2FKLA

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain (residues 126- 189 of app)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
ALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein precursor
publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 14
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12924 APP_Cu_bd Copper-binding of amyloid precursor, CuBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fklA00
2FMAA 2FK2A 2FK1A 2FJZA 2FK3A 3KTMA 1OWTA 4PWQA 2M05A 2FKLA
chains in the Genus database with same CATH superfamily
3WO0A 4LH7A 3OTOH 1AN7A 2Q2TA 5KFMA 3BA8A 3G6VA 4RU9A 5D1OA 4YR2A 1J5EH 2XGPA 1RK6A 2C2EA 2ZDHA 4HNTA 1EZ1A 2FPIB 3FKIG 2PN1A 4C5BA 2UVUA 3TIIA 3GIJA 2W8KA 5KG0A 1PX2A 4YAKB 3GLKA 4DV0H 4YBZB 2GPWA 4RNOA 4PDBA 2CW7A 4ED2A 1B33N 2UUCH 4F4YA 3H0GG 1SCUB 1W96A 3WNZA 5KG1A 2AGPA 5KT7A 5KFGA 2R8GA 2FB9A 2X0SA 1I6UA 3KHGA 4LFBH 3H20A 5L1KA 2CKZB 1C3OA 3QZ7A 3PO2G 1L2ZA 3MFIA 1T36A 2FP4B 1E4EA 2XC9A 4Q0YA 2DPJA 4GLXA 5KT5A 2SCUB 3GTOA 1JIHA 4A2AA 4GKJH 4B3TH 3HOZG 4MV6A 1B6RA 5KFTA 2WTFA 4EYIB 2NU8B 2ASLA 4A3JG 1IBMH 2IBKA 1IBLH 4A3BG 4RUCA 2FK2A 2IP4A 4RNMA 3E5NA 2E5LH 1E4GT 4DV7H 5C8YF 4J9KA 3M9OB 3PW5A 4L1KA 3J7AK 1K1SA 2C2RA 4QW9A 5DQGA 4QWBA 4X65H 2UXCH 2R84A 3UFXB 1KC7A 3GIPA 3GIKA 4FS2A 3HOXG 5J2TF 4R8UB 4JYAH 4YB8B 2QK4A 2NUAB 2UXDH 5KFUA 5IYBG 2R8KA 1WSCA 4RB0A 3R23A 3HOWG 2BR0A 4JI6H 2B63G 5JH7F 1C30A 2UUAH 2DWCA 2R7KA 5DQHA 4QWDA 1AUXA 3PO3G 4X62H 1XNQH 4ME6A 3RJ0A 2W7PA 1Y1WG 3OSNA 4YJ3F 4A2BA 3RB6A 2W9CB 5F9NA 4JI1H 4ECXA 4EFEA 1WR2A 2DZDA 3QFFA 5KG6A 2CZGA 4BXXG 3I12A 5FLMG 1BNCA 4DL7A 2F4VH 2YL2A 3FKIA 4YY3H 5KFNA 3V4ZA 3HOYG 2R7LA 5BR8H 4JV2A 1S97A 3ORRA 3GV7B 5A2QW 2J9GA 4M7EA 4ECTA 2ZJTA 4O3PA 2NVYA 1CQJB 1RJRA 1Z2OX 5KFLA 3H0GA 5EWFA 5EDWA 4RZRA 5C3EG 3RBDA 4DR2H 2FLLA 2VPQA 4IWXA 2ASDA 5DG8A 1V4YA 4DLKA 2XCPA 2VQEH 4MTDA 2AGQA 4C5CA 5KT2A 2I87A 2Y0SA 3TQTA 2VUGA 3UQ8A 3RGZA 2R85A 1S0OA 4I55F 4DR7H 2VUMG 5JVLA 4EYHB 3GV8B 2C00A 4LSXA 1S0MA 2W6ZA 4BWSC 4NXMH 3Q8RB 4B3MH 4CC5A 2DLNA 2XIGA 1SYXB 4XX0B 3L4KA 2V9WA 2R8JA 5DLFA 4LMYA 2O03A 4DL6A 1ZHSA 1IOVA 2NU9B 4AYBE 3RV3A 4JI0H 5KFQA 4ECRA 4O2BF 1T3NA 5BPFA 3N42B 4MV9A 5KFIA 2W6PA 3VMMA 4APMA 4DR1H 4ED8A 2WB1A 2UUBH 2NVXA 2FKLA 2HGSA 2I80A 1JKJB 2MCTA 4XYMB 4YJ2F 5KT3A 3Q8PB 3L4JA 1HNZH 2WYOA 3GILA 2VPSA 4MAMA 1KJJA 3RTXA 2J6SA 4IHJF 4EEQA 2GLTA 2VOBA 1K1QA 2HJWA 1EYZA 5CAEB 5H80A 1FKAH 2VQDA 3BAAA 5J2UF 4EBCA 1TA8A 2ZM6H 4MV7A 2YU9A 2I8CA 5LOVF 4TQRA 3FDSA 3RB4A 5IYZF 3HB9A 1UC9A 2PMZA 2ALZA 2IMWP 3PR4A 4IR1A 1I7NA 4JI7H 5JUMA 4IWYA 5IP7G 2AQ4A 2B63A 3GTMA 4GKKH 3OSPA 2CW8A 4E4TA 4F4WA 2JEFA 4XZ3B 4DR5H 5DG9A 4UFZA 4XYLB 5KFXA 4EG0A 4A3EG 4JUZA 1N48A 4FS1A 2R92G 1TWCA 5JQWA 4BBSG 1Y1WA 4K0KH 2Q2UA 5L1IA 2R93G 2VR1A 4ZHQF 4UCVA 4DV3H 4HYKA 1WH2A 4ZI7F 5DG7A 3GTPA 4J9PA 2W57A 3HBLA 5EZYF 2FK3A 2IA6A 1GSOA 1VAJA 4PWQA 4UCSA 4OX9H 4HR7A 3RB0A 2NU6B 4Q8EA 5KFWA 4FBUA 5KKNB 2WB1E 3AYHB 5C5JA 2R87A 1T94A 3BQ2A 2DIKA 3TINA 5KFFA 5HV6A 4O2AF 5FPOA 3GQCA 2RDJA 4O4HF 5L1LA 4JV1A 4J9OA 2WAQA 2J6TA 3K5IA 2OLSA 4NLGA 1TWHA 4DR4H 3JRXA 4HQ6A 1GYFA 1XDNA 5CA1F 4WBNF 5C1PA 3KHLA 2VUMA 4JI8H 3ETJA 5EWEA 3G6YA 2PMZE 2YS6A 2RDIA 3ORQA 4YAJB 2BQRA 3MJFA 4QW8A 3V6KA 4YQWA 2YZGA 1RYSA 3R5HA 4ED1A 5FD6A 5KFYA 2W9BB 3L2PA 2CQYA 2JEGA 2FPPB 5I47A 2V4RA 4J9MA 4J9LA 1R9TA 1ZQ7A 5KFZA 4DR6H 1HNWH 1KBLA 1XMOH 1EUDB 1TWAA 5EOYA 5C1OA 5KT6A 1ZHQA 2VQFH 4C2MA 2R7ZG 3GIIA 1UNNC 5KFHA 1I7LA 4A3FG 3H4DA 3T1YH 2R7MA 1N56A 4TQSA 1KJQA 5KFAA 1S03G 4MV1A 1M0TA 1GO3E 4M9UA 2WDTA 1Z2NX 3T5JA 5L9XA 5JVDF 1E4FT 5D1OB 1WCMG 5K2MA 4Q44A 3J81W 2OH2A 4MV8A 3RGXA 5FLXW 1GSAA 4DUYH 3BQ1A 3GV5B 1K83A 1EUCB 1AUVA 4EFBA 5KFJA 5KFEA 2XCAA 2HVQA 3RUPA 1Y14B 2HVRA 3MWDA 5LYJF 3KHRA 3SI8A 2R92A 5LMUH 3T1HH 1V51A 4ECVA 1JLLB 4LF4H 4IRDA 2R93A 4X64H 5T14A 1GSHA 1GLVA 2V4QA 4Y8VB 3PW0A 2YZNA 3EPGA 3FMAA 1JXLA 1E4EB 4A3DG 4QWCA 5IT9W 3KHHA 4HNVA 3PVXA 1EHIA 2P0AA 3H3VH 2NU7B 2YRWA 2FLNA 3T5LA 2BQ3A 2AU0A 4B3SH 5KFPA 3Q1KA 2YS7A 3LMLA 4ZQIA 2FK1A 3OUZA 4YHHH 1S10A 2XCLA 4Q8FA 3ETHA 1N34H 3N40P 2JA5G 1KEEA 5KFKA 4U6PA 5GONF 4RB3C 4JI5H 4JV5H 3Q2OA 1BJTA 1XMQH 4CC6A 2J6UA 3BG5A 2V58A 4A93G 4Q43A 3BJYA 4ECYA 5IYCG 1Z2PX 4DV6H 4RNNA 3T5HA 5KT4A 3M9NB 3KALA 2UVRA 5C4XG 5IP9G 1BGWA 3RF2A 4DV4H 4EEYA 2JEJA 2BQUA 1PK8A 4I4TF 3GTLA 3KAJA 3R5XA 4ECQA 5CA0F 3N43B 4IRCA 3PW7A 2C22A 3EYYA 3J80W 1S9FA 4RB1A 2JA7G 1N32H 2RGVA 3N6XA 5BMVF 4IRKA 4TUYF 4AQYH 4ED3A 4BY1G 3MR3A 1ZETA 2YZMA 3RIZA 4R8UA 2FE3A 4MA0A 2W6QA 5IYDG 3Q8QB 3RAQA 4JI4H 3RBEA 3HOUG 5DQIA 3M9MB 3U9SA 5LMNH 2JA6G 2Y0SE 1B6SA 4TV9F 2R7ZA 1RJQA 2VA2A 2DPIA 1UC8A 4JI2H 4LFCH 2UXBH 2R86A 5IWAH 4F4ZA 3RV4A 1ULZA 4RUAA 3V6JA 4A3KG 1MZBA 1WCMA 4O3SA 3TQ1A 2W9CA 4IR9A 1KJ8A 2M05A 3LWBA 4O3NA 2UVVA 1CQIB 5BPHA 4BY7G 4X66H 4HNUA 4DL5A 4A3IG 2C28A 3JAMW 4QIWA 1SEIA 4RAYA 3DF7A 2ZDQA 4UCOA 4DUZH 1S68A 4F50A 4DL2A 1W93A 4J9QA 4FBTA 2RGRA 4FM9A 4MA5A 3V4SA 3OHAA 3MR2A 2R7NA 1DIKA 1Y1VG 3PN1A 4I50F 4O4IF 4GC7A 3I4NG 5FJ8G 4MV4A 4J9RA 5CB4F 4FU0A 5KG7A 1RK5A 3I4MG 4ECZA 3HOVG 2YW2A 5C44G 2XD4A 4UCTA 3OUUA 4O3OA 4EBEA 4JV0A 5KG2A 4YR0A 3T5KA 3R5FA 4LFAH 3CVZA 1X9NA 4KHPH 4QJFA 2PBZA 3GTJA 3HXLA 2E2IA 1V9PA 2JA8G 1B04A 2GPSA 5KFOA 5DGBA 4O3QA 2UVWA 2JA5A 4J9SA 5LXTF 2C2DA 3WO1A 5KG3A 1DV2A 5KG5A 2YRXA 4LF9H 2R6FA 2YCHA 5HBRB 3NGDA 3RAXA 4DL3A 4O4LF 3G6XA 1I94H 4LF6H 4WD3A 2E2HA 3HKZA 5L1JA 4J0MA 2JEIA 1P8LA 4ED6A 1A9XA 4ED0A 3PR5B 4LH6A 5FD5A 3MR6A 4NXNH 3IG0A 2R82A 5KFRA 5EWGA 4QIWE 3C0FB 1RYRA 4ZOLF 3JRWA 4GC6A 3IN5A 1M7JA 4J9NA 1DV1A 5LP6F 2OWOA 2JA7A 4DV2H 4ECUA 4LF5H 3KAKA 2XGQA 1TWGA 4Q45A 5KX5F 3BA9A 3N8DA 3GTQA 4ECWA 2WAQE 3OHBA 4C5AA 5D8DA 1N36H 2W6MA 3LP8A 2JA6A 1KJ9A 4BBRG 4RAZA 3GTKA 5DGAA 4I7HA 1O75A 4QWAA 3GIDA 3N44B 1IBKH 2V5AA 3U9TA 4AYBA 2HVSA 2HHHH 1TWFA 1JDBB 1VBHA 4LSAA 3MWEA 5LA6F 1N33H 3EPIA 4MTEA 3H40A 3V6HA 2R8HA 3JSNA 5F9LA 1CS0A 4YR3A 3K5HA 3MR5A 5KFVA 3GTGA 1SFOA 3CQZA 2YYAA 3F8NA 2QYZA 2ZDGA 5DLGA 4DV1H 4F4XA 2W71A 3HKZE 3KTMA 4RZQA 1VKZA 5KFDA 4YP3A 3PW4A 2V59A 1BXRA 1Y1VA 4JI3H 2UU9H 2W7OA 4DR3H 5LL6b 4ETSA 4DV5H 1M6VA 3GIQA 1TAEA 4LF8H 2W8LA 1HNXH 3VPCA 4A3CG 3TIGA 3BQ0A 4O3RA 2PVPA 3KXYT 1I50A 5KG4A 4ECSA 4EBDA 4LF7H 3JZIA 2KSWA 2ATLA 5D1PA 4U7CA 1GGOA 4EGQA 4G3IA 5FPRA 1CE8A 4UCUA 2W70A 4IAJA 2VA3A 2WE6A 3BABA 3K3VA 2ASJA 4A3LG 3VPDA 2W6NA 1XNRH 3Q8SB 1A0IA 4IZOA 3N41B 3VPBA 3QZ8A 3MFHA 3K3PA 1JX4A 4R7RA 3MWMA 1M0WA 3SE7A 2R8IA 2FLPA 3RB3A 1VBGA 1HR0H 2AGOA 1VS0A 4MV3A 4UCRA 2W9BA 4DL4A 1KJIA 4ED7A 1FVIA 3H4BA 2FPGB 5KFSA 4A3GG 2W9AA 2FJZA 1OWTA 1IOWA 3PZPA 5KFCA 3PW2A 1JDEA 4RB2C 4A3MG 4EGJA 2FMAA 2W6OA 1S0NA 3M4IA 2RF4A 3G8CA 4TV8F 3RFCA 1FJGH 3JSLA 3GIMA 1I3QA 5KFBA 4QWEA 1DGSA 4B3RH 2C35B 1RJPA
chains in the Genus database with same CATH topology
2FMAA 2FK2A 2FK1A 2FJZA 2FK3A 3KTMA 1OWTA 4PWQA 2M05A 2FKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FMA A;  2FK2 A;  2FK1 A;  2FJZ A;  2FK3 A;  3KTM A;  1OWT A;  4PWQ A;  2M05 A;  2FKL A; 
#chains in the Genus database with same CATH topology
 3WO0 A;  4LH7 A;  3OTO H;  1AN7 A;  2Q2T A;  5KFM A;  3BA8 A;  3G6V A;  4RU9 A;  5D1O A;  4YR2 A;  1J5E H;  2XGP A;  1RK6 A;  2C2E A;  2ZDH A;  4HNT A;  1EZ1 A;  2FPI B;  3FKI G;  2PN1 A;  4C5B A;  2UVU A;  3TII A;  3GIJ A;  2W8K A;  5KG0 A;  1PX2 A;  4YAK B;  3GLK A;  4DV0 H;  4YBZ B;  2GPW A;  4RNO A;  4PDB A;  2CW7 A;  4ED2 A;  1B33 N;  2UUC H;  4F4Y A;  3H0G G;  1SCU B;  1W96 A;  3WNZ A;  5KG1 A;  2AGP A;  5KT7 A;  5KFG A;  2R8G A;  2FB9 A;  2X0S A;  1I6U A;  3KHG A;  4LFB H;  3H20 A;  5L1K A;  2CKZ B;  1C3O A;  3QZ7 A;  3PO2 G;  1L2Z A;  3MFI A;  1T36 A;  2FP4 B;  1E4E A;  2XC9 A;  4Q0Y A;  2DPJ A;  4GLX A;  5KT5 A;  2SCU B;  3GTO A;  1JIH A;  4A2A A;  4GKJ H;  4B3T H;  3HOZ G;  4MV6 A;  1B6R A;  5KFT A;  2WTF A;  4EYI B;  2NU8 B;  2ASL A;  4A3J G;  1IBM H;  2IBK A;  1IBL H;  4A3B G;  4RUC A;  2FK2 A;  2IP4 A;  4RNM A;  3E5N A;  2E5L H;  1E4G T;  4DV7 H;  5C8Y F;  4J9K A;  3M9O B;  3PW5 A;  4L1K A;  3J7A K;  1K1S A;  2C2R A;  4QW9 A;  5DQG A;  4QWB A;  4X65 H;  2UXC H;  2R84 A;  3UFX B;  1KC7 A;  3GIP A;  3GIK A;  4FS2 A;  3HOX G;  5J2T F;  4R8U B;  4JYA H;  4YB8 B;  2QK4 A;  2NUA B;  2UXD H;  5KFU A;  5IYB G;  2R8K A;  1WSC A;  4RB0 A;  3R23 A;  3HOW G;  2BR0 A;  4JI6 H;  2B63 G;  5JH7 F;  1C30 A;  2UUA H;  2DWC A;  2R7K A;  5DQH A;  4QWD A;  1AUX A;  3PO3 G;  4X62 H;  1XNQ H;  4ME6 A;  3RJ0 A;  2W7P A;  1Y1W G;  3OSN A;  4YJ3 F;  4A2B A;  3RB6 A;  2W9C B;  5F9N A;  4JI1 H;  4ECX A;  4EFE A;  1WR2 A;  2DZD A;  3QFF A;  5KG6 A;  2CZG A;  4BXX G;  3I12 A;  5FLM G;  1BNC A;  4DL7 A;  2F4V H;  2YL2 A;  3FKI A;  4YY3 H;  5KFN A;  3V4Z A;  3HOY G;  2R7L A;  5BR8 H;  4JV2 A;  1S97 A;  3ORR A;  3GV7 B;  5A2Q W;  2J9G A;  4M7E A;  4ECT A;  2ZJT A;  4O3P A;  2NVY A;  1CQJ B;  1RJR A;  1Z2O X;  5KFL A;  3H0G A;  5EWF A;  5EDW A;  4RZR A;  5C3E G;  3RBD A;  4DR2 H;  2FLL A;  2VPQ A;  4IWX A;  2ASD A;  5DG8 A;  1V4Y A;  4DLK A;  2XCP A;  2VQE H;  4MTD A;  2AGQ A;  4C5C A;  5KT2 A;  2I87 A;  2Y0S A;  3TQT A;  2VUG A;  3UQ8 A;  3RGZ A;  2R85 A;  1S0O A;  4I55 F;  4DR7 H;  2VUM G;  5JVL A;  4EYH B;  3GV8 B;  2C00 A;  4LSX A;  1S0M A;  2W6Z A;  4BWS C;  4NXM H;  3Q8R B;  4B3M H;  4CC5 A;  2DLN A;  2XIG A;  1SYX B;  4XX0 B;  3L4K A;  2V9W A;  2R8J A;  5DLF A;  4LMY A;  2O03 A;  4DL6 A;  1ZHS A;  1IOV A;  2NU9 B;  4AYB E;  3RV3 A;  4JI0 H;  5KFQ A;  4ECR A;  4O2B F;  1T3N A;  5BPF A;  3N42 B;  4MV9 A;  5KFI A;  2W6P A;  3VMM A;  4APM A;  4DR1 H;  4ED8 A;  2WB1 A;  2UUB H;  2NVX A;  2FKL A;  2HGS A;  2I80 A;  1JKJ B;  2MCT A;  4XYM B;  4YJ2 F;  5KT3 A;  3Q8P B;  3L4J A;  1HNZ H;  2WYO A;  3GIL A;  2VPS A;  4MAM A;  1KJJ A;  3RTX A;  2J6S A;  4IHJ F;  4EEQ A;  2GLT A;  2VOB A;  1K1Q A;  2HJW A;  1EYZ A;  5CAE B;  5H80 A;  1FKA H;  2VQD A;  3BAA A;  5J2U F;  4EBC A;  1TA8 A;  2ZM6 H;  4MV7 A;  2YU9 A;  2I8C A;  5LOV F;  4TQR A;  3FDS A;  3RB4 A;  5IYZ F;  3HB9 A;  1UC9 A;  2PMZ A;  2ALZ A;  2IMW P;  3PR4 A;  4IR1 A;  1I7N A;  4JI7 H;  5JUM A;  4IWY A;  5IP7 G;  2AQ4 A;  2B63 A;  3GTM A;  4GKK H;  3OSP A;  2CW8 A;  4E4T A;  4F4W A;  2JEF A;  4XZ3 B;  4DR5 H;  5DG9 A;  4UFZ A;  4XYL B;  5KFX A;  4EG0 A;  4A3E G;  4JUZ A;  1N48 A;  4FS1 A;  2R92 G;  1TWC A;  5JQW A;  4BBS G;  1Y1W A;  4K0K H;  2Q2U A;  5L1I A;  2R93 G;  2VR1 A;  4ZHQ F;  4UCV A;  4DV3 H;  4HYK A;  1WH2 A;  4ZI7 F;  5DG7 A;  3GTP A;  4J9P A;  2W57 A;  3HBL A;  5EZY F;  2FK3 A;  2IA6 A;  1GSO A;  1VAJ A;  4PWQ A;  4UCS A;  4OX9 H;  4HR7 A;  3RB0 A;  2NU6 B;  4Q8E A;  5KFW A;  4FBU A;  5KKN B;  2WB1 E;  3AYH B;  5C5J A;  2R87 A;  1T94 A;  3BQ2 A;  2DIK A;  3TIN A;  5KFF A;  5HV6 A;  4O2A F;  5FPO A;  3GQC A;  2RDJ A;  4O4H F;  5L1L A;  4JV1 A;  4J9O A;  2WAQ A;  2J6T A;  3K5I A;  2OLS A;  4NLG A;  1TWH A;  4DR4 H;  3JRX A;  4HQ6 A;  1GYF A;  1XDN A;  5CA1 F;  4WBN F;  5C1P A;  3KHL A;  2VUM A;  4JI8 H;  3ETJ A;  5EWE A;  3G6Y A;  2PMZ E;  2YS6 A;  2RDI A;  3ORQ A;  4YAJ B;  2BQR A;  3MJF A;  4QW8 A;  3V6K A;  4YQW A;  2YZG A;  1RYS A;  3R5H A;  4ED1 A;  5FD6 A;  5KFY A;  2W9B B;  3L2P A;  2CQY A;  2JEG A;  2FPP B;  5I47 A;  2V4R A;  4J9M A;  4J9L A;  1R9T A;  1ZQ7 A;  5KFZ A;  4DR6 H;  1HNW H;  1KBL A;  1XMO H;  1EUD B;  1TWA A;  5EOY A;  5C1O A;  5KT6 A;  1ZHQ A;  2VQF H;  4C2M A;  2R7Z G;  3GII A;  1UNN C;  5KFH A;  1I7L A;  4A3F G;  3H4D A;  3T1Y H;  2R7M A;  1N56 A;  4TQS A;  1KJQ A;  5KFA A;  1S03 G;  4MV1 A;  1M0T A;  1GO3 E;  4M9U A;  2WDT A;  1Z2N X;  3T5J A;  5L9X A;  5JVD F;  1E4F T;  5D1O B;  1WCM G;  5K2M A;  4Q44 A;  3J81 W;  2OH2 A;  4MV8 A;  3RGX A;  5FLX W;  1GSA A;  4DUY H;  3BQ1 A;  3GV5 B;  1K83 A;  1EUC B;  1AUV A;  4EFB A;  5KFJ A;  5KFE A;  2XCA A;  2HVQ A;  3RUP A;  1Y14 B;  2HVR A;  3MWD A;  5LYJ F;  3KHR A;  3SI8 A;  2R92 A;  5LMU H;  3T1H H;  1V51 A;  4ECV A;  1JLL B;  4LF4 H;  4IRD A;  2R93 A;  4X64 H;  5T14 A;  1GSH A;  1GLV A;  2V4Q A;  4Y8V B;  3PW0 A;  2YZN A;  3EPG A;  3FMA A;  1JXL A;  1E4E B;  4A3D G;  4QWC A;  5IT9 W;  3KHH A;  4HNV A;  3PVX A;  1EHI A;  2P0A A;  3H3V H;  2NU7 B;  2YRW A;  2FLN A;  3T5L A;  2BQ3 A;  2AU0 A;  4B3S H;  5KFP A;  3Q1K A;  2YS7 A;  3LML A;  4ZQI A;  2FK1 A;  3OUZ A;  4YHH H;  1S10 A;  2XCL A;  4Q8F A;  3ETH A;  1N34 H;  3N40 P;  2JA5 G;  1KEE A;  5KFK A;  4U6P A;  5GON F;  4RB3 C;  4JI5 H;  4JV5 H;  3Q2O A;  1BJT A;  1XMQ H;  4CC6 A;  2J6U A;  3BG5 A;  2V58 A;  4A93 G;  4Q43 A;  3BJY A;  4ECY A;  5IYC G;  1Z2P X;  4DV6 H;  4RNN A;  3T5H A;  5KT4 A;  3M9N B;  3KAL A;  2UVR A;  5C4X G;  5IP9 G;  1BGW A;  3RF2 A;  4DV4 H;  4EEY A;  2JEJ A;  2BQU A;  1PK8 A;  4I4T F;  3GTL A;  3KAJ A;  3R5X A;  4ECQ A;  5CA0 F;  3N43 B;  4IRC A;  3PW7 A;  2C22 A;  3EYY A;  3J80 W;  1S9F A;  4RB1 A;  2JA7 G;  1N32 H;  2RGV A;  3N6X A;  5BMV F;  4IRK A;  4TUY F;  4AQY H;  4ED3 A;  4BY1 G;  3MR3 A;  1ZET A;  2YZM A;  3RIZ A;  4R8U A;  2FE3 A;  4MA0 A;  2W6Q A;  5IYD G;  3Q8Q B;  3RAQ A;  4JI4 H;  3RBE A;  3HOU G;  5DQI A;  3M9M B;  3U9S A;  5LMN H;  2JA6 G;  2Y0S E;  1B6S A;  4TV9 F;  2R7Z A;  1RJQ A;  2VA2 A;  2DPI A;  1UC8 A;  4JI2 H;  4LFC H;  2UXB H;  2R86 A;  5IWA H;  4F4Z A;  3RV4 A;  1ULZ A;  4RUA A;  3V6J A;  4A3K G;  1MZB A;  1WCM A;  4O3S A;  3TQ1 A;  2W9C A;  4IR9 A;  1KJ8 A;  2M05 A;  3LWB A;  4O3N A;  2UVV A;  1CQI B;  5BPH A;  4BY7 G;  4X66 H;  4HNU A;  4DL5 A;  4A3I G;  2C28 A;  3JAM W;  4QIW A;  1SEI A;  4RAY A;  3DF7 A;  2ZDQ A;  4UCO A;  4DUZ H;  1S68 A;  4F50 A;  4DL2 A;  1W93 A;  4J9Q A;  4FBT A;  2RGR A;  4FM9 A;  4MA5 A;  3V4S A;  3OHA A;  3MR2 A;  2R7N A;  1DIK A;  1Y1V G;  3PN1 A;  4I50 F;  4O4I F;  4GC7 A;  3I4N G;  5FJ8 G;  4MV4 A;  4J9R A;  5CB4 F;  4FU0 A;  5KG7 A;  1RK5 A;  3I4M G;  4ECZ A;  3HOV G;  2YW2 A;  5C44 G;  2XD4 A;  4UCT A;  3OUU A;  4O3O A;  4EBE A;  4JV0 A;  5KG2 A;  4YR0 A;  3T5K A;  3R5F A;  4LFA H;  3CVZ A;  1X9N A;  4KHP H;  4QJF A;  2PBZ A;  3GTJ A;  3HXL A;  2E2I A;  1V9P A;  2JA8 G;  1B04 A;  2GPS A;  5KFO A;  5DGB A;  4O3Q A;  2UVW A;  2JA5 A;  4J9S A;  5LXT F;  2C2D A;  3WO1 A;  5KG3 A;  1DV2 A;  5KG5 A;  2YRX A;  4LF9 H;  2R6F A;  2YCH A;  5HBR B;  3NGD A;  3RAX A;  4DL3 A;  4O4L F;  3G6X A;  1I94 H;  4LF6 H;  4WD3 A;  2E2H A;  3HKZ A;  5L1J A;  4J0M A;  2JEI A;  1P8L A;  4ED6 A;  1A9X A;  4ED0 A;  3PR5 B;  4LH6 A;  5FD5 A;  3MR6 A;  4NXN H;  3IG0 A;  2R82 A;  5KFR A;  5EWG A;  4QIW E;  3C0F B;  1RYR A;  4ZOL F;  3JRW A;  4GC6 A;  3IN5 A;  1M7J A;  4J9N A;  1DV1 A;  5LP6 F;  2OWO A;  2JA7 A;  4DV2 H;  4ECU A;  4LF5 H;  3KAK A;  2XGQ A;  1TWG A;  4Q45 A;  5KX5 F;  3BA9 A;  3N8D A;  3GTQ A;  4ECW A;  2WAQ E;  3OHB A;  4C5A A;  5D8D A;  1N36 H;  2W6M A;  3LP8 A;  2JA6 A;  1KJ9 A;  4BBR G;  4RAZ A;  3GTK A;  5DGA A;  4I7H A;  1O75 A;  4QWA A;  3GID A;  3N44 B;  1IBK H;  2V5A A;  3U9T A;  4AYB A;  2HVS A;  2HHH H;  1TWF A;  1JDB B;  1VBH A;  4LSA A;  3MWE A;  5LA6 F;  1N33 H;  3EPI A;  4MTE A;  3H40 A;  3V6H A;  2R8H A;  3JSN A;  5F9L A;  1CS0 A;  4YR3 A;  3K5H A;  3MR5 A;  5KFV A;  3GTG A;  1SFO A;  3CQZ A;  2YYA A;  3F8N A;  2QYZ A;  2ZDG A;  5DLG A;  4DV1 H;  4F4X A;  2W71 A;  3HKZ E;  3KTM A;  4RZQ A;  1VKZ A;  5KFD A;  4YP3 A;  3PW4 A;  2V59 A;  1BXR A;  1Y1V A;  4JI3 H;  2UU9 H;  2W7O A;  4DR3 H;  5LL6 b;  4ETS A;  4DV5 H;  1M6V A;  3GIQ A;  1TAE A;  4LF8 H;  2W8L A;  1HNX H;  3VPC A;  4A3C G;  3TIG A;  3BQ0 A;  4O3R A;  2PVP A;  3KXY T;  1I50 A;  5KG4 A;  4ECS A;  4EBD A;  4LF7 H;  3JZI A;  2KSW A;  2ATL A;  5D1P A;  4U7C A;  1GGO A;  4EGQ A;  4G3I A;  5FPR A;  1CE8 A;  4UCU A;  2W70 A;  4IAJ A;  2VA3 A;  2WE6 A;  3BAB A;  3K3V A;  2ASJ A;  4A3L G;  3VPD A;  2W6N A;  1XNR H;  3Q8S B;  1A0I A;  4IZO A;  3N41 B;  3VPB A;  3QZ8 A;  3MFH A;  3K3P A;  1JX4 A;  4R7R A;  3MWM A;  1M0W A;  3SE7 A;  2R8I A;  2FLP A;  3RB3 A;  1VBG A;  1HR0 H;  2AGO A;  1VS0 A;  4MV3 A;  4UCR A;  2W9B A;  4DL4 A;  1KJI A;  4ED7 A;  1FVI A;  3H4B A;  2FPG B;  5KFS A;  4A3G G;  2W9A A;  2FJZ A;  1OWT A;  1IOW A;  3PZP A;  5KFC A;  3PW2 A;  1JDE A;  4RB2 C;  4A3M G;  4EGJ A;  2FMA A;  2W6O A;  1S0N A;  3M4I A;  2RF4 A;  3G8C A;  4TV8 F;  3RFC A;  1FJG H;  3JSL A;  3GIM A;  1I3Q A;  5KFB A;  4QWE A;  1DGS A;  4B3R H;  2C35 B;  1RJP A; 
#chains in the Genus database with same CATH homology
 2FMA A;  2FK2 A;  2FK1 A;  2FJZ A;  2FK3 A;  3KTM A;  1OWT A;  4PWQ A;  2M05 A;  2FKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...