2FKLA

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain (residues 126- 189 of app)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
ALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Amyloid beta A4 protein precursor
total genus 14
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12924 APP_Cu_bd Copper-binding of amyloid precursor, CuBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fklA00
2FMAA 1OWTA 2M05A 2FK3A 2FK2A 2FJZA 3KTMA 2FK1A 2FKLA 4PWQA
chains in the Genus database with same CATH superfamily
2W6MA 2XCAA 3LP8A 5HBRB 1GSOA 1KEEA 4PDBA 3GILA 1GYFA 4FS1A 4JI8H 1K1QA 4DR7H 2R92A 4BY1G 2C00A 4EGQA 1T3NA 5LXTF 4I50F 5C3EG 5D1OA 3CQZA 5FLXW 4Q8EA 4YR2A 5DG7A 2OWOA 1SFOA 2V4RA 3GTKA 4JV2A 2W8LA 5DG9A 4NXNH 1KJIA 3Q8RB 3RFCA 4CC6A 4JI7H 4Y8VB 2W6NA 2YW2A 4YJ2F 4YY3H 3PW2A 2CZGA 4RUCA 2C22A 2UUAH 2ATLA 1BNCA 2BQ3A 1E4EB 4L1KA 3L4JA 2VA3A 4IRKA 4CC5A 4ECQA 4ED2A 2JA6A 4YP3A 3RUPA 4DV7H 2AU0A 4R7RA 2WE6A 4U7CA 5FJ8G 2W9CB 4DUYH 3BQ1A 4RB3C 4FM9A 1JDEA 1P8LA 3UQ8A 4Q43A 3Q8PB 5KFYA 3HOXG 3H0GA 1RYRA 4A3LG 4UCOA 2UXBH 1E4FT 2JEIA 5KFLA 4BBRG 4EFBA 1JIHA 3HKZA 4EBDA 1Z2PX 2YRWA 1O75A 4ME6A 4U6PA 4MV8A 2JA7A 4BXXG 3HBLA 4GC7A 1GSHA 4TV9F 4J9SA 1OWTA 3KXYT 3K3PA 4DV1H 4EEYA 1N34H 1ZHQA 3MR6A 5FD5A 5EZYF 2AGQA 1Y1WA 4I7HA 2AGPA 3H20A 2AQ4A 3V4SA 1JDBB 2W6ZA 3DF7A 5KKNB 2R87A 2YS6A 2ZDHA 3OSPA 2W71A 4K0KH 3LMLA 4QW9A 4KHPH 2W7PA 4I55F 4YBZB 4X64H 4ECYA 1VAJA 4C5AA 4ED8A 4QW8A 5KFCA 5CA1F 3FDSA 4ED7A 4LF7H 4UCRA 5JH7F 2FPGB 5C44G 2JEJA 2O03A 5CA0F 4ED6A 5IYCG 4FBUA 3GTGA 5IYZF 1B33N 1WCMG 3MFIA 2W6OA 4LF5H 2YRXA 4ZQIA 3T5HA 4C5CA 3TINA 5DQHA 4F4YA 5DGAA 1V51A 3KAKA 3RTXA 1VBGA 5JVDF 2C28A 2UVRA 3HOZG 2RF4A 1BJTA 3GIDA 3R23A 4ETSA 1A9XA 4ED1A 4DLKA 3JRWA 2VUMA 5KFKA 2NVYA 1I7LA 3QZ8A 3SI8A 1RK6A 2GPSA 3J7AK 3U9SA 1VBHA 1SEIA 1IOWA 1WR2A 2PN1A 2FMAA 3KHHA 4ECUA 4AQYH 3PN1A 3FMAA 1XNQH 1EHIA 3U9TA 4YQWA 3OTOH 3BG5A 4J9KA 1ZQ7A 2R82A 4R8UB 5LMNH 4LH6A 2W9CA 2YS7A 2VQFH 3GIKA 3N44B 4LFCH 1AUVA 4TV8F 2RDJA 2SCUB 4A3MG 1KJ8A 1GGOA 2UVVA 3HOWG 4IRDA 3RJ0A 2IMWP 2R84A 3NGDA 1DIKA 3R5HA 4APMA 4M7EA 4HQ6A 4DV6H 4TQRA 3KALA 3HB9A 4JI3H 5BR8H 1ZETA 5KG4A 5DQIA 5LMUH 5DGBA 1VKZA 5KG7A 5JUMA 2PMZA 4RB0A 5KFJA 4MV1A 5KFDA 2R6FA 2VA2A 4X62H 1I6UA 1RYSA 4MV7A 2X0SA 2VPSA 5LYJF 2XCPA 2BR0A 4DR2H 2PBZA 1CQJB 4JV0A 3HOYG 2C35B 4A2AA 1E4GT 3JSLA 3IG0A 1JLLB 3VPCA 1IBMH 5FD6A 1TWHA 2R8GA 4JI1H 4O3OA 2DIKA 1V4YA 4WBNF 5KFSA 5L9XA 5IWAH 1RJQA 1Y14B 3UFXB 4EFEA 3IN5A 2HVSA 4JI6H 5I47A 4YHHH 4WD3A 3KAJA 3EPIA 4YAJB 4EBEA 4DL7A 4B3RH 3T5JA 1AN7A 4TUYF 5D8DA 2V9WA 3K3VA 4A3DG 4ECWA 5DG8A 2UU9H 4QIWE 4ED3A 3GTQA 1KC7A 4XYLB 3T1YH 5KT6A 4RNOA 2VUMG 3GIQA 5H80A 5KFPA 3I4NG 3AYHB 4FU0A 1HR0H 4EG0A 4RZQA 2OH2A 4X65H 3H4BA 1S9FA 1JXLA 2Q2TA 4DV0H 3KTMA 4RUAA 3JRXA 5KG5A 4MV4A 2RDIA 3OHAA 2UVUA 1CS0A 1C3OA 4QWBA 5LL6b 4LF8H 5KT7A 5L1LA 2XGQA 4YB8B 2YL2A 5EWEA 1RK5A 2FPPB 2WAQE 2YZGA 1V9PA 2HVQA 5GONF 3OUZA 3GV5B 3HOVG 1FJGH 1MZBA 4A3EG 2VUGA 2Y0SE 1Y1VG 3M4IA 5FPOA 3GQCA 3KHRA 3GTLA 1Y1VA 2HVRA 4LSAA 2FP4B 4J9LA 1B6SA 2DWCA 3HXLA 3I4MG 4B3TH 1I7NA 5KG0A 2NUAB 2XD4A 4ZHQF 5LP6F 5T14A 4JYAH 4A3CG 3MWDA 1RJRA 1B6RA 1N48A 2ASLA 1IBLH 2JA7G 4O3QA 4O4HF 2MCTA 4RAYA 1A0IA 1E4EA 1N33H 4J0MA 2ZDGA 5KFHA 4A3JG 3H0GG 3BAAA 1GSAA 1S0MA 2HHHH 4LF9H 3PW5A 4GC6A 1ULZA 5F9LA 2DLNA 4UCUA 2WB1E 4QWEA 4OX9H 5KG1A 3H3VH 3V6KA 1R9TA 5DLFA 4MA0A 4AYBE 3R5XA 2RGRA 1GO3E 2WTFA 3ETJA 2WDTA 4DL2A 1S97A 1KJ9A 4X66H 2NU8B 4IR9A 3EPGA 4JI4H 4O2BF 2E2IA 5C1OA 2ALZA 5KFRA 2FKLA 5L1KA 4HNUA 1JX4A 1HNXH 2R8HA 2FLPA 2R7LA 3KHGA 4RB2C 3L2PA 5L1JA 5KFXA 3VMMA 3PW4A 3RGZA 5KFWA 4DR5H 3TIGA 5LOVF 3G6XA 3PZPA 2ZDQA 2V59A 4QWCA 5C5JA 2E5LH 5DLGA 4XX0B 4ECVA 2FLNA 2UVWA 4R8UA 2R7MA 1TWFA 2GPWA 3T5LA 5DQGA 1I50A 4ECSA 4LFAH 2JEFA 4BWSC 3RGXA 4O3RA 4TQSA 2KSWA 4F4WA 2W7OA 5D1OB 3H40A 5KFVA 2J6TA 4A3IG 5CAEB 2VOBA 2FB9A 1T94A 4DV4H 5KFAA 3GTJA 4DR3H 2WYOA 4ZI7F 4IWXA 4DR4H 2XGPA 4A3BG 3ORQA 5JQWA 2W70A 2YZMA 5KFBA 4JUZA 2J6UA 3K5HA 2IBKA 3ORRA 2XIGA 2WAQA 1M0WA 4UFZA 2VQDA 3V4ZA 5CB4F 5KFNA 2NU7B 4RU9A 4Q44A 4MTDA 2ZM6H 1WH2A 4DUZH 2V4QA 4HYKA 4O3NA 2R93G 3MR3A 2VPQA 2UXCH 1UC9A 4FBTA 2B63A 1ZHSA 4ECRA 2Y0SA 3RBEA 3N40P 1UC8A 1BGWA 4EBCA 3OSNA 2Q2UA 3F8NA 2GLTA 2I8CA 3RB3A 2W9BB 4HNTA 5KFGA 2AGOA 3RAXA 4JV1A 2FK3A 1RJPA 4B3MH 4GKJH 4A3KG 3M9NB 4B3SH 3RF2A 5IT9W 5KFMA 5IYDG 3V6HA 4LMYA 4EEQA 2F4VH 2RGVA 2M05A 2YCHA 2NU6B 4YR3A 2NVXA 1IOVA 3BQ2A 1VS0A 5KFIA 4IRCA 3M9OB 3FKIG 4A3FG 2OLSA 4LF6H 3MJFA 3GIMA 2R85A 3FKIA 5J2TF 1S68A 1M7JA 2WB1A 4JI5H 4O4IF 4MV9A 5FLMG 2JA5A 2DPIA 3J81W 3RBDA 3RAQA 1M0TA 4AYBA 2DPJA 3RB4A 4LF4H 1JKJB 2I87A 1T36A 1TWAA 1DGSA 3G8CA 4JI2H 3MWMA 5C1PA 2CKZB 1TWGA 4J9QA 1S0OA 5BPFA 4YJ3F 1KJQA 2FK2A 1PX2A 3G6YA 3RV4A 2HJWA 4DL6A 1S0NA 3OUUA 3PW7A 5KFEA 1BXRA 3JAMW 4A3GG 5L1IA 2V58A 3GTOA 4RNMA 2YZNA 4J9OA 1TAEA 3BA9A 4J9MA 3GLKA 4Q0YA 4UCVA 2E2HA 1XDNA 2CW8A 5IYBG 4IWYA 3BJYA 2JA6G 1X9NA 2FPIB 2B63G 4UCTA 4LFBH 2FJZA 4ZOLF 2R7ZG 1IBKH 2UXDH 5BMVF 5EWFA 5F9NA 3OHBA 3RIZA 2BQRA 2DZDA 1GLVA 4BBSG 2FK1A 4HNVA 1KJJA 3WO1A 3HOUG 5LA6F 4QJFA 2HGSA 3MR2A 4J9NA 4EYHB 2W57A 5KG2A 1AUXA 4RB1A 5EDWA 4HR7A 4QWAA 2IA6A 4DR1H 2UUBH 1EUCB 1K1SA 3TQ1A 1I94H 2P0AA 4C5BA 4IR1A 3MR5A 4G3IA 3E5NA 4IHJF 2QYZA 2ZJTA 3JZIA 3Q1KA 1J5EH 3N8DA 3J80W 5KFUA 3WO0A 2XCLA 4ECZA 5EWGA 2R7ZA 3Q2OA 2NU9B 3MFHA 1S10A 3TIIA 5C8YF 4F50A 4LH7A 3SE7A 5KFTA 4LSXA 3RB6A 1XNRH 3GIPA 1WCMA 1CE8A 3PO3G 3N42B 4BY7G 3K5IA 5J2UF 4MV3A 1PK8A 4O4LF 5KFZA 2W9AA 1M6VA 4IAJA 3VPDA 2C2DA 5BPHA 4Q45A 4O3SA 5EOYA 4MAMA 4YR0A 4EGJA 4O2AF 1N56A 5K2MA 4JI0H 3RV3A 2JA5G 1Z2NX 3RB0A 5KT3A 1Z2OX 5KT2A 3N41B 2R86A 4F4ZA 1KBLA 3Q8SB 4RNNA 4IZOA 1SYXB 1FVIA 1Y1WG 3I12A 2BQUA 5C4XG 1EYZA 2PMZE 3Q8QB 4UCSA 3GTPA 2FLLA 3GV7B 3GV8B 1SCUB 1W96A 4MV6A 1HNWH 1XMQH 3HKZE 2J9GA 4YAKB 4DV2H 1W93A 2JEGA 3H4DA 1FKAH 2CQYA 2IP4A 2W8KA 3PW0A 4MTEA 2YYAA 1CQIB 4GLXA 2W6PA 3BABA 3JSNA 4DL3A 4E4TA 5KT4A 4ECTA 4ECXA 4JV5H 2JA8G 4QWDA 4A93G 3L4KA 2R7NA 4C2MA 3ETHA 5JVLA 4MA5A 3T5KA 2VQEH 4Q8FA 3BA8A 3V6JA 1B04A 3M9MB 4ED0A 1S03G 1C30A 1I3QA 3QZ7A 1XMOH 2J6SA 5D1PA 3G6VA 4QIWA 1EZ1A 2FE3A 3C0FB 4RAZA 3PVXA 4I4TF 3N6XA 2CW7A 1TWCA 4EYIB 3WNZA 5KT5A 3PR4A 2R7KA 3GIIA 5KG6A 1N36H 4DR6H 2R93A 4FS2A 3EYYA 4XZ3B 3N43B 4RZRA 5KFOA 5KFFA 1L2ZA 1UNNC 3GIJA 2V5AA 1HNZH 4DV3H 3R5FA 1WSCA 5KG3A 4DL4A 2W9BA 3MWEA 1N32H 3VPBA 5IP9G 2XC9A 2QK4A 4J9RA 4O3PA 2ASDA 2UUCH 2YU9A 2W6QA 4DL5A 3PR5B 4PWQA 1EUDB 3LWBA 3TQTA 1DV2A 5KX5F 3BQ0A 4NLGA 5HV6A 2C2EA 2R92G 5KFQA 2R8JA 4DV5H 4F4XA 2PVPA 2C2RA 3PO2G 2I80A 3GTMA 1TA8A 2VR1A 3KHLA 4NXMH 4A2BA 3QFFA 3T1HH 3CVZA 2R8IA 5IP7G 4XYMB 5A2QW 1K83A 4J9PA 2ASJA 5FPRA 4GKKH 1DV1A 4M9UA 2R8KA
chains in the Genus database with same CATH topology
2FMAA 1OWTA 2M05A 2FK3A 2FK2A 2FJZA 3KTMA 2FK1A 2FKLA 4PWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FMA A;  1OWT A;  2M05 A;  2FK3 A;  2FK2 A;  2FJZ A;  3KTM A;  2FK1 A;  2FKL A;  4PWQ A; 
#chains in the Genus database with same CATH topology
 2W6M A;  2XCA A;  3LP8 A;  5HBR B;  1GSO A;  1KEE A;  4PDB A;  3GIL A;  1GYF A;  4FS1 A;  4JI8 H;  1K1Q A;  4DR7 H;  2R92 A;  4BY1 G;  2C00 A;  4EGQ A;  1T3N A;  5LXT F;  4I50 F;  5C3E G;  5D1O A;  3CQZ A;  5FLX W;  4Q8E A;  4YR2 A;  5DG7 A;  2OWO A;  1SFO A;  2V4R A;  3GTK A;  4JV2 A;  2W8L A;  5DG9 A;  4NXN H;  1KJI A;  3Q8R B;  3RFC A;  4CC6 A;  4JI7 H;  4Y8V B;  2W6N A;  2YW2 A;  4YJ2 F;  4YY3 H;  3PW2 A;  2CZG A;  4RUC A;  2C22 A;  2UUA H;  2ATL A;  1BNC A;  2BQ3 A;  1E4E B;  4L1K A;  3L4J A;  2VA3 A;  4IRK A;  4CC5 A;  4ECQ A;  4ED2 A;  2JA6 A;  4YP3 A;  3RUP A;  4DV7 H;  2AU0 A;  4R7R A;  2WE6 A;  4U7C A;  5FJ8 G;  2W9C B;  4DUY H;  3BQ1 A;  4RB3 C;  4FM9 A;  1JDE A;  1P8L A;  3UQ8 A;  4Q43 A;  3Q8P B;  5KFY A;  3HOX G;  3H0G A;  1RYR A;  4A3L G;  4UCO A;  2UXB H;  1E4F T;  2JEI A;  5KFL A;  4BBR G;  4EFB A;  1JIH A;  3HKZ A;  4EBD A;  1Z2P X;  2YRW A;  1O75 A;  4ME6 A;  4U6P A;  4MV8 A;  2JA7 A;  4BXX G;  3HBL A;  4GC7 A;  1GSH A;  4TV9 F;  4J9S A;  1OWT A;  3KXY T;  3K3P A;  4DV1 H;  4EEY A;  1N34 H;  1ZHQ A;  3MR6 A;  5FD5 A;  5EZY F;  2AGQ A;  1Y1W A;  4I7H A;  2AGP A;  3H20 A;  2AQ4 A;  3V4S A;  1JDB B;  2W6Z A;  3DF7 A;  5KKN B;  2R87 A;  2YS6 A;  2ZDH A;  3OSP A;  2W71 A;  4K0K H;  3LML A;  4QW9 A;  4KHP H;  2W7P A;  4I55 F;  4YBZ B;  4X64 H;  4ECY A;  1VAJ A;  4C5A A;  4ED8 A;  4QW8 A;  5KFC A;  5CA1 F;  3FDS A;  4ED7 A;  4LF7 H;  4UCR A;  5JH7 F;  2FPG B;  5C44 G;  2JEJ A;  2O03 A;  5CA0 F;  4ED6 A;  5IYC G;  4FBU A;  3GTG A;  5IYZ F;  1B33 N;  1WCM G;  3MFI A;  2W6O A;  4LF5 H;  2YRX A;  4ZQI A;  3T5H A;  4C5C A;  3TIN A;  5DQH A;  4F4Y A;  5DGA A;  1V51 A;  3KAK A;  3RTX A;  1VBG A;  5JVD F;  2C28 A;  2UVR A;  3HOZ G;  2RF4 A;  1BJT A;  3GID A;  3R23 A;  4ETS A;  1A9X A;  4ED1 A;  4DLK A;  3JRW A;  2VUM A;  5KFK A;  2NVY A;  1I7L A;  3QZ8 A;  3SI8 A;  1RK6 A;  2GPS A;  3J7A K;  3U9S A;  1VBH A;  1SEI A;  1IOW A;  1WR2 A;  2PN1 A;  2FMA A;  3KHH A;  4ECU A;  4AQY H;  3PN1 A;  3FMA A;  1XNQ H;  1EHI A;  3U9T A;  4YQW A;  3OTO H;  3BG5 A;  4J9K A;  1ZQ7 A;  2R82 A;  4R8U B;  5LMN H;  4LH6 A;  2W9C A;  2YS7 A;  2VQF H;  3GIK A;  3N44 B;  4LFC H;  1AUV A;  4TV8 F;  2RDJ A;  2SCU B;  4A3M G;  1KJ8 A;  1GGO A;  2UVV A;  3HOW G;  4IRD A;  3RJ0 A;  2IMW P;  2R84 A;  3NGD A;  1DIK A;  3R5H A;  4APM A;  4M7E A;  4HQ6 A;  4DV6 H;  4TQR A;  3KAL A;  3HB9 A;  4JI3 H;  5BR8 H;  1ZET A;  5KG4 A;  5DQI A;  5LMU H;  5DGB A;  1VKZ A;  5KG7 A;  5JUM A;  2PMZ A;  4RB0 A;  5KFJ A;  4MV1 A;  5KFD A;  2R6F A;  2VA2 A;  4X62 H;  1I6U A;  1RYS A;  4MV7 A;  2X0S A;  2VPS A;  5LYJ F;  2XCP A;  2BR0 A;  4DR2 H;  2PBZ A;  1CQJ B;  4JV0 A;  3HOY G;  2C35 B;  4A2A A;  1E4G T;  3JSL A;  3IG0 A;  1JLL B;  3VPC A;  1IBM H;  5FD6 A;  1TWH A;  2R8G A;  4JI1 H;  4O3O A;  2DIK A;  1V4Y A;  4WBN F;  5KFS A;  5L9X A;  5IWA H;  1RJQ A;  1Y14 B;  3UFX B;  4EFE A;  3IN5 A;  2HVS A;  4JI6 H;  5I47 A;  4YHH H;  4WD3 A;  3KAJ A;  3EPI A;  4YAJ B;  4EBE A;  4DL7 A;  4B3R H;  3T5J A;  1AN7 A;  4TUY F;  5D8D A;  2V9W A;  3K3V A;  4A3D G;  4ECW A;  5DG8 A;  2UU9 H;  4QIW E;  4ED3 A;  3GTQ A;  1KC7 A;  4XYL B;  3T1Y H;  5KT6 A;  4RNO A;  2VUM G;  3GIQ A;  5H80 A;  5KFP A;  3I4N G;  3AYH B;  4FU0 A;  1HR0 H;  4EG0 A;  4RZQ A;  2OH2 A;  4X65 H;  3H4B A;  1S9F A;  1JXL A;  2Q2T A;  4DV0 H;  3KTM A;  4RUA A;  3JRX A;  5KG5 A;  4MV4 A;  2RDI A;  3OHA A;  2UVU A;  1CS0 A;  1C3O A;  4QWB A;  5LL6 b;  4LF8 H;  5KT7 A;  5L1L A;  2XGQ A;  4YB8 B;  2YL2 A;  5EWE A;  1RK5 A;  2FPP B;  2WAQ E;  2YZG A;  1V9P A;  2HVQ A;  5GON F;  3OUZ A;  3GV5 B;  3HOV G;  1FJG H;  1MZB A;  4A3E G;  2VUG A;  2Y0S E;  1Y1V G;  3M4I A;  5FPO A;  3GQC A;  3KHR A;  3GTL A;  1Y1V A;  2HVR A;  4LSA A;  2FP4 B;  4J9L A;  1B6S A;  2DWC A;  3HXL A;  3I4M G;  4B3T H;  1I7N A;  5KG0 A;  2NUA B;  2XD4 A;  4ZHQ F;  5LP6 F;  5T14 A;  4JYA H;  4A3C G;  3MWD A;  1RJR A;  1B6R A;  1N48 A;  2ASL A;  1IBL H;  2JA7 G;  4O3Q A;  4O4H F;  2MCT A;  4RAY A;  1A0I A;  1E4E A;  1N33 H;  4J0M A;  2ZDG A;  5KFH A;  4A3J G;  3H0G G;  3BAA A;  1GSA A;  1S0M A;  2HHH H;  4LF9 H;  3PW5 A;  4GC6 A;  1ULZ A;  5F9L A;  2DLN A;  4UCU A;  2WB1 E;  4QWE A;  4OX9 H;  5KG1 A;  3H3V H;  3V6K A;  1R9T A;  5DLF A;  4MA0 A;  4AYB E;  3R5X A;  2RGR A;  1GO3 E;  2WTF A;  3ETJ A;  2WDT A;  4DL2 A;  1S97 A;  1KJ9 A;  4X66 H;  2NU8 B;  4IR9 A;  3EPG A;  4JI4 H;  4O2B F;  2E2I A;  5C1O A;  2ALZ A;  5KFR A;  2FKL A;  5L1K A;  4HNU A;  1JX4 A;  1HNX H;  2R8H A;  2FLP A;  2R7L A;  3KHG A;  4RB2 C;  3L2P A;  5L1J A;  5KFX A;  3VMM A;  3PW4 A;  3RGZ A;  5KFW A;  4DR5 H;  3TIG A;  5LOV F;  3G6X A;  3PZP A;  2ZDQ A;  2V59 A;  4QWC A;  5C5J A;  2E5L H;  5DLG A;  4XX0 B;  4ECV A;  2FLN A;  2UVW A;  4R8U A;  2R7M A;  1TWF A;  2GPW A;  3T5L A;  5DQG A;  1I50 A;  4ECS A;  4LFA H;  2JEF A;  4BWS C;  3RGX A;  4O3R A;  4TQS A;  2KSW A;  4F4W A;  2W7O A;  5D1O B;  3H40 A;  5KFV A;  2J6T A;  4A3I G;  5CAE B;  2VOB A;  2FB9 A;  1T94 A;  4DV4 H;  5KFA A;  3GTJ A;  4DR3 H;  2WYO A;  4ZI7 F;  4IWX A;  4DR4 H;  2XGP A;  4A3B G;  3ORQ A;  5JQW A;  2W70 A;  2YZM A;  5KFB A;  4JUZ A;  2J6U A;  3K5H A;  2IBK A;  3ORR A;  2XIG A;  2WAQ A;  1M0W A;  4UFZ A;  2VQD A;  3V4Z A;  5CB4 F;  5KFN A;  2NU7 B;  4RU9 A;  4Q44 A;  4MTD A;  2ZM6 H;  1WH2 A;  4DUZ H;  2V4Q A;  4HYK A;  4O3N A;  2R93 G;  3MR3 A;  2VPQ A;  2UXC H;  1UC9 A;  4FBT A;  2B63 A;  1ZHS A;  4ECR A;  2Y0S A;  3RBE A;  3N40 P;  1UC8 A;  1BGW A;  4EBC A;  3OSN A;  2Q2U A;  3F8N A;  2GLT A;  2I8C A;  3RB3 A;  2W9B B;  4HNT A;  5KFG A;  2AGO A;  3RAX A;  4JV1 A;  2FK3 A;  1RJP A;  4B3M H;  4GKJ H;  4A3K G;  3M9N B;  4B3S H;  3RF2 A;  5IT9 W;  5KFM A;  5IYD G;  3V6H A;  4LMY A;  4EEQ A;  2F4V H;  2RGV A;  2M05 A;  2YCH A;  2NU6 B;  4YR3 A;  2NVX A;  1IOV A;  3BQ2 A;  1VS0 A;  5KFI A;  4IRC A;  3M9O B;  3FKI G;  4A3F G;  2OLS A;  4LF6 H;  3MJF A;  3GIM A;  2R85 A;  3FKI A;  5J2T F;  1S68 A;  1M7J A;  2WB1 A;  4JI5 H;  4O4I F;  4MV9 A;  5FLM G;  2JA5 A;  2DPI A;  3J81 W;  3RBD A;  3RAQ A;  1M0T A;  4AYB A;  2DPJ A;  3RB4 A;  4LF4 H;  1JKJ B;  2I87 A;  1T36 A;  1TWA A;  1DGS A;  3G8C A;  4JI2 H;  3MWM A;  5C1P A;  2CKZ B;  1TWG A;  4J9Q A;  1S0O A;  5BPF A;  4YJ3 F;  1KJQ A;  2FK2 A;  1PX2 A;  3G6Y A;  3RV4 A;  2HJW A;  4DL6 A;  1S0N A;  3OUU A;  3PW7 A;  5KFE A;  1BXR A;  3JAM W;  4A3G G;  5L1I A;  2V58 A;  3GTO A;  4RNM A;  2YZN A;  4J9O A;  1TAE A;  3BA9 A;  4J9M A;  3GLK A;  4Q0Y A;  4UCV A;  2E2H A;  1XDN A;  2CW8 A;  5IYB G;  4IWY A;  3BJY A;  2JA6 G;  1X9N A;  2FPI B;  2B63 G;  4UCT A;  4LFB H;  2FJZ A;  4ZOL F;  2R7Z G;  1IBK H;  2UXD H;  5BMV F;  5EWF A;  5F9N A;  3OHB A;  3RIZ A;  2BQR A;  2DZD A;  1GLV A;  4BBS G;  2FK1 A;  4HNV A;  1KJJ A;  3WO1 A;  3HOU G;  5LA6 F;  4QJF A;  2HGS A;  3MR2 A;  4J9N A;  4EYH B;  2W57 A;  5KG2 A;  1AUX A;  4RB1 A;  5EDW A;  4HR7 A;  4QWA A;  2IA6 A;  4DR1 H;  2UUB H;  1EUC B;  1K1S A;  3TQ1 A;  1I94 H;  2P0A A;  4C5B A;  4IR1 A;  3MR5 A;  4G3I A;  3E5N A;  4IHJ F;  2QYZ A;  2ZJT A;  3JZI A;  3Q1K A;  1J5E H;  3N8D A;  3J80 W;  5KFU A;  3WO0 A;  2XCL A;  4ECZ A;  5EWG A;  2R7Z A;  3Q2O A;  2NU9 B;  3MFH A;  1S10 A;  3TII A;  5C8Y F;  4F50 A;  4LH7 A;  3SE7 A;  5KFT A;  4LSX A;  3RB6 A;  1XNR H;  3GIP A;  1WCM A;  1CE8 A;  3PO3 G;  3N42 B;  4BY7 G;  3K5I A;  5J2U F;  4MV3 A;  1PK8 A;  4O4L F;  5KFZ A;  2W9A A;  1M6V A;  4IAJ A;  3VPD A;  2C2D A;  5BPH A;  4Q45 A;  4O3S A;  5EOY A;  4MAM A;  4YR0 A;  4EGJ A;  4O2A F;  1N56 A;  5K2M A;  4JI0 H;  3RV3 A;  2JA5 G;  1Z2N X;  3RB0 A;  5KT3 A;  1Z2O X;  5KT2 A;  3N41 B;  2R86 A;  4F4Z A;  1KBL A;  3Q8S B;  4RNN A;  4IZO A;  1SYX B;  1FVI A;  1Y1W G;  3I12 A;  2BQU A;  5C4X G;  1EYZ A;  2PMZ E;  3Q8Q B;  4UCS A;  3GTP A;  2FLL A;  3GV7 B;  3GV8 B;  1SCU B;  1W96 A;  4MV6 A;  1HNW H;  1XMQ H;  3HKZ E;  2J9G A;  4YAK B;  4DV2 H;  1W93 A;  2JEG A;  3H4D A;  1FKA H;  2CQY A;  2IP4 A;  2W8K A;  3PW0 A;  4MTE A;  2YYA A;  1CQI B;  4GLX A;  2W6P A;  3BAB A;  3JSN A;  4DL3 A;  4E4T A;  5KT4 A;  4ECT A;  4ECX A;  4JV5 H;  2JA8 G;  4QWD A;  4A93 G;  3L4K A;  2R7N A;  4C2M A;  3ETH A;  5JVL A;  4MA5 A;  3T5K A;  2VQE H;  4Q8F A;  3BA8 A;  3V6J A;  1B04 A;  3M9M B;  4ED0 A;  1S03 G;  1C30 A;  1I3Q A;  3QZ7 A;  1XMO H;  2J6S A;  5D1P A;  3G6V A;  4QIW A;  1EZ1 A;  2FE3 A;  3C0F B;  4RAZ A;  3PVX A;  4I4T F;  3N6X A;  2CW7 A;  1TWC A;  4EYI B;  3WNZ A;  5KT5 A;  3PR4 A;  2R7K A;  3GII A;  5KG6 A;  1N36 H;  4DR6 H;  2R93 A;  4FS2 A;  3EYY A;  4XZ3 B;  3N43 B;  4RZR A;  5KFO A;  5KFF A;  1L2Z A;  1UNN C;  3GIJ A;  2V5A A;  1HNZ H;  4DV3 H;  3R5F A;  1WSC A;  5KG3 A;  4DL4 A;  2W9B A;  3MWE A;  1N32 H;  3VPB A;  5IP9 G;  2XC9 A;  2QK4 A;  4J9R A;  4O3P A;  2ASD A;  2UUC H;  2YU9 A;  2W6Q A;  4DL5 A;  3PR5 B;  4PWQ A;  1EUD B;  3LWB A;  3TQT A;  1DV2 A;  5KX5 F;  3BQ0 A;  4NLG A;  5HV6 A;  2C2E A;  2R92 G;  5KFQ A;  2R8J A;  4DV5 H;  4F4X A;  2PVP A;  2C2R A;  3PO2 G;  2I80 A;  3GTM A;  1TA8 A;  2VR1 A;  3KHL A;  4NXM H;  4A2B A;  3QFF A;  3T1H H;  3CVZ A;  2R8I A;  5IP7 G;  4XYM B;  5A2Q W;  1K83 A;  4J9P A;  2ASJ A;  5FPR A;  4GKK H;  1DV1 A;  4M9U A;  2R8K A; 
#chains in the Genus database with same CATH homology
 2FMA A;  1OWT A;  2M05 A;  2FK3 A;  2FK2 A;  2FJZ A;  3KTM A;  2FK1 A;  2FKL A;  4PWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...