2FKJA

The crystal structure of engineered ospa
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
361
structure length
361
Chain Sequence
b'NSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer Surface Protein A
publication title Atomic structures of peptide self-assembly mimics.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags De novo protein
total genus 71
structure length 361
sequence length 361
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2fkjA01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2fkjA02
3.90.930.30 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2fkjA03
2HKDA 2OL7A 2FKJA 3CKFA 2OL8O 1P4PA 2I5VO 2OY1O 5B3MO 2G8CO 2OY8A 3AUMO 5B10O 2OY5O 1OSPO 1RJLC 2I5ZO 2FKGA 1FJ1E 3EC5A 2OY7A 5B2AO 2PI3O 2AF5A 5B11O 2OYBO 2OL6O 3CKGA
chains in the Genus database with same CATH superfamily
2MF6A 2X56A 3JS1A 4FGIB 2AT5X 3VGWA 3CCSE 3Q34A 3ZW1A 3OW2E 1HMSA 2A2GA 1GM6A 1ZNDA 4Y0PA 1SWBA 5IRWA 1RLBE 1HBPA 1AVGI 2RN4A 1NP4A 5EZ2A 4L3RA 3FA9A 2A5CA 4I9RA 2BC3A 1YIJE 1HY2A 1LPJA 4ZGFA 3UEXA 5H9KA 4WFBE 3WZPA 1SWHA 4HPBA 3APWA 4YCHA 1NQNA 2X46A 1IW2A 4PJ2A 4ZFXA 2OY1O 4GKCA 1EIIA 1VWEB 1ML7A 2WEXA 3WYPA 1MX8A 1E06A 2L68A 1O1VA 4IBAA 4WFNE 1L6MA 3UEUA 4Z2OA 2RD7C 3FLLA 1T0VA 4KT5A 2RTAA 2Q2PA 1VWNB 4ON1A 4YKMA 2R56A 3G6EE 2WEWA 2RTOB 4XMFA 1SLGB 4EXZA 3Q6LA 5DG4A 2W2BA 4I6SA 2A13A 4R0BA 2C1QA 4MVKA 3CCQE 1PBOA 3JQOA 1VYGA 2JU8A 1LIEA 2QMIA 1SY3A 2F73A 3CCUE 3MBTA 1YP6A 1VYOA 4ZHFA 3QQ2A 4ZH6A 1Y53X 1O8VA 2IZHB 3FEKA 5JVGE 1HBQA 1N9YA 3BX7A 2X45A 3HOEA 2WWPA 3PH5A 2CM9A 3D95A 4Y0QA 4UU3A 4CPHA 1SY1A 3LHNA 2ACOA 1K73G 2RTBB 4LKPA 4CPFA 3C78X 4FBRA 3RDXA 2BS6A 4CV7A 4WCEE 5B29A 3P6GA 4IAXA 3K3LA 2LB6A 4YBPA 4I3BA 4BX6A 3IFBA 1YI2E 1VWHB 3CCEE 3MG5A 1BWYA 4IB9A 5D48A 1JBHA 1KFFA 3O19A 1B56A 5KIDA 4YBUA 2IZDB 4YH0A 4AYHA 5HL7E 1A3YA 1KT5A 2FHNX 4CDDA 2RTQB 4BCSA 1ACDA 4A60A 1G5WA 3N91A 4QZUA 1G85A 5LKEA 4OS3A 4GNYA 4OKAA 1DC9A 3O22A 2MO5A 2MM3A 2JW1A 4O4SA 5LJCA 3CWKA 2QEXE 2OTJE 4NV7A 2WUTA 1ERBA 1LICA 4GZVA 3RY1A 4YKOA 1UYNX 1LDOA 4JNJA 2QCBA 2KW1A 2IZIA 3UEWA 2N93A 4HWMA 1GT5A 1JV4A 4Z6JA 1SWJA 5B11O 3SAOA 1JJXA 5H9AA 1ZNLA 1AB0A 1X8PA 4IB8A 5AEOA 4M6SA 1B0OA 5HA0A 1KT4A 4BX7B 4AZMA 1KOIA 1MDCA 5JD2A 2VFCA 1SLEB 3F6ZB 4I95A 3VPJE 4QYPA 4RUUA 2LFOA 3CBCA 1VWLB 2RTFB 4AW8A 4GDAA 1SWEA 1OEJA 3ELZA 2BHVA 2I5VO 4OMXA 1K9MG 3CCLE 1MUPA 1CJ5A 1VWOB 2FR2A 1NBXA 1AVDA 5DPQA 1VWMB 3PPTA 4O9SA 4A1HA 3BDRA 4NYRA 3RE5A 5AJBA 3D4RA 5K67A 4QYNA 1NDJA 4Z2PA 2IZEB 4I3DA 5JR8A 5LJGA 3C76X 4GETA 2BLGA 5HTEA 3NBXX 2OFMX 2WPUA 2DJGA 3FR4A 3PH6A 3CKFA 1VQ6E 5K06A 2FS6A 1X8NA 2UYWA 3WZQA 4RUNA 3AKNA 2IZGB 3HWEA 2E4JA 4NNTA 3WZNA 1I06A 3T6LA 4KC7A 2AT6X 5EPQA 4MVLA 1FEMA 4MVIA 4GD9A 2AT8X 5B5GA 4MISA 1QFVA 3S5XA 3UAQA 2AVIA 1PMPA 1RXJA 4IB7A 3KFGA 1RSTB 2Y3FA 3VG2A 3B2HA 1RXHA 1SXYA 2RCTA 2OY8A 3WJBA 1QWDA 4GU8A 5EEEA 1LIDA 2HZQA 3FR5A 5HWZA 2CM4A 4HPDA 4Z27A 2OFAA 5F7GA 5B27A 4YDAA 2GC9A 1DZJA 2K62A 1SWRA 1RBPA 3D97A 4XMCA 2JU7A 3D9WA 2QO4A 3IGEA 1HQQA 4K19A 3E3CA 1VWGB 2QM9A 2G79A 3ZW2A 2BS5A 1BBPA 4CDFA 3KZAA 4IMOA 1PEEA 4U8UN 4O3XB 4KC8A 4ORWA 1CRBA 3MM0A 3BY0A 3VHMA 1JYDA 2A3FX 1MVGA 1KQXA 1NP1A 1W2BE 4ARHA 5HZ5A 3KFIA 3APVA 1JMZA 1XCAA 4MVEA 3FELA 3I55E 5GADG 4IOCE 4OS0A 3NQKA 4Y0SA 1JMXA 1GKAA 2Z4IA 3VE2A 1YJNE 5LJKA 2RTKA 2IZLB 2DM5A 1Y55X 1LUQA 1Y9LA 3BSZE 2RTIB 1QY1A 3DLLE 2CAMA 1QVGE 2GTLO 1OEEA 4O3WA 1RXKA 1ADLA 3PQUA 4YCEA 1PM1X 1ICNA 3U03A 1VQOE 2JN3A 3NQ3A 1JIWI 2IZBA 4GDZA 4Z28A 2IZAA 3FW5A 1HMTA 3BLGA 2ASNX 2ANSA 1FTPA 5D4AA 3BS2A 2PY1A 2Q4NA 3RDMA 1VWRB 2A2UA 2C4IA 1EI5A 1VWCB 1LCVA 4U8UO 2Q2MA 1A57A 1JJ2E 1MOYA 2CZTA 3F9DA 3G71E 1CBQA 4GH7A 2P8GA 1SWTA 2OFRX 4WFUA 4N7DA 3OD9A 5FQ8E 2ZAGA 1NGLA 1A2DA 1EXSA 4Y5DA 3GE2A 4D6AA 3WJFA 3WJCA 1DF8A 2G5LA 1R0UA 1X8OA 4IAWA 5IRUA 3ZQ3A 3RWXA 3FW4A 4BX7A 4DQ3A 5LKFA 3NADA 1VYFA 1MK5A 1Y9TA 5HZ8A 2R73A 4XMHA 3P24A 1I78A 4CK4A 1GT3A 3C77X 2GTLM 5HBSA 1BLRA 3SZIA 3EM0A 1D2UA 4ID2A 3FIDA 4XMEA 5FENA 2X8TA 2POAA 4EKVA 4ALOA 1QQSA 4C5PA 1EQDA 4BBOA 4DCBA 3CC7E 1NC9A 1IFBA 3CC4E 1CBIA 1LDQA 5BVTA 1LFOA 5LJHA 5CHKA 2ALLX 3CMPA 1GKAB 2WQAE 1DF3A 2VFBA 3X00A 4ZR2A 4BVMA 3PK2A 4U8UM 1SWSA 5F6BA 1QG5A 2K23A 3RDQA 4BX5B 4NP1A 2VDFA 4DNEA 2MJIA 4GE1A 4B55A 4ORXA 3AKMA 3JSQA 4Y59A 3B2JA 2A8GA 2LA7A 4I60A 1BEBA 2FRSA 4Z2VA 1EALA 4GNWA 2RTCB 3NP1A 3TF6A 2BSZA 1BSYA 4COTA 1LIBA 1VWIB 2FKJA 4BOEA 4QRLA 2UZ2A 1X8QA 5GAHG 3T2XA 5H9NA 4IO9E 1W5RA 1YWAA 4WBKA 1SWAA 2FWVA 3V8UA 2RQ0A 2OL6O 5HTDA 1RAVA 3VG6A 4TLJA 1IFCA 2KT4B 2QO6A 2IZJA 3UEVA 1KL3A 1SWKA 1QABE 1SXWA 4JO6A 1SRJA 5MLCH 5L3YA 1KC8G 4NLIA 2HKDA 1IIUA 5GAEG 1P4PA 3F8AA 2IZKA 3HWFA 1VWQB 5KHPA 2R74A 3CR6A 4CDEA 1S72E 4CPEA 3HPEA 5EEDA 1OPAA 5AN9B 4N7CA 1FE3A 3ELXA 2X55A 4CSBA 5L8IA 5CYBA 2M4LA 4WHIA 4YGZA 3CPWE 1I9HA 5H8TA 1MM9A 5IO5A 2RTPB 1VWPB 1IJ8A 3FMZA 1X8UA 3SOTA 5AJCA 2DJFA 1TW4A 1NJIG 5K68A 1GT1A 1X71A 4YGGA 4ORYA 1AVEA 2Y3EA 3EBKA 2AF5A 1LF7A 2FGSA 3VG5A 3CCME 4IMNA 2G78A 2OF8A 1H91A 4ES7A 3NX2A 3QKGA 1N8RG 2FLJA 4O4XA 1SRFA 1OEKA 1HQPA 1K24A 2QO5A 3RE6A 1SLDB 4AZOA 1O1UA 3NQ9A 1HXLA 3TGCA 5FFHA 1GT4A 1KGLA 2MWHA 1G74A 2ZSCA 4OEMA 2IZFB 1S7DA 2BT9A 3VE1A 4U46A 2AT3X 2HMBA 2CQLA 1HN2A 2HNXA 1W4TA 1YITE 4DQ4A 1LIFA 3P02A 5H9LA 4YFQA 1WUBA 2OVSA 4BJ8A 5F6ZA 1YP7A 4AZPA 4GRJA 1CBSA 3FIQA 2W2AA 1TVQA 1VWDB 4QGWA 5LJEA 1VWJB 5DM7E 2JOZA 2CBRA 1OSPO 2GTLN 2NP1A 5LJDA 1PBYA 1YJ9E 2PI3O 4QNIA 1VQKE 3FYFA 4U67E 3OBLA 3VHHA 3CKGA 4MIRA 2CBSA 2Y32A 4GGTA 2OTLE 1P6PA 4IRWA 5IO6A 1E02A 3EC5A 3FA8A 4KCAA 4FQBB 4Y0RA 1JZUA 3T1DA 1SMPI 1KT6A 4QGXA 3EMMA 3SLJA 5CSEA 3CCRE 1JJJA 1KQSE 4TKHA 1KL5A 5IO7A 1D3SA 4GK9A 2OY7A 5L8NA 3FR2A 1Q7YG 3ZW0B 1ERXA 1KL4A 1TXLA 1N0SA 1N9MA 2RTHB 4OS8A 1LCWA 2L9CA 5HZ6A 2ZAIA 1YWCA 4ALBA 2A0AA 4D6BA 4ORUA 1Q81G 1FJ1E 1QFTA 4MEEA 1NQMA 3P6HA 3CQNA 3DSZA 4FBOA 5HZ9A 3OE3A 2YG2A 5CE4A 5F58A 1EW3A 1SWGA 1SWCA 3AUMO 3H3IA 1JYJA 1MX7A 1SWUA 1U17A 1VWKB 1VQ5E 1VQLE 2OFBA 2OVDA 3AEHA 5JVHE 2WQ9A 4BX5A 1ALBA 3B2KA 4QQ1A 2CZUA 1LCZA 4TJZA 1WBIA 1GX8A 2JMBA 1SWQA 3WBGA 5AQ6A 2X8SA 2HLVA 3BU9A 4NLJA 4TKJA 3ZUIA 1DZKA 4O3YA 3I17A 3WZOA 4I9SA 2RTJA 4A1YA 1STPA 1OBUA 1AELA 4EFGA 1BSQA 4CDCA 2L67A 1N7YA 2EU7X 3WXQA 4KIIA 1Z24A 1K3BA 1SA8A 4YFRA 3VG7A 1M90G 4AZRA 3CCJE 4OELA 4ORRA 1HMRA 5FQ7E 3EBWA 1BRPA 2OVEA 3RDSA 2OL7A 4ML7B 3RSWA 3RKGA 1U18A 3ZUOA 4LKTA 4LZUA 1IKJA 3APUA 2I5ZO 3BRNA 2AH7X 4BQUA 5B2AO 1ZNEA 4TKBA 3FEPA 4TNNA 1SWFA 4QGVA 4HPAA 4HPCA 3SLTA 4XMGA 5L8OA 1YWBA 3CMEE 4FBVA 1OBPA 3D96A 1B4MA 1KZWA 3PIOE 1GX3A 2AL0X 1OPBA 2RTGB 1I04A 1JJUA 1QVFE 5B3MO 2G8CO 1S44A 3CXCE 5HCCC 2F01A 2C1SA 5HA1A 1LELA 2RA6A 4ZHGA 3S26A 1M1KG 1VQNE 4IB6A 3RZYA 2QOMA 3U0DA 1GGLA 1LNMA 4LQZA 4NYQA 4O4UA 3APXA 4ZJ0A 4ODDA 5IRAA 3O2YA 1EPBA 1ZNGA 4INNA 1T68X 3WOVA 5D45A 2X32A 4YFPA 1YWDA 3I0AA 1YUPA 4L1NA 3STKA 3EYCA 5D47A 1QY0A 3CCVE 4LZVA 1SRIA 3HWDA 3CD6E 1FELA 1SLFB 2WR6A 1VPRA 1SWPA 2IZCB 4ZGUA 2G7BA 4GJSA 1E00A 1Q86G 3FDCA 1BRQA 3VHIA 1AQBA 5FAZA 2LBVA 3TGAA 1BJ7A 2AMMX 5F1EA 3P6CA 2RTLA 1IKEA 1VQPE 2KTDA 2FKGA 1YHQE 3EW1A 2AT0X 5DM6E 1VWBB 1BSOA 1N4JA 2RTNB 2OL8O 2NNDA 1SXUA 3PEDA 1DFVA 5H1SI 1KD1G 2HYSA 2RCQA 3CQRA 3ZW1B 4GGZA 4O49A 3KFFA 3SZHA 4AZNA 5HAEA 1SY2A 3TGBA 1KT7A 1UYOX 3G4SE 4YVBA 3T2WA 1ZNHA 1MEPA 3VG4A 2X4MA 4QAEA 5HCEC 3IA8A 1PTSA 1TOWA 1GXAA 4U3QA 1U0XA 5B10O 1ZNKA 2OY5O 3HTYA 3RY2A 1Y0GA 2KTSA 5BYPA 4NNSA 3BX8A 1SRGA 1KQWA 4YDBA 5EDCA 4EQAC 1FDQA 3CF5E 4ZHCA 3MX7A 1S2PA 1SWOA 2KD2A 5IXGA 1EUOA 1I4UA 1VQ7E 3T6FA 1SWNA 1TOUA 3B2IA 1YIVA 3ZW0A 2OF9A 4NW4A 3EW2A 3B2LA 1VQME 3PIPE 3FA6A 1SWDA 3KFHA 2L5PA 1SREA 4TQ2A 4CPIA 1K8AG 2GTFX 5C0NA 1FENA 1LKEA 2FR3A 5KICA 5LJBA 3I56E 3CC2E 1EPAA 4ORSA 3MVFA 1VQ4E 4YGHA 3PECA 3HWGA 2ZJPE 4AZQA 2MHDA 1DZPA 4UY8G 2RTRB 3RDUA 4O3ZA 2X34A 2RTMA 3FA7A 1W6FA 1QY2A 4M7MA 2GJ5A 1KXOA 3LV4A 4UU2A 4EEJA 1SRHA 1X89A 3J7ZG 1SXXA 3G7XA 3WJDA 3HK1A 1E2TA 4IABA 4U9CA 1Y52X 3RBYA 2A5BA 2IFBA 4GUZA 1I05A 1JQPA 4CPHB 2JU3A 2ZJRE 2W2FA 3VG3A 3STMX 4WFVA 3BU1A 4IOAE 1BM5A 1E5PA 2JGSA 1G7NA 4GJVA 1EIOA 3DTQA 2RTEB 1UZ2X 4BX6B 2QOSC 4WF9E 1XKIA 1UREA 3ZZVA 3VU1A 4GGRA 3P6EA 1STRB 2XSTA 3IG9A 3P6DA 1CBRA 2Q9SA 2FS7A 4JHQA 1RL6A 3U9PC 2RTDB 5BVQA 4PSQA 3CBSA 1KT3A 1T8VA 3WJGA 5B5FA 3KQ0A 3SLOA 2Q39A 2WSJA 3NX1A 1B8EA 3NR3A 3LTWA 2NNQA 1VQ8E 3GAQA 3P6FA 5HCDC 3CMAE 3HOLA 1SWLA 3NPOA 2Z4HA 5EDBA 1A18A 4YMYA 3RDOA 2OZQA 3WYQA 1ICMA 3WJEA 1GX9A 5D8JA 2XKLA 1RSUB 2FTBA 3PQSA 3PDFA 2AKQA 3TZSA 1HXZA 2OVAA 2NNEA 1KZXA 1N43A 1DZMA 5F2BA 1SY0A 1ZRYA 4KH8A 3ZI8A 2LBAA 1YJWE 5HZQA 2FT9A 3ZWEA 1OBQA 2FHLA 2F09A 2GH7A 2X8FA 3WVMA 4JGLA 4BGFA 4ZHDA 3OJYC 4XMDA 5FQ6E 2ACPX 1VWAB 3SZJA 1RJLC 2LKKA 4A8ZA 3S60A 1VWFB 5BVSA 4ZHHA 3PP6A 2QA4E 1VQ9E 1DV9A 4HFOA 3KVNA 1Q82G 4I3CA 3S5VA 1STSB 2O62A 4EDEA 3STNA 4QZTA 3L4RA 4ZH9A 2HZRA 4ZCBA 4NV8A 2YMSA 3FENA 4O4OA 2ZJQE 5GAGG 4WFAE 4OMWA 2OYBO
chains in the Genus database with same CATH topology
2HKDA 2OL7A 2FKJA 3IGEA 3CKFA 2OL8O 1P4PA 2I5VO 2OY1O 5B3MO 2G8CO 2OY8A 3AUMO 5B10O 2OY5O 1OSPO 1RJLC 2I5ZO 2FKGA 1FJ1E 3EC5A 2OY7A 5B2AO 2PI3O 2AF5A 5B11O 2OYBO 2OL6O 3CKGA 3IG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKD A;  2OL7 A;  2FKJ A;  3CKF A;  2OL8 O;  1P4P A;  2I5V O;  2OY1 O;  5B3M O;  2G8C O;  2OY8 A;  3AUM O;  5B10 O;  2OY5 O;  1OSP O;  1RJL C;  2I5Z O;  2FKG A;  1FJ1 E;  3EC5 A;  2OY7 A;  5B2A O;  2PI3 O;  2AF5 A;  5B11 O;  2OYB O;  2OL6 O;  3CKG A; 
#chains in the Genus database with same CATH topology
 2MF6 A;  2X56 A;  3JS1 A;  4FGI B;  2AT5 X;  3VGW A;  3CCS E;  3Q34 A;  3ZW1 A;  3OW2 E;  1HMS A;  2A2G A;  1GM6 A;  1ZND A;  4Y0P A;  1SWB A;  5IRW A;  1RLB E;  1HBP A;  1AVG I;  2RN4 A;  1NP4 A;  5EZ2 A;  4L3R A;  3FA9 A;  2A5C A;  4I9R A;  2BC3 A;  1YIJ E;  1HY2 A;  1LPJ A;  4ZGF A;  3UEX A;  5H9K A;  4WFB E;  3WZP A;  1SWH A;  4HPB A;  3APW A;  4YCH A;  1NQN A;  2X46 A;  1IW2 A;  4PJ2 A;  4ZFX A;  2OY1 O;  4GKC A;  1EII A;  1VWE B;  1ML7 A;  2WEX A;  3WYP A;  1MX8 A;  1E06 A;  2L68 A;  1O1V A;  4IBA A;  4WFN E;  1L6M A;  3UEU A;  4Z2O A;  2RD7 C;  3FLL A;  1T0V A;  4KT5 A;  2RTA A;  2Q2P A;  1VWN B;  4ON1 A;  4YKM A;  2R56 A;  3G6E E;  2WEW A;  2RTO B;  4XMF A;  1SLG B;  4EXZ A;  3Q6L A;  5DG4 A;  2W2B A;  4I6S A;  2A13 A;  4R0B A;  2C1Q A;  4MVK A;  3CCQ E;  1PBO A;  3JQO A;  1VYG A;  2JU8 A;  1LIE A;  2QMI A;  1SY3 A;  2F73 A;  3CCU E;  3MBT A;  1YP6 A;  1VYO A;  4ZHF A;  3QQ2 A;  4ZH6 A;  1Y53 X;  1O8V A;  2IZH B;  3FEK A;  5JVG E;  1HBQ A;  1N9Y A;  3BX7 A;  2X45 A;  3HOE A;  2WWP A;  3PH5 A;  2CM9 A;  3D95 A;  4Y0Q A;  4UU3 A;  4CPH A;  1SY1 A;  3LHN A;  2ACO A;  1K73 G;  2RTB B;  4LKP A;  4CPF A;  3C78 X;  4FBR A;  3RDX A;  2BS6 A;  4CV7 A;  4WCE E;  5B29 A;  3P6G A;  4IAX A;  3K3L A;  2LB6 A;  4YBP A;  4I3B A;  4BX6 A;  3IFB A;  1YI2 E;  1VWH B;  3CCE E;  3MG5 A;  1BWY A;  4IB9 A;  5D48 A;  1JBH A;  1KFF A;  3O19 A;  1B56 A;  5KID A;  4YBU A;  2IZD B;  4YH0 A;  4AYH A;  5HL7 E;  1A3Y A;  1KT5 A;  2FHN X;  4CDD A;  2RTQ B;  4BCS A;  1ACD A;  4A60 A;  1G5W A;  3N91 A;  4QZU A;  1G85 A;  5LKE A;  4OS3 A;  4GNY A;  4OKA A;  1DC9 A;  3O22 A;  2MO5 A;  2MM3 A;  2JW1 A;  4O4S A;  5LJC A;  3CWK A;  2QEX E;  2OTJ E;  4NV7 A;  2WUT A;  1ERB A;  1LIC A;  4GZV A;  3RY1 A;  4YKO A;  1UYN X;  1LDO A;  4JNJ A;  2QCB A;  2KW1 A;  2IZI A;  3UEW A;  2N93 A;  4HWM A;  1GT5 A;  1JV4 A;  4Z6J A;  1SWJ A;  5B11 O;  3SAO A;  1JJX A;  5H9A A;  1ZNL A;  1AB0 A;  1X8P A;  4IB8 A;  5AEO A;  4M6S A;  1B0O A;  5HA0 A;  1KT4 A;  4BX7 B;  4AZM A;  1KOI A;  1MDC A;  5JD2 A;  2VFC A;  1SLE B;  3F6Z B;  4I95 A;  3VPJ E;  4QYP A;  4RUU A;  2LFO A;  3CBC A;  1VWL B;  2RTF B;  4AW8 A;  4GDA A;  1SWE A;  1OEJ A;  3ELZ A;  2BHV A;  2I5V O;  4OMX A;  1K9M G;  3CCL E;  1MUP A;  1CJ5 A;  1VWO B;  2FR2 A;  1NBX A;  1AVD A;  5DPQ A;  1VWM B;  3PPT A;  4O9S A;  4A1H A;  3BDR A;  4NYR A;  3RE5 A;  5AJB A;  3D4R A;  5K67 A;  4QYN A;  1NDJ A;  4Z2P A;  2IZE B;  4I3D A;  5JR8 A;  5LJG A;  3C76 X;  4GET A;  2BLG A;  5HTE A;  3NBX X;  2OFM X;  2WPU A;  2DJG A;  3FR4 A;  3PH6 A;  3CKF A;  1VQ6 E;  5K06 A;  2FS6 A;  1X8N A;  2UYW A;  3WZQ A;  4RUN A;  3AKN A;  2IZG B;  3HWE A;  2E4J A;  4NNT A;  3WZN A;  1I06 A;  3T6L A;  4KC7 A;  2AT6 X;  5EPQ A;  4MVL A;  1FEM A;  4MVI A;  4GD9 A;  2AT8 X;  5B5G A;  4MIS A;  1QFV A;  3S5X A;  3UAQ A;  2AVI A;  1PMP A;  1RXJ A;  4IB7 A;  3KFG A;  1RST B;  2Y3F A;  3VG2 A;  3B2H A;  1RXH A;  1SXY A;  2RCT A;  2OY8 A;  3WJB A;  1QWD A;  4GU8 A;  5EEE A;  1LID A;  2HZQ A;  3FR5 A;  5HWZ A;  2CM4 A;  4HPD A;  4Z27 A;  2OFA A;  5F7G A;  5B27 A;  4YDA A;  2GC9 A;  1DZJ A;  2K62 A;  1SWR A;  1RBP A;  3D97 A;  4XMC A;  2JU7 A;  3D9W A;  2QO4 A;  3IGE A;  1HQQ A;  4K19 A;  3E3C A;  1VWG B;  2QM9 A;  2G79 A;  3ZW2 A;  2BS5 A;  1BBP A;  4CDF A;  3KZA A;  4IMO A;  1PEE A;  4U8U N;  4O3X B;  4KC8 A;  4ORW A;  1CRB A;  3MM0 A;  3BY0 A;  3VHM A;  1JYD A;  2A3F X;  1MVG A;  1KQX A;  1NP1 A;  1W2B E;  4ARH A;  5HZ5 A;  3KFI A;  3APV A;  1JMZ A;  1XCA A;  4MVE A;  3FEL A;  3I55 E;  5GAD G;  4IOC E;  4OS0 A;  3NQK A;  4Y0S A;  1JMX A;  1GKA A;  2Z4I A;  3VE2 A;  1YJN E;  5LJK A;  2RTK A;  2IZL B;  2DM5 A;  1Y55 X;  1LUQ A;  1Y9L A;  3BSZ E;  2RTI B;  1QY1 A;  3DLL E;  2CAM A;  1QVG E;  2GTL O;  1OEE A;  4O3W A;  1RXK A;  1ADL A;  3PQU A;  4YCE A;  1PM1 X;  1ICN A;  3U03 A;  1VQO E;  2JN3 A;  3NQ3 A;  1JIW I;  2IZB A;  4GDZ A;  4Z28 A;  2IZA A;  3FW5 A;  1HMT A;  3BLG A;  2ASN X;  2ANS A;  1FTP A;  5D4A A;  3BS2 A;  2PY1 A;  2Q4N A;  3RDM A;  1VWR B;  2A2U A;  2C4I A;  1EI5 A;  1VWC B;  1LCV A;  4U8U O;  2Q2M A;  1A57 A;  1JJ2 E;  1MOY A;  2CZT A;  3F9D A;  3G71 E;  1CBQ A;  4GH7 A;  2P8G A;  1SWT A;  2OFR X;  4WFU A;  4N7D A;  3OD9 A;  5FQ8 E;  2ZAG A;  1NGL A;  1A2D A;  1EXS A;  4Y5D A;  3GE2 A;  4D6A A;  3WJF A;  3WJC A;  1DF8 A;  2G5L A;  1R0U A;  1X8O A;  4IAW A;  5IRU A;  3ZQ3 A;  3RWX A;  3FW4 A;  4BX7 A;  4DQ3 A;  5LKF A;  3NAD A;  1VYF A;  1MK5 A;  1Y9T A;  5HZ8 A;  2R73 A;  4XMH A;  3P24 A;  1I78 A;  4CK4 A;  1GT3 A;  3C77 X;  2GTL M;  5HBS A;  1BLR A;  3SZI A;  3EM0 A;  1D2U A;  4ID2 A;  3FID A;  4XME A;  5FEN A;  2X8T A;  2POA A;  4EKV A;  4ALO A;  1QQS A;  4C5P A;  1EQD A;  4BBO A;  4DCB A;  3CC7 E;  1NC9 A;  1IFB A;  3CC4 E;  1CBI A;  1LDQ A;  5BVT A;  1LFO A;  5LJH A;  5CHK A;  2ALL X;  3CMP A;  1GKA B;  2WQA E;  1DF3 A;  2VFB A;  3X00 A;  4ZR2 A;  4BVM A;  3PK2 A;  4U8U M;  1SWS A;  5F6B A;  1QG5 A;  2K23 A;  3RDQ A;  4BX5 B;  4NP1 A;  2VDF A;  4DNE A;  2MJI A;  4GE1 A;  4B55 A;  4ORX A;  3AKM A;  3JSQ A;  4Y59 A;  3B2J A;  2A8G A;  2LA7 A;  4I60 A;  1BEB A;  2FRS A;  4Z2V A;  1EAL A;  4GNW A;  2RTC B;  3NP1 A;  3TF6 A;  2BSZ A;  1BSY A;  4COT A;  1LIB A;  1VWI B;  2FKJ A;  4BOE A;  4QRL A;  2UZ2 A;  1X8Q A;  5GAH G;  3T2X A;  5H9N A;  4IO9 E;  1W5R A;  1YWA A;  4WBK A;  1SWA A;  2FWV A;  3V8U A;  2RQ0 A;  2OL6 O;  5HTD A;  1RAV A;  3VG6 A;  4TLJ A;  1IFC A;  2KT4 B;  2QO6 A;  2IZJ A;  3UEV A;  1KL3 A;  1SWK A;  1QAB E;  1SXW A;  4JO6 A;  1SRJ A;  5MLC H;  5L3Y A;  1KC8 G;  4NLI A;  2HKD A;  1IIU A;  5GAE G;  1P4P A;  3F8A A;  2IZK A;  3HWF A;  1VWQ B;  5KHP A;  2R74 A;  3CR6 A;  4CDE A;  1S72 E;  4CPE A;  3HPE A;  5EED A;  1OPA A;  5AN9 B;  4N7C A;  1FE3 A;  3ELX A;  2X55 A;  4CSB A;  5L8I A;  5CYB A;  2M4L A;  4WHI A;  4YGZ A;  3CPW E;  1I9H A;  5H8T A;  1MM9 A;  5IO5 A;  2RTP B;  1VWP B;  1IJ8 A;  3FMZ A;  1X8U A;  3SOT A;  5AJC A;  2DJF A;  1TW4 A;  1NJI G;  5K68 A;  1GT1 A;  1X71 A;  4YGG A;  4ORY A;  1AVE A;  2Y3E A;  3EBK A;  2AF5 A;  1LF7 A;  2FGS A;  3VG5 A;  3CCM E;  4IMN A;  2G78 A;  2OF8 A;  1H91 A;  4ES7 A;  3NX2 A;  3QKG A;  1N8R G;  2FLJ A;  4O4X A;  1SRF A;  1OEK A;  1HQP A;  1K24 A;  2QO5 A;  3RE6 A;  1SLD B;  4AZO A;  1O1U A;  3NQ9 A;  1HXL A;  3TGC A;  5FFH A;  1GT4 A;  1KGL A;  2MWH A;  1G74 A;  2ZSC A;  4OEM A;  2IZF B;  1S7D A;  2BT9 A;  3VE1 A;  4U46 A;  2AT3 X;  2HMB A;  2CQL A;  1HN2 A;  2HNX A;  1W4T A;  1YIT E;  4DQ4 A;  1LIF A;  3P02 A;  5H9L A;  4YFQ A;  1WUB A;  2OVS A;  4BJ8 A;  5F6Z A;  1YP7 A;  4AZP A;  4GRJ A;  1CBS A;  3FIQ A;  2W2A A;  1TVQ A;  1VWD B;  4QGW A;  5LJE A;  1VWJ B;  5DM7 E;  2JOZ A;  2CBR A;  1OSP O;  2GTL N;  2NP1 A;  5LJD A;  1PBY A;  1YJ9 E;  2PI3 O;  4QNI A;  1VQK E;  3FYF A;  4U67 E;  3OBL A;  3VHH A;  3CKG A;  4MIR A;  2CBS A;  2Y32 A;  4GGT A;  2OTL E;  1P6P A;  4IRW A;  5IO6 A;  1E02 A;  3EC5 A;  3FA8 A;  4KCA A;  4FQB B;  4Y0R A;  1JZU A;  3T1D A;  1SMP I;  1KT6 A;  4QGX A;  3EMM A;  3SLJ A;  5CSE A;  3CCR E;  1JJJ A;  1KQS E;  4TKH A;  1KL5 A;  5IO7 A;  1D3S A;  4GK9 A;  2OY7 A;  5L8N A;  3FR2 A;  1Q7Y G;  3ZW0 B;  1ERX A;  1KL4 A;  1TXL A;  1N0S A;  1N9M A;  2RTH B;  4OS8 A;  1LCW A;  2L9C A;  5HZ6 A;  2ZAI A;  1YWC A;  4ALB A;  2A0A A;  4D6B A;  4ORU A;  1Q81 G;  1FJ1 E;  1QFT A;  4MEE A;  1NQM A;  3P6H A;  3CQN A;  3DSZ A;  4FBO A;  5HZ9 A;  3OE3 A;  2YG2 A;  5CE4 A;  5F58 A;  1EW3 A;  1SWG A;  1SWC A;  3AUM O;  3H3I A;  1JYJ A;  1MX7 A;  1SWU A;  1U17 A;  1VWK B;  1VQ5 E;  1VQL E;  2OFB A;  2OVD A;  3AEH A;  5JVH E;  2WQ9 A;  4BX5 A;  1ALB A;  3B2K A;  4QQ1 A;  2CZU A;  1LCZ A;  4TJZ A;  1WBI A;  1GX8 A;  2JMB A;  1SWQ A;  3WBG A;  5AQ6 A;  2X8S A;  2HLV A;  3BU9 A;  4NLJ A;  4TKJ A;  3ZUI A;  1DZK A;  4O3Y A;  3I17 A;  3WZO A;  4I9S A;  2RTJ A;  4A1Y A;  1STP A;  1OBU A;  1AEL A;  4EFG A;  1BSQ A;  4CDC A;  2L67 A;  1N7Y A;  2EU7 X;  3WXQ A;  4KII A;  1Z24 A;  1K3B A;  1SA8 A;  4YFR A;  3VG7 A;  1M90 G;  4AZR A;  3CCJ E;  4OEL A;  4ORR A;  1HMR A;  5FQ7 E;  3EBW A;  1BRP A;  2OVE A;  3RDS A;  2OL7 A;  4ML7 B;  3RSW A;  3RKG A;  1U18 A;  3ZUO A;  4LKT A;  4LZU A;  1IKJ A;  3APU A;  2I5Z O;  3BRN A;  2AH7 X;  4BQU A;  5B2A O;  1ZNE A;  4TKB A;  3FEP A;  4TNN A;  1SWF A;  4QGV A;  4HPA A;  4HPC A;  3SLT A;  4XMG A;  5L8O A;  1YWB A;  3CME E;  4FBV A;  1OBP A;  3D96 A;  1B4M A;  1KZW A;  3PIO E;  1GX3 A;  2AL0 X;  1OPB A;  2RTG B;  1I04 A;  1JJU A;  1QVF E;  5B3M O;  2G8C O;  1S44 A;  3CXC E;  5HCC C;  2F01 A;  2C1S A;  5HA1 A;  1LEL A;  2RA6 A;  4ZHG A;  3S26 A;  1M1K G;  1VQN E;  4IB6 A;  3RZY A;  2QOM A;  3U0D A;  1GGL A;  1LNM A;  4LQZ A;  4NYQ A;  4O4U A;  3APX A;  4ZJ0 A;  4ODD A;  5IRA A;  3O2Y A;  1EPB A;  1ZNG A;  4INN A;  1T68 X;  3WOV A;  5D45 A;  2X32 A;  4YFP A;  1YWD A;  3I0A A;  1YUP A;  4L1N A;  3STK A;  3EYC A;  5D47 A;  1QY0 A;  3CCV E;  4LZV A;  1SRI A;  3HWD A;  3CD6 E;  1FEL A;  1SLF B;  2WR6 A;  1VPR A;  1SWP A;  2IZC B;  4ZGU A;  2G7B A;  4GJS A;  1E00 A;  1Q86 G;  3FDC A;  1BRQ A;  3VHI A;  1AQB A;  5FAZ A;  2LBV A;  3TGA A;  1BJ7 A;  2AMM X;  5F1E A;  3P6C A;  2RTL A;  1IKE A;  1VQP E;  2KTD A;  2FKG A;  1YHQ E;  3EW1 A;  2AT0 X;  5DM6 E;  1VWB B;  1BSO A;  1N4J A;  2RTN B;  2OL8 O;  2NND A;  1SXU A;  3PED A;  1DFV A;  5H1S I;  1KD1 G;  2HYS A;  2RCQ A;  3CQR A;  3ZW1 B;  4GGZ A;  4O49 A;  3KFF A;  3SZH A;  4AZN A;  5HAE A;  1SY2 A;  3TGB A;  1KT7 A;  1UYO X;  3G4S E;  4YVB A;  3T2W A;  1ZNH A;  1MEP A;  3VG4 A;  2X4M A;  4QAE A;  5HCE C;  3IA8 A;  1PTS A;  1TOW A;  1GXA A;  4U3Q A;  1U0X A;  5B10 O;  1ZNK A;  2OY5 O;  3HTY A;  3RY2 A;  1Y0G A;  2KTS A;  5BYP A;  4NNS A;  3BX8 A;  1SRG A;  1KQW A;  4YDB A;  5EDC A;  4EQA C;  1FDQ A;  3CF5 E;  4ZHC A;  3MX7 A;  1S2P A;  1SWO A;  2KD2 A;  5IXG A;  1EUO A;  1I4U A;  1VQ7 E;  3T6F A;  1SWN A;  1TOU A;  3B2I A;  1YIV A;  3ZW0 A;  2OF9 A;  4NW4 A;  3EW2 A;  3B2L A;  1VQM E;  3PIP E;  3FA6 A;  1SWD A;  3KFH A;  2L5P A;  1SRE A;  4TQ2 A;  4CPI A;  1K8A G;  2GTF X;  5C0N A;  1FEN A;  1LKE A;  2FR3 A;  5KIC A;  5LJB A;  3I56 E;  3CC2 E;  1EPA A;  4ORS A;  3MVF A;  1VQ4 E;  4YGH A;  3PEC A;  3HWG A;  2ZJP E;  4AZQ A;  2MHD A;  1DZP A;  4UY8 G;  2RTR B;  3RDU A;  4O3Z A;  2X34 A;  2RTM A;  3FA7 A;  1W6F A;  1QY2 A;  4M7M A;  2GJ5 A;  1KXO A;  3LV4 A;  4UU2 A;  4EEJ A;  1SRH A;  1X89 A;  3J7Z G;  1SXX A;  3G7X A;  3WJD A;  3HK1 A;  1E2T A;  4IAB A;  4U9C A;  1Y52 X;  3RBY A;  2A5B A;  2IFB A;  4GUZ A;  1I05 A;  1JQP A;  4CPH B;  2JU3 A;  2ZJR E;  2W2F A;  3VG3 A;  3STM X;  4WFV A;  3BU1 A;  4IOA E;  1BM5 A;  1E5P A;  2JGS A;  1G7N A;  4GJV A;  1EIO A;  3DTQ A;  2RTE B;  1UZ2 X;  4BX6 B;  2QOS C;  4WF9 E;  1XKI A;  1URE A;  3ZZV A;  3VU1 A;  4GGR A;  3P6E A;  1STR B;  2XST A;  3IG9 A;  3P6D A;  1CBR A;  2Q9S A;  2FS7 A;  4JHQ A;  1RL6 A;  3U9P C;  2RTD B;  5BVQ A;  4PSQ A;  3CBS A;  1KT3 A;  1T8V A;  3WJG A;  5B5F A;  3KQ0 A;  3SLO A;  2Q39 A;  2WSJ A;  3NX1 A;  1B8E A;  3NR3 A;  3LTW A;  2NNQ A;  1VQ8 E;  3GAQ A;  3P6F A;  5HCD C;  3CMA E;  3HOL A;  1SWL A;  3NPO A;  2Z4H A;  5EDB A;  1A18 A;  4YMY A;  3RDO A;  2OZQ A;  3WYQ A;  1ICM A;  3WJE A;  1GX9 A;  5D8J A;  2XKL A;  1RSU B;  2FTB A;  3PQS A;  3PDF A;  2AKQ A;  3TZS A;  1HXZ A;  2OVA A;  2NNE A;  1KZX A;  1N43 A;  1DZM A;  5F2B A;  1SY0 A;  1ZRY A;  4KH8 A;  3ZI8 A;  2LBA A;  1YJW E;  5HZQ A;  2FT9 A;  3ZWE A;  1OBQ A;  2FHL A;  2F09 A;  2GH7 A;  2X8F A;  3WVM A;  4JGL A;  4BGF A;  4ZHD A;  3OJY C;  4XMD A;  5FQ6 E;  2ACP X;  1VWA B;  3SZJ A;  1RJL C;  2LKK A;  4A8Z A;  3S60 A;  1VWF B;  5BVS A;  4ZHH A;  3PP6 A;  2QA4 E;  1VQ9 E;  1DV9 A;  4HFO A;  3KVN A;  1Q82 G;  4I3C A;  3S5V A;  1STS B;  2O62 A;  4EDE A;  3STN A;  4QZT A;  3L4R A;  4ZH9 A;  2HZR A;  4ZCB A;  4NV8 A;  2YMS A;  3FEN A;  4O4O A;  2ZJQ E;  5GAG G;  4WFA E;  4OMW A;  2OYB O; 
#chains in the Genus database with same CATH homology
 2HKD A;  2OL7 A;  2FKJ A;  3IGE A;  3CKF A;  2OL8 O;  1P4P A;  2I5V O;  2OY1 O;  5B3M O;  2G8C O;  2OY8 A;  3AUM O;  5B10 O;  2OY5 O;  1OSP O;  1RJL C;  2I5Z O;  2FKG A;  1FJ1 E;  3EC5 A;  2OY7 A;  5B2A O;  2PI3 O;  2AF5 A;  5B11 O;  2OYB O;  2OL6 O;  3CKG A;  3IG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...