E5I A;  4ADE A;  3CAI A;  3R9A A;  3NUB A;  3TCM A;  3N75 A;  2CST A;  1AKC A;  7AAT A;  2Q7W A;  1UKJ A;  4E3Q A;  5G0A A;  1YOO A;  4WXB A;  3A2B A;  4GDY A;  4IW7 A;  2O7C A;  1AX4 A;  5EUE A;  3VAX A;  2HUU A;  5M46 A;  1OHY A;  1BJW A;  1Z3Z A;  3AAT A;  3ELP A;  3AEJ C;  1UU0 A;  2KFP A;  4F5K A;  1SZS A;  1AHX A;  5EAA A;  1M4N A;  2BI2 A;  2R5C B;  3FVX A;  1X29 A;  4WLJ A;  1ARH A;  4Q6R A;  2CTZ A;  5G2P A;  3UAK A;  3FZ8 A;  1S09 A;  4RJY A;  1JF9 A;  2G7J A;  1ASD A;  2VMV A;  1ZC9 A;  2YOB A;  3BWN C;  4PIW A;  1ECX A;  4WLH A;  1DFO A;  4LW2 A;  3EIB A;  1AJS A;  5AX8 A;  2AY7 A;  4E1O A;  4F5H A;  5HXX A;  1AIC A;  1AMA A;  1TOI A;  1B5P A;  2A1V A;  3FFR A;  3RQ1 A;  3MAU A;  1CQ8 A;  3DXW A;  4LNM A;  1DJ9 A;  2FM1 A;  3TAT A;  4UHM A;  4UHN A;  3LVK A;  2AY5 A;  2ZY4 A;  2C81 A;  2X8U A;  1CQ7 A;  1SZU A;  1O61 A;  1C7O A;  1LW5 A;  3CQ5 A;  1GEX A;  2HOR A;  4UOY A;  2W7K A;  3WY7 A;  3EI5 A;  3A9X A;  1D2F A;  3LVJ A;  4ZDP A;  1M0O A;  1IX7 A;  4F5L A;  5G4I A;  3W1J A;  1AHF A;  1WYU A;  3AEN A;  1YNU A;  2OGA A;  3CQ6 A;  3KE3 A;  1ASM A;  2EYQ A;  5M49 A;  2DGK A;  2Z61 A;  3LG0 A;  1TOG A;  2CFB A;  1I41 A;  1OXP A;  1WYV A;  1VEF A;  4EU1 A;  4ZAH A;  1IAY A;  4A0H A;  1QJ5 A;  4OBU A;  3I5T A;  3W1H A;  1G7W A;  2Z9V A;  2GMU A;  3JTX A;  2QA3 A;  5EUN A;  3JW9 A;  2DOU A;  3PDB A;  1LC5 A;  2CJD A;  3TQX A;  1I29 A;  3EUC A;  4P7Y A;  4UQV A;  4HF8 A;  2F8J A;  5HHY A;  4OCA A;  1ASG A;  2W8V A;  1AKA A;  3WX9 A;  1IX8 A;  2VGV A;  2EZ2 A;  4EB7 A;  1KL1 A;  1S07 A;  4WYC A;  3ZRQ A;  1ELQ A;  3WGC A;  1ASN A;  1M0Q A;  4W91 A;  2HP2 A;  3T32 A;  3ZRR A;  3HVY A;  1AMQ A;  1C0N A;  4JF1 A;  4NOG A;  4HVK A;  3ELE A;  3BV0 A;  3FZ7 A;  5E3K A;  1MAQ A;  4LC3 A;  1RV4 A;  3FFH A;  1MDX A;  2AY3 A;  1KMK A;  2ZUK A;  4ITG A;  2BWO A;  3JWA A;  2CY8 A;  2DKB A;  2PO3 A;  1SF2 A;  4PVF A;  3W1I A;  1UU1 A;  2BIG A;  4JEV A;  3G7Q A;  3QN6 A;  1MLY A;  3KGW A;  5M4B A;  3KGX A;  2YKV A;  3P6K A;  1IAX A;  4W8I A;  1GC3 A;  2YKY A;  3E6G A;  3MAF B;  1QIR A;  2BWP A;  4W1W A;  1AAW A;  3VK2 A;  4WYE A;  1DJU A;  1S08 A;  5DJ9 A;  2W8U A;  3GJU A;  4ZAS A;  4ZLV A;  4CBR A;  2VGZ A;  4WYF A;  1C7N A;  1G4V A;  3OP7 A;  4ZM3 A;  1BJO A;  1DKA A;  4R5Z A;  1SZK A;  2WB6 A;  3F6T A;  4GEB A;  4BA5 A;  1B4X A;  1TOE A;  1D7R A;  2Z9W A;  2VMR A;  4ZWV A;  1MDZ A;  1M0P A;  2GMS A;  3BWN A;  2W7E A;  3NU8 A;  1ASB A;  5EAV A;  4W1X A;  3VP6 A;  2FQ6 A;  3FQ8 A;  4H63 Q;  2OKK A;  3D6K A;  2JGT A;  1GDE A;  2VIA A;  1W7M A;  4MKK A;  1M6S A;  4BHD A;  1N31 A;  3ISL A;  2YHK A;  3JZL A;  5F9S A;  4BA4 A;  1CZE A;  2FNI A;  3EI9 A;  3FVU A;  3NNK A;  3P1T A;  1WKG A;  3OKS A;  2HOY A;  3LVM A;  5FT6 A;  1GC4 A;  3K28 A;  4IX8 A;  1MDO A;  1V2D A;  2BI5 A;  3HBX A;  3K40 A;  4RLG A;  2QSR A;  1PMM A;  4ADD A;  5C6U A;  2VMY A;  3H7F A;  1EJI A;  4R8D A;  3DRD A;  1XEY A;  4B9B A;  5KTB A;  1V2F A;  4GE4 A;  1GEY A;  4AO4 A;  5EQC A;  4A6R A;  4XAU A;  3PIU A;  3PAA A;  2HP1 A;  1QIT A;  5D5S A;  3MBB A;  4A0F A;  2Z1Z A;  1JS6 A;  3FCR A;  3PDX A;  4WBT A;  4M2M A;  2VGU A;  2GB3 A;  3F9T A;  4CXR A;  3PA9 A;  2BHX A;  4EMY A;  5JAY A;  3EIA A;  1ARG A;  2D63 A;  2FYF A;  3BWO A;  2XH1 A;  1KKJ A;  2E7I A;  4F5F A;  3BC8 A;  2W7I A;  4XJP A;  3QHX A;  2FNU A;  3FRK A;  4F5M A;  2W8W A;  3A9Z A;  3EZ1 A;  5F8V A;  3FQ7 A;  4R2N A;  2G6W A;  2W8J A;  1OHW A;  1W3U A;  1P3W A;  1T3I A;  2D7Y A;  4XK1 A;  2C7T A;  4RM1 A;  3RCH B;  3NYT A;  4ATP A;  2AY2 A;  1M0N A;  2HOZ A;  4OYT A;  4OT8 A;  4RKD A;  4WB0 A;  4WYG A;  2CAN A;  3DR7 A;  5J8Q A;  3G0T A;  2EH6 A;  1S0A A;  3BB8 A;  4KYO A;  2ZP7 A;  2BYL A;  2YCN A;  3GWP A;  1IUG A;  2VMP A;  3QGU A;  1GC2 A;  3NTJ A;  5K8B A;  3NYS A;  3LVL B;  1G4X A;  3ZZK A;  4ZWM A;  3HMU A;  4JEZ A;  4JEW A;  4A6U A;  1BT4 A;  1X0M A;  2W7F A;  1E5E A;  1G7X A;  2VGW A;  1BS0 A;  1X28 A;  9AAT A;  1CQ6 A;  2VLH A;  5EUD A;  4EFF A;  1S06 A;  2NMP A;  2TPL A;  1TPL A;  5D95 A;  4ATQ A;  3DU4 A;  4WD2 A;  1X2A A;  1WYT B;  2VMS A;  3DXV A;  3JWB A;  4ZDO A;  3B8X A;  2AY1 A;  3QI6 A;  2OKJ A;  2WKA A;  1B8G A;  4TMR A;  4IXO A;  1ARI A;  1H1C A;  2R5E A;  4OBV A;  4ZDL A;  2GQN A;  1N8P A;  5I92 A;  2JIS A;  1EQB A;  2XBN A;  1BQA A;  4O6Z A;  4Y0H A;  3WKS A;  4RAE A;  1SFF A;  2YKX A;  3AOW A;  3NX3 A;  3N4X A;  4N0W A;  1QZ9 A;  5IWQ A;  5EIG A;  2D65 A;  4MQR A;  2BWN A;  5EFS A;  3E2Z B;  3MEB A;  1IBJ A;  4MSO A;  3USF A;  2JJH A;  3NRA A;  1DJE A;  1U08 A;  1MGV A;  4BMK A;  3PD6 A;  5M4D A;  2JG2 A;  2AY6 A;  2D61 A;  3WCN A;  3LV2 A;  2YRI A;  3TFU A;  4IYO A;  4AH3 A;  1OAT A;  1W7L A;  1V72 A;  4AZJ A;  2Z9U A;  1I43 A;  1GC0 A;  2E54 A;  4A00 A;  3WGB A;  3FVS A;  2VMO A;  2EPJ A;  3MKJ A;  3DC1 A;  1N2T A;  3ACZ A;  2ZJG A;  1ASA A;  4GSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...