2FKLA

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain (residues 126- 189 of app)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
b'ALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein precursor
publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 14
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12924 APP_Cu_bd Copper-binding of amyloid precursor, CuBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fklA00
2FK3A 2M05A 2FK1A 2FKLA 1OWTA 2FMAA 3KTMA 2FJZA 4PWQA 2FK2A
chains in the Genus database with same CATH superfamily
2V4QA 1RJRA 4J9KA 5FLMG 1S03G 2V5AA 5KG0A 2FE3A 2PN1A 4O2BF 2V4RA 1SFOA 1GSOA 5KFUA 2HHHH 4RUAA 3Q8RB 3NGDA 3N6XA 3CQZA 1BXRA 3RV3A 4FS2A 1T3NA 4BWSC 4O3NA 4A3IG 4LF8H 4RB1A 1Y1VG 4FU0A 3WNZA 1XNQH 3PN1A 1AN7A 2W71A 2HJWA 3G8CA 4F50A 3OUZA 3RB0A 3GTPA 2BQRA 4YR2A 3R5FA 4EGJA 1RJPA 2GPSA 1E4EA 4DR1H 3I4NG 5DQHA 2B63A 4QIWE 2FB9A 3TQTA 5KT2A 4EBDA 5DG9A 4Q43A 2VPSA 2DPJA 5K2MA 1N48A 5KFBA 2VA3A 2CW7A 2VUMA 4RZQA 3KHGA 3OTOH 5KFJA 3J81W 2UU9H 3J80W 3RB3A 2W7OA 4FS1A 5KT3A 1DGSA 1WH2A 5JUMA 4JI3H 3TQ1A 4Q8EA 3T5HA 5I47A 2PVPA 4UCTA 3TINA 2QK4A 3UFXB 2R8IA 1Y1WG 3RJ0A 4A3DG 2DIKA 4FBUA 5IT9W 1HR0H 5CA0F 5KFNA 4UCVA 3DF7A 5KFEA 4LH7A 1M6VA 2R8HA 3GIDA 2C00A 5BR8H 2VQFH 3KHRA 3MR2A 4RNMA 4JUZA 5KG7A 2ZM6H 2RDJA 2FPIB 2WYOA 4ED0A 3V6HA 3GTMA 2FK2A 4R8UA 5DG8A 1B6RA 2VQEH 3RB6A 2ATLA 1KJQA 5KFQA 1T36A 4J9QA 2CZGA 1S97A 4LF4H 4MTDA 3E5NA 4DLKA 1FJGH 4XZ3B 2RF4A 2VR1A 3N8DA 2BQ3A 3PW4A 4A3JG 4QWCA 3KHLA 4YR0A 2JA8G 2VOBA 3HKZE 5KFYA 5GONF 4CC6A 2AQ4A 2DZDA 3FKIA 5EWGA 2FK1A 5L1KA 1WR2A 3RGZA 4IR9A 2VQDA 4IAJA 3RIZA 5D1PA 2UVRA 4WBNF 2R82A 1BNCA 3N40P 4O4HF 2C28A 3OUUA 1HNZH 2W6ZA 4F4ZA 4LSXA 1JXLA 4J9MA 5LP6F 5F9LA 4J9LA 4ZI7F 3QFFA 2CKZB 1KEEA 3M9NB 5L1LA 4J9NA 3G6VA 4HQ6A 4C5AA 4DL3A 1EUCB 4A3MG 4TUYF 4A93G 2C35B 2ALZA 3QZ8A 1A0IA 4B3SH 5KG1A 4TV9F 4DR6H 3N41B 4A3GG 5JVDF 1WCMG 4IZOA 1UC8A 3N42B 4JI1H 4YB8B 3HOVG 1BJTA 3TIIA 4J9PA 4DR5H 4ECRA 4R7RA 3BJYA 1IBLH 3FDSA 2R8GA 1N34H 2Q2UA 1Z2NX 4EG0A 3V4ZA 3F8NA 5EDWA 1L2ZA 1CQJB 2YZMA 4ED1A 3Q1KA 4AYBE 4DL4A 5FPOA 3ETJA 4DR3H 2X0SA 3MWDA 2AGPA 2R7NA 5KFGA 3MFIA 3SE7A 2QYZA 2NU7B 2B63G 1GSHA 4TQSA 2R87A 4DL7A 2IMWP 5A2QW 2W9CB 1OWTA 2P0AA 3PW2A 5KFIA 2HGSA 4JI7H 2YW2A 2J6TA 2AGQA 4XX0B 1KBLA 2AU0A 4A3LG 4QJFA 4O3PA 1HNXH 5JH7F 2XCLA 5FPRA 2XIGA 1HNWH 4I7HA 4DUYH 1JDBB 1IBKH 1GSAA 3G6XA 4ECXA 2GLTA 1Z2OX 3GTGA 4APMA 3C0FB 5EZYF 2ZJTA 1XMOH 3EPIA 4GC6A 4YY3H 5KFSA 4YAJB 3RV4A 4ECWA 3Q8PB 2WAQE 3MJFA 1I7LA 5LMNH 3PZPA 2R93A 3M4IA 2UXDH 3CVZA 2V59A 4DL5A 3PW5A 1CE8A 1GGOA 3R5HA 1GO3E 3PO2G 2SCUB 4A3CG 4A3EG 4ECVA 1AUVA 2J9GA 5KG2A 4TQRA 3PW7A 3GTJA 2UUBH 4RNOA 4ECZA 2YL2A 1S0OA 4MV1A 3G6YA 1GLVA 1VS0A 1V51A 5HBRB 4J9RA 2C2RA 3HOUG 2NU8B 1EZ1A 4JV2A 1O75A 1ZHQA 1RYSA 4LFCH 3IG0A 3J7AK 3GIPA 4E4TA 3HOYG 2JA6A 5IYCG 2Y0SA 3BQ0A 4DR7H 2FK3A 3LP8A 5DGBA 1TAEA 3Q8SB 1R9TA 1PK8A 2DWCA 2J6SA 5DGAA 2FP4B 4YR3A 4TV8F 4EEYA 1RK6A 3JAMW 4RUCA 4U6PA 2W8KA 1KJIA 3PVXA 4UCSA 3HOZG 3GILA 3GTOA 3ETHA 4EBEA 4B3TH 3KHHA 2W57A 3K3VA 3M9OB 3BA9A 3H0GA 5HV6A 1EYZA 4RB3C 3RBEA 2JA7G 5LA6F 2R7ZA 1B33N 1DV2A 2UVVA 2M05A 2DLNA 2C2EA 5KFRA 2W70A 2FLPA 2W8LA 1CQIB 4ECYA 2W6PA 4IRKA 2UVWA 1KJ8A 3I12A 1I7NA 2HVQA 3RTXA 3UQ8A 2UUAH 5C5JA 4QWEA 3VMMA 2IP4A 1Y14B 1X9NA 5L1IA 4I50F 5KFCA 4LF6H 3Q2OA 4NXNH 4ECSA 4X66H 5F9NA 3ORRA 2FLLA 4YP3A 2JA5G 3GIMA 3BA8A 3V6JA 2ASJA 1MZBA 1N33H 5IYZF 1EHIA 3HB9A 3LMLA 4YJ2F 3BAAA 2UVUA 1SCUB 1M7JA 5JVLA 3OHAA 1KJ9A 1TWFA 4DV5H 4DV6H 4A3KG 2GPWA 3Q8QB 1BGWA 4F4YA 3GLKA 4X62H 4Q0YA 4A3BG 5LMUH 3H40A 4Y8VB 1WSCA 3U9SA 4QIWA 4MA5A 4HNTA 3VPDA 4PWQA 5J2UF 3RF2A 2R86A 5CB4F 3RUPA 4MTEA 5D1OB 3PR5B 4J0MA 4DV4H 2BR0A 4DR4H 4C2MA 2R84A 3OSPA 4UCUA 4MV3A 1K83A 1Y1VA 2J6UA 1Z2PX 1N32H 2W6MA 2RDIA 1RJQA 2KSWA 3QZ7A 3K5IA 2NU9B 3WO1A 1S68A 4X65H 3H4BA 4DV7H 4MAMA 2NUAB 2XC9A 3U9TA 1ZQ7A 4IWYA 2R8KA 3MWMA 4X64H 4DL6A 2YCHA 4I4TF 4A2BA 1V9PA 1GYFA 4EYIB 4IR1A 2R7LA 4YHHH 4DV1H 5JQWA 4ED7A 3GTKA 4K0KH 4DL2A 1N36H 4O3OA 1Y1WA 5IWAH 3RFCA 4AQYH 3OSNA 2YZNA 4A2AA 5BPHA 1S0NA 2PMZE 4LMYA 4O4IF 3HKZA 3R5XA 5KFOA 3T5JA 4BY7G 4UCRA 4ZOLF 5J2TF 4O3QA 4JV0A 5KG3A 5DQGA 1I94H 2IBKA 5KFTA 4OX9H 5KT5A 1M0WA 2R8JA 2YRXA 2VUMG 4QWAA 3MR6A 3HOXG 2DPIA 2FKLA 1I6UA 4L1KA 1M0TA 5IYDG 4JI2H 5CAEB 3K3PA 2W9CA 1JDEA 4ECTA 3RAQA 1IOVA 3KXYT 5C1OA 2XGPA 4YQWA 1UNNC 4UFZA 2W6NA 4NXMH 5C44G 5IYBG 3L2PA 4JYAH 4C5BA 2W9BB 5C1PA 2JEGA 1B6SA 3MR3A 4IWXA 4Q8FA 2WTFA 2R7KA 2FLNA 4LSAA 1TA8A 3H20A 1EUDB 4DV2H 3BQ1A 2WB1A 5KFWA 2I80A 2CW8A 3M9MB 3T5LA 1J5EH 5KT4A 2UXBH 4LFAH 1A9XA 1XMQH 4RAZA 4O3SA 3GTQA 2RGRA 4HNUA 2E2IA 4GLXA 3WO0A 4U7CA 3T5KA 1ZHSA 4ZHQF 3L4KA 5KFDA 3H4DA 4EFBA 2WDTA 4Q45A 4ED8A 4RU9A 1I3QA 1JX4A 4JI6H 5BMVF 3FKIG 2WE6A 4IHJF 4AYBA 5T14A 2XGQA 5KFKA 3HXLA 2VPQA 5D8DA 3BG5A 4FM9A 4GKJH 5IP9G 2YRWA 4EYHB 5FD5A 2W9AA 4FBTA 5DG7A 1K1QA 3R23A 3N44B 5DLGA 2W6OA 4LH6A 2IA6A 1DV1A 3N43B 4QWBA 5KFAA 3EPGA 2FPPB 4RAYA 1S9FA 1C30A 2R7MA 1E4EB 3IN5A 4ED6A 5DLFA 2F4VH 1E4GT 2I87A 1PX2A 4ZQIA 1KJJA 4Q44A 1XDNA 2CQYA 3GTLA 4YAKB 1XNRH 5CA1F 1VAJA 2VUGA 4EEQA 4ECQA 4O3RA 2V58A 1S10A 3VPBA 3VPCA 2E2HA 4HNVA 4HR7A 2W6QA 5KFHA 2Q2TA 1JLLB 3KTMA 3T1HH 3H3VH 1RK5A 1UC9A 5FJ8G 3PR4A 4JI8H 2WAQA 2YYAA 2ZDGA 2R85A 3JZIA 4BXXG 3L4JA 2FMAA 2YZGA 4G3IA 3MWEA 1FVIA 5BPFA 3KALA 2I8CA 3GV8B 4M9UA 1K1SA 4ED2A 4MV4A 1DIKA 3OHBA 4RB2C 4LF7H 2YU9A 4DUZH 2UXCH 1KC7A 3RGXA 4R8UB 5FD6A 4YJ3F 5L9XA 3JSNA 4LF5H 4I55F 1V4YA 2R92A 4ECUA 4DV0H 4F4XA 4B3RH 2W7PA 5KFVA 1P8LA 4KHPH 3JSLA 3ORQA 3LWBA 4MV7A 4ME6A 5LOVF 2JEFA 3K5HA 4HYKA 3KAJA 5KFFA 2RGVA 2YS6A 3I4MG 1T94A 5DQIA 4EBCA 2R93G 4JI4H 5D1OA 3AYHB 2ASDA 4B3MH 4J9OA 1SEIA 3RB4A 2R6FA 1VBHA 2XD4A 2BQUA 4BBSG 2JEJA 2FJZA 2O03A 4RZRA 1ULZA 5LYJF 4J9SA 3V6KA 3RAXA 4YBZB 4IRDA 1AUXA 4IRCA 2NVXA 4XYLB 3GIJA 4RB0A 2XCPA 3EYYA 2XCAA 4M7EA 4BY1G 4A3FG 4CC5A 2HVSA 2NU6B 1C3OA 1RYRA 4JV1A 1W96A 5IP7G 4QW9A 4MV9A 2OLSA 2JA7A 2MCTA 2WB1E 2C2DA 5KT7A 2ASLA 1CS0A 3GIIA 2JA6G 3HBLA 3JRXA 4MV8A 2NVYA 5KKNB 1I50A 3PO3G 4DR2H 2AGOA 1IOWA 1TWGA 4DV3H 4WD3A 1N56A 4XYMB 2ZDQA 1TWAA 1VBGA 4MV6A 4JI5H 2C22A 3RBDA 5H80A 2YS7A 5KFPA 3GQCA 3H0GG 3KAKA 5KG4A 3TIGA 4ETSA 1B04A 4F4WA 2UUCH 2V9WA 3FMAA 5LXTF 5KFXA 2R7ZG 2JA5A 4GC7A 3T1YH 2Y0SE 5EWFA 3BQ2A 5FLXW 1E4FT 4RNNA 2JEIA 4C5CA 5KG5A 5KT6A 1VKZA 4QW8A 5EWEA 2HVRA 4O4LF 5C8YF 4JI0H 3GV7B 2OWOA 2OH2A 4MA0A 2W9BA 3GV5B 2E5LH 5KFLA 3HOWG 1FKAH 5KG6A 4ED3A 3GIQA 2VA2A 1ZETA 5C4XG 3SI8A 2FPGB 2PBZA 1S0MA 1JIHA 2ZDHA 5KFMA 3MFHA 4QWDA 1JKJB 1W93A 5L1JA 5EOYA 1IBMH 4LFBH 1TWHA 4BBRG 4EGQA 3GIKA 3JRWA 4EFEA 5LL6b 3V4SA 5KX5F 4NLGA 5KFZA 4JV5H 3BABA 5C3EG 4LF9H 1TWCA 3PW0A 2R92G 4UCOA 4GKKH 4O2AF 1SYXB 1WCMA 3MR5A 4PDBA 2PMZA
chains in the Genus database with same CATH topology
2FK3A 2M05A 2FK1A 2FKLA 1OWTA 2FMAA 3KTMA 2FJZA 4PWQA 2FK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FK3 A;  2M05 A;  2FK1 A;  2FKL A;  1OWT A;  2FMA A;  3KTM A;  2FJZ A;  4PWQ A;  2FK2 A; 
#chains in the Genus database with same CATH topology
 2V4Q A;  1RJR A;  4J9K A;  5FLM G;  1S03 G;  2V5A A;  5KG0 A;  2FE3 A;  2PN1 A;  4O2B F;  2V4R A;  1SFO A;  1GSO A;  5KFU A;  2HHH H;  4RUA A;  3Q8R B;  3NGD A;  3N6X A;  3CQZ A;  1BXR A;  3RV3 A;  4FS2 A;  1T3N A;  4BWS C;  4O3N A;  4A3I G;  4LF8 H;  4RB1 A;  1Y1V G;  4FU0 A;  3WNZ A;  1XNQ H;  3PN1 A;  1AN7 A;  2W71 A;  2HJW A;  3G8C A;  4F50 A;  3OUZ A;  3RB0 A;  3GTP A;  2BQR A;  4YR2 A;  3R5F A;  4EGJ A;  1RJP A;  2GPS A;  1E4E A;  4DR1 H;  3I4N G;  5DQH A;  2B63 A;  4QIW E;  2FB9 A;  3TQT A;  5KT2 A;  4EBD A;  5DG9 A;  4Q43 A;  2VPS A;  2DPJ A;  5K2M A;  1N48 A;  5KFB A;  2VA3 A;  2CW7 A;  2VUM A;  4RZQ A;  3KHG A;  3OTO H;  5KFJ A;  3J81 W;  2UU9 H;  3J80 W;  3RB3 A;  2W7O A;  4FS1 A;  5KT3 A;  1DGS A;  1WH2 A;  5JUM A;  4JI3 H;  3TQ1 A;  4Q8E A;  3T5H A;  5I47 A;  2PVP A;  4UCT A;  3TIN A;  2QK4 A;  3UFX B;  2R8I A;  1Y1W G;  3RJ0 A;  4A3D G;  2DIK A;  4FBU A;  5IT9 W;  1HR0 H;  5CA0 F;  5KFN A;  4UCV A;  3DF7 A;  5KFE A;  4LH7 A;  1M6V A;  2R8H A;  3GID A;  2C00 A;  5BR8 H;  2VQF H;  3KHR A;  3MR2 A;  4RNM A;  4JUZ A;  5KG7 A;  2ZM6 H;  2RDJ A;  2FPI B;  2WYO A;  4ED0 A;  3V6H A;  3GTM A;  2FK2 A;  4R8U A;  5DG8 A;  1B6R A;  2VQE H;  3RB6 A;  2ATL A;  1KJQ A;  5KFQ A;  1T36 A;  4J9Q A;  2CZG A;  1S97 A;  4LF4 H;  4MTD A;  3E5N A;  4DLK A;  1FJG H;  4XZ3 B;  2RF4 A;  2VR1 A;  3N8D A;  2BQ3 A;  3PW4 A;  4A3J G;  4QWC A;  3KHL A;  4YR0 A;  2JA8 G;  2VOB A;  3HKZ E;  5KFY A;  5GON F;  4CC6 A;  2AQ4 A;  2DZD A;  3FKI A;  5EWG A;  2FK1 A;  5L1K A;  1WR2 A;  3RGZ A;  4IR9 A;  2VQD A;  4IAJ A;  3RIZ A;  5D1P A;  2UVR A;  4WBN F;  2R82 A;  1BNC A;  3N40 P;  4O4H F;  2C28 A;  3OUU A;  1HNZ H;  2W6Z A;  4F4Z A;  4LSX A;  1JXL A;  4J9M A;  5LP6 F;  5F9L A;  4J9L A;  4ZI7 F;  3QFF A;  2CKZ B;  1KEE A;  3M9N B;  5L1L A;  4J9N A;  3G6V A;  4HQ6 A;  4C5A A;  4DL3 A;  1EUC B;  4A3M G;  4TUY F;  4A93 G;  2C35 B;  2ALZ A;  3QZ8 A;  1A0I A;  4B3S H;  5KG1 A;  4TV9 F;  4DR6 H;  3N41 B;  4A3G G;  5JVD F;  1WCM G;  4IZO A;  1UC8 A;  3N42 B;  4JI1 H;  4YB8 B;  3HOV G;  1BJT A;  3TII A;  4J9P A;  4DR5 H;  4ECR A;  4R7R A;  3BJY A;  1IBL H;  3FDS A;  2R8G A;  1N34 H;  2Q2U A;  1Z2N X;  4EG0 A;  3V4Z A;  3F8N A;  5EDW A;  1L2Z A;  1CQJ B;  2YZM A;  4ED1 A;  3Q1K A;  4AYB E;  4DL4 A;  5FPO A;  3ETJ A;  4DR3 H;  2X0S A;  3MWD A;  2AGP A;  2R7N A;  5KFG A;  3MFI A;  3SE7 A;  2QYZ A;  2NU7 B;  2B63 G;  1GSH A;  4TQS A;  2R87 A;  4DL7 A;  2IMW P;  5A2Q W;  2W9C B;  1OWT A;  2P0A A;  3PW2 A;  5KFI A;  2HGS A;  4JI7 H;  2YW2 A;  2J6T A;  2AGQ A;  4XX0 B;  1KBL A;  2AU0 A;  4A3L G;  4QJF A;  4O3P A;  1HNX H;  5JH7 F;  2XCL A;  5FPR A;  2XIG A;  1HNW H;  4I7H A;  4DUY H;  1JDB B;  1IBK H;  1GSA A;  3G6X A;  4ECX A;  2GLT A;  1Z2O X;  3GTG A;  4APM A;  3C0F B;  5EZY F;  2ZJT A;  1XMO H;  3EPI A;  4GC6 A;  4YY3 H;  5KFS A;  4YAJ B;  3RV4 A;  4ECW A;  3Q8P B;  2WAQ E;  3MJF A;  1I7L A;  5LMN H;  3PZP A;  2R93 A;  3M4I A;  2UXD H;  3CVZ A;  2V59 A;  4DL5 A;  3PW5 A;  1CE8 A;  1GGO A;  3R5H A;  1GO3 E;  3PO2 G;  2SCU B;  4A3C G;  4A3E G;  4ECV A;  1AUV A;  2J9G A;  5KG2 A;  4TQR A;  3PW7 A;  3GTJ A;  2UUB H;  4RNO A;  4ECZ A;  2YL2 A;  1S0O A;  4MV1 A;  3G6Y A;  1GLV A;  1VS0 A;  1V51 A;  5HBR B;  4J9R A;  2C2R A;  3HOU G;  2NU8 B;  1EZ1 A;  4JV2 A;  1O75 A;  1ZHQ A;  1RYS A;  4LFC H;  3IG0 A;  3J7A K;  3GIP A;  4E4T A;  3HOY G;  2JA6 A;  5IYC G;  2Y0S A;  3BQ0 A;  4DR7 H;  2FK3 A;  3LP8 A;  5DGB A;  1TAE A;  3Q8S B;  1R9T A;  1PK8 A;  2DWC A;  2J6S A;  5DGA A;  2FP4 B;  4YR3 A;  4TV8 F;  4EEY A;  1RK6 A;  3JAM W;  4RUC A;  4U6P A;  2W8K A;  1KJI A;  3PVX A;  4UCS A;  3HOZ G;  3GIL A;  3GTO A;  3ETH A;  4EBE A;  4B3T H;  3KHH A;  2W57 A;  3K3V A;  3M9O B;  3BA9 A;  3H0G A;  5HV6 A;  1EYZ A;  4RB3 C;  3RBE A;  2JA7 G;  5LA6 F;  2R7Z A;  1B33 N;  1DV2 A;  2UVV A;  2M05 A;  2DLN A;  2C2E A;  5KFR A;  2W70 A;  2FLP A;  2W8L A;  1CQI B;  4ECY A;  2W6P A;  4IRK A;  2UVW A;  1KJ8 A;  3I12 A;  1I7N A;  2HVQ A;  3RTX A;  3UQ8 A;  2UUA H;  5C5J A;  4QWE A;  3VMM A;  2IP4 A;  1Y14 B;  1X9N A;  5L1I A;  4I50 F;  5KFC A;  4LF6 H;  3Q2O A;  4NXN H;  4ECS A;  4X66 H;  5F9N A;  3ORR A;  2FLL A;  4YP3 A;  2JA5 G;  3GIM A;  3BA8 A;  3V6J A;  2ASJ A;  1MZB A;  1N33 H;  5IYZ F;  1EHI A;  3HB9 A;  3LML A;  4YJ2 F;  3BAA A;  2UVU A;  1SCU B;  1M7J A;  5JVL A;  3OHA A;  1KJ9 A;  1TWF A;  4DV5 H;  4DV6 H;  4A3K G;  2GPW A;  3Q8Q B;  1BGW A;  4F4Y A;  3GLK A;  4X62 H;  4Q0Y A;  4A3B G;  5LMU H;  3H40 A;  4Y8V B;  1WSC A;  3U9S A;  4QIW A;  4MA5 A;  4HNT A;  3VPD A;  4PWQ A;  5J2U F;  3RF2 A;  2R86 A;  5CB4 F;  3RUP A;  4MTE A;  5D1O B;  3PR5 B;  4J0M A;  4DV4 H;  2BR0 A;  4DR4 H;  4C2M A;  2R84 A;  3OSP A;  4UCU A;  4MV3 A;  1K83 A;  1Y1V A;  2J6U A;  1Z2P X;  1N32 H;  2W6M A;  2RDI A;  1RJQ A;  2KSW A;  3QZ7 A;  3K5I A;  2NU9 B;  3WO1 A;  1S68 A;  4X65 H;  3H4B A;  4DV7 H;  4MAM A;  2NUA B;  2XC9 A;  3U9T A;  1ZQ7 A;  4IWY A;  2R8K A;  3MWM A;  4X64 H;  4DL6 A;  2YCH A;  4I4T F;  4A2B A;  1V9P A;  1GYF A;  4EYI B;  4IR1 A;  2R7L A;  4YHH H;  4DV1 H;  5JQW A;  4ED7 A;  3GTK A;  4K0K H;  4DL2 A;  1N36 H;  4O3O A;  1Y1W A;  5IWA H;  3RFC A;  4AQY H;  3OSN A;  2YZN A;  4A2A A;  5BPH A;  1S0N A;  2PMZ E;  4LMY A;  4O4I F;  3HKZ A;  3R5X A;  5KFO A;  3T5J A;  4BY7 G;  4UCR A;  4ZOL F;  5J2T F;  4O3Q A;  4JV0 A;  5KG3 A;  5DQG A;  1I94 H;  2IBK A;  5KFT A;  4OX9 H;  5KT5 A;  1M0W A;  2R8J A;  2YRX A;  2VUM G;  4QWA A;  3MR6 A;  3HOX G;  2DPI A;  2FKL A;  1I6U A;  4L1K A;  1M0T A;  5IYD G;  4JI2 H;  5CAE B;  3K3P A;  2W9C A;  1JDE A;  4ECT A;  3RAQ A;  1IOV A;  3KXY T;  5C1O A;  2XGP A;  4YQW A;  1UNN C;  4UFZ A;  2W6N A;  4NXM H;  5C44 G;  5IYB G;  3L2P A;  4JYA H;  4C5B A;  2W9B B;  5C1P A;  2JEG A;  1B6S A;  3MR3 A;  4IWX A;  4Q8F A;  2WTF A;  2R7K A;  2FLN A;  4LSA A;  1TA8 A;  3H20 A;  1EUD B;  4DV2 H;  3BQ1 A;  2WB1 A;  5KFW A;  2I80 A;  2CW8 A;  3M9M B;  3T5L A;  1J5E H;  5KT4 A;  2UXB H;  4LFA H;  1A9X A;  1XMQ H;  4RAZ A;  4O3S A;  3GTQ A;  2RGR A;  4HNU A;  2E2I A;  4GLX A;  3WO0 A;  4U7C A;  3T5K A;  1ZHS A;  4ZHQ F;  3L4K A;  5KFD A;  3H4D A;  4EFB A;  2WDT A;  4Q45 A;  4ED8 A;  4RU9 A;  1I3Q A;  1JX4 A;  4JI6 H;  5BMV F;  3FKI G;  2WE6 A;  4IHJ F;  4AYB A;  5T14 A;  2XGQ A;  5KFK A;  3HXL A;  2VPQ A;  5D8D A;  3BG5 A;  4FM9 A;  4GKJ H;  5IP9 G;  2YRW A;  4EYH B;  5FD5 A;  2W9A A;  4FBT A;  5DG7 A;  1K1Q A;  3R23 A;  3N44 B;  5DLG A;  2W6O A;  4LH6 A;  2IA6 A;  1DV1 A;  3N43 B;  4QWB A;  5KFA A;  3EPG A;  2FPP B;  4RAY A;  1S9F A;  1C30 A;  2R7M A;  1E4E B;  3IN5 A;  4ED6 A;  5DLF A;  2F4V H;  1E4G T;  2I87 A;  1PX2 A;  4ZQI A;  1KJJ A;  4Q44 A;  1XDN A;  2CQY A;  3GTL A;  4YAK B;  1XNR H;  5CA1 F;  1VAJ A;  2VUG A;  4EEQ A;  4ECQ A;  4O3R A;  2V58 A;  1S10 A;  3VPB A;  3VPC A;  2E2H A;  4HNV A;  4HR7 A;  2W6Q A;  5KFH A;  2Q2T A;  1JLL B;  3KTM A;  3T1H H;  3H3V H;  1RK5 A;  1UC9 A;  5FJ8 G;  3PR4 A;  4JI8 H;  2WAQ A;  2YYA A;  2ZDG A;  2R85 A;  3JZI A;  4BXX G;  3L4J A;  2FMA A;  2YZG A;  4G3I A;  3MWE A;  1FVI A;  5BPF A;  3KAL A;  2I8C A;  3GV8 B;  4M9U A;  1K1S A;  4ED2 A;  4MV4 A;  1DIK A;  3OHB A;  4RB2 C;  4LF7 H;  2YU9 A;  4DUZ H;  2UXC H;  1KC7 A;  3RGX A;  4R8U B;  5FD6 A;  4YJ3 F;  5L9X A;  3JSN A;  4LF5 H;  4I55 F;  1V4Y A;  2R92 A;  4ECU A;  4DV0 H;  4F4X A;  4B3R H;  2W7P A;  5KFV A;  1P8L A;  4KHP H;  3JSL A;  3ORQ A;  3LWB A;  4MV7 A;  4ME6 A;  5LOV F;  2JEF A;  3K5H A;  4HYK A;  3KAJ A;  5KFF A;  2RGV A;  2YS6 A;  3I4M G;  1T94 A;  5DQI A;  4EBC A;  2R93 G;  4JI4 H;  5D1O A;  3AYH B;  2ASD A;  4B3M H;  4J9O A;  1SEI A;  3RB4 A;  2R6F A;  1VBH A;  2XD4 A;  2BQU A;  4BBS G;  2JEJ A;  2FJZ A;  2O03 A;  4RZR A;  1ULZ A;  5LYJ F;  4J9S A;  3V6K A;  3RAX A;  4YBZ B;  4IRD A;  1AUX A;  4IRC A;  2NVX A;  4XYL B;  3GIJ A;  4RB0 A;  2XCP A;  3EYY A;  2XCA A;  4M7E A;  4BY1 G;  4A3F G;  4CC5 A;  2HVS A;  2NU6 B;  1C3O A;  1RYR A;  4JV1 A;  1W96 A;  5IP7 G;  4QW9 A;  4MV9 A;  2OLS A;  2JA7 A;  2MCT A;  2WB1 E;  2C2D A;  5KT7 A;  2ASL A;  1CS0 A;  3GII A;  2JA6 G;  3HBL A;  3JRX A;  4MV8 A;  2NVY A;  5KKN B;  1I50 A;  3PO3 G;  4DR2 H;  2AGO A;  1IOW A;  1TWG A;  4DV3 H;  4WD3 A;  1N56 A;  4XYM B;  2ZDQ A;  1TWA A;  1VBG A;  4MV6 A;  4JI5 H;  2C22 A;  3RBD A;  5H80 A;  2YS7 A;  5KFP A;  3GQC A;  3H0G G;  3KAK A;  5KG4 A;  3TIG A;  4ETS A;  1B04 A;  4F4W A;  2UUC H;  2V9W A;  3FMA A;  5LXT F;  5KFX A;  2R7Z G;  2JA5 A;  4GC7 A;  3T1Y H;  2Y0S E;  5EWF A;  3BQ2 A;  5FLX W;  1E4F T;  4RNN A;  2JEI A;  4C5C A;  5KG5 A;  5KT6 A;  1VKZ A;  4QW8 A;  5EWE A;  2HVR A;  4O4L F;  5C8Y F;  4JI0 H;  3GV7 B;  2OWO A;  2OH2 A;  4MA0 A;  2W9B A;  3GV5 B;  2E5L H;  5KFL A;  3HOW G;  1FKA H;  5KG6 A;  4ED3 A;  3GIQ A;  2VA2 A;  1ZET A;  5C4X G;  3SI8 A;  2FPG B;  2PBZ A;  1S0M A;  1JIH A;  2ZDH A;  5KFM A;  3MFH A;  4QWD A;  1JKJ B;  1W93 A;  5L1J A;  5EOY A;  1IBM H;  4LFB H;  1TWH A;  4BBR G;  4EGQ A;  3GIK A;  3JRW A;  4EFE A;  5LL6 b;  3V4S A;  5KX5 F;  4NLG A;  5KFZ A;  4JV5 H;  3BAB A;  5C3E G;  4LF9 H;  1TWC A;  3PW0 A;  2R92 G;  4UCO A;  4GKK H;  4O2A F;  1SYX B;  1WCM A;  3MR5 A;  4PDB A;  2PMZ A; 
#chains in the Genus database with same CATH homology
 2FK3 A;  2M05 A;  2FK1 A;  2FKL A;  1OWT A;  2FMA A;  3KTM A;  2FJZ A;  4PWQ A;  2FK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...