2FKOA

Structure of ph1591 from pyrococcus horikoshii ot3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
MAIYEINGKKPRIHPSAFVDENAVVIGDVVLEEKTSVWPSAVLRGDIEQIYVGKYSNVQDNVSIHTSHGYPTEIGEYVTIGHNAMVHGAKVGNYVIIGISSVILDGAKIGDHVIIGAGAVVPPNKEIPDYSLVLGVPGKVVRQLTEEEIEWTKKNAEIYVELAEKHIKGRKRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 173aa long hypothetical ferripyochelin binding protein
publication title Observation of a calcium-binding site in the gamma-class carbonic anhydrase from Pyrococcus horikoshii.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Lyase
total genus 65
structure length 173
sequence length 173
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 2fkoA00
1T3DA 4J18A 4G3QA 1QRLA 2QIAA 3VBPA 1YP2A 1HV9A 2GGQA 2V0IA 2WLCA 3I3XA 3IXCA 5DEPA 5E3QA 3P1BA 1FXJA 3FSCA 3VBIA 3BXYA 3T57A 2WLFA 3HSQA 2P2OA 3FSYA 1SSQA 2OEFA 3MC4A 2QIVX 4N27A 2OI5A 4E1KA 2ICYA 4IHFA 3KWDA 5L6SA 3R1WA 1HM8A 4E75A 1KK5A 3R5AA 3MQHA 3DJ4A 4HZCA 1KHRA 3EH0A 3KWEA 3MQGA 4IHHA 1Z90A 5AFUV 4E6UA 3R0SA 2W0WA 4N6BA 1QQ0A 3BSYA 2WLEA 5L6VA 4M28A 5AFUU 3NZ2A 3OUPA 4KPXA 3R8YA 3C8VA 2IUAA 4ISXA 3IGJA 3TIOA 3PMOA 5E3RA 4EGGA 1MR9A 5ADXV 1YP4A 4M99A 4KNRA 3R5DA 4IHGA 2FKOA 2IU9A 2Q4JA 1J2ZA 4KPZA 3R3RA 2OI6A 4AC3A 3HJJA 4G87A 1OCXA 4R7PA 5DEMA 3OU9A 3F1XA 2TDTA 3FSXA 3FSBA 3ST8A 4MFGA 2RIJA 2I5KA 4J09A 3CJ8A 1SSTA 3BSWA 4M98A 4EABA 3EG4A 3BFPA 5E3PA 3FTTA 4M9CA 1HM9A 1MRLA 1XHDA 2IC7A 3I3AA 1KRRA 4G3PA 3TV0A 3P47A 4N69A 4HZDA 1KGTA 5DG3A 1TDTA 3SPTA 4EAAA 3JQYA 1QRMA 4G3SA 4R37A 5F42A 3VBJA 3TDTA 4EA8A 1HM0A 4MYOA 3R3IA 3TK8A 5ADXU 1KQAA 2VHEA 4K6RA 1G95A 4AAWA 2XATA 4HCQA 3VBLA 4FCEA 1QRFA 1KRUA 1LXAA 3D98A 2QKXA 3EEVA 4MZUA 4EQYA 2V0LA 3VBNA 2OI7A 3VNPA 1QRGA 1KGQA 4M2AA 2GGOA 2WLGA 3VBMA 4DCLA 3FS8A 2IU8A 2OEGA 2V0HA 3GOSA 3BRKX 3SRTA 1KK4A 2V0JA 3DHOA 4R36A 3GVDA 3TWDA 1KK6A 1V3WA 3FOQA 3OTMA 2JF3A 1FWYA 2WLDA 4KNXA 4KQLA 1KRVA 3BSSA 4E79A 1MR7A 2VD4A 4H7OA 3Q1XA 2V0KA 1V67A 3GUEA 1G97A 3DK5A 3FWWA 1S80A 4E6TA 5U2KA 4EA7A 4M2BA 2JF2A 3ECTA 1SSMA 2ICXA 4EA9A 1XATA 3KWCA 4HURA 1YP3A 3OTZA 3TISA 4HUSA 3OW5A 3R5BA 2NPOA 4AA7A 3R2WA 1THJA 4N6AA 2W0VA 3R5CA 3D8VA 2AQ9A 1QREA 3V4EA 3VBKA
chains in the Genus database with same CATH superfamily
1T3DA 4J18A 4G3QA 1QRLA 2QIAA 3VBPA 1YP2A 1HV9A 2GGQA 2V0IA 2WLCA 3I3XA 3IXCA 5DEPA 5E3QA 3SUCA 3P1BA 1FXJA 3FSCA 3VBIA 3BXYA 3T57A 3OH2A 2WLFA 3HSQA 2P2OA 3FSYA 1SSQA 2OEFA 3MC4A 2QIVX 4N27A 2OI5A 4E1KA 2ICYA 4IHFA 3KWDA 5L6SA 3R1WA 1HM8A 4E75A 1KK5A 3R5AA 3MQHA 3DJ4A 4HZCA 1KHRA 3EH0A 3KWEA 3MQGA 4IHHA 1Z90A 5AFUV 4E6UA 1EWWA 3R0SA 2W0WA 4N6BA 1QQ0A 3BSYA 2WLEA 5L6VA 4M28A 5AFUU 3NZ2A 3OUPA 4KPXA 3R8YA 3C8VA 2IUAA 4ISXA 3IGJA 3TIOA 3PMOA 5E3RA 4EGGA 1MR9A 5ADXV 1YP4A 4M99A 3OH0A 4KNRA 3R5DA 4IHGA 2FKOA 2IU9A 2Q4JA 1J2ZA 4KPZA 3R3RA 2OI6A 4AC3A 3HJJA 3OGZA 4G87A 1OCXA 4R7PA 5DEMA 3OU9A 3F1XA 2TDTA 3FSXA 3FSBA 3ST8A 4MFGA 2RIJA 2I5KA 4J09A 3GQAA 3CJ8A 1SSTA 3BSWA 4M98A 4EABA 3EG4A 3BFPA 5E3PA 3FTTA 4M9CA 1HM9A 1MRLA 1XHDA 2IC7A 3I3AA 1KRRA 4G3PA 3TV0A 3P47A 4N69A 4HZDA 1KGTA 5DG3A 1TDTA 3SPTA 4EAAA 3JQYA 1QRMA 4G3SA 4R37A 5F42A 3VBJA 1N4IA 3TDTA 4EA8A 1HM0A 4MYOA 3R3IA 3TK8A 5ADXU 1KQAA 2VHEA 4K6RA 1G95A 4AAWA 2XATA 4HCQA 3VBLA 4FCEA 1QRFA 1KRUA 1LXAA 3D98A 1M8NA 2QKXA 3EEVA 3GQ8A 4MZUA 4EQYA 2V0LA 3VBNA 2OI7A 3VNPA 1QRGA 1KGQA 4M2AA 2GGOA 2WLGA 3VBMA 4DCLA 3FS8A 2IU8A 2OEGA 2V0HA 3GOSA 3BRKX 3SRTA 1KK4A 2V0JA 3DHOA 4R36A 3GVDA 3TWDA 1KK6A 1V3WA 3FOQA 3OTMA 2JF3A 1FWYA 2WLDA 4KNXA 4KQLA 1KRVA 3BSSA 4E79A 1MR7A 3GQ9A 2VD4A 4H7OA 3Q1XA 2V0KA 1V67A 1L0SA 3GUEA 1G97A 3DK5A 3GQ7A 3FWWA 1S80A 3OH4A 4E6TA 5U2KA 4EA7A 4M2BA 2JF2A 3ECTA 3OH1A 1SSMA 2ICXA 4EA9A 1XATA 3KWCA 4HURA 1YP3A 3OTZA 3TISA 4HUSA 3OW5A 3R5BA 2NPOA 4AA7A 3OH3A 1THJA 1Z2FA 3R2WA 2W0VA 3R5CA 4N6AA 3D8VA 2AQ9A 1QREA 3V4EA 3VBKA
chains in the Genus database with same CATH topology
1T3DA 4J18A 4G3QA 1QRLA 2QIAA 3VBPA 1YP2A 1HV9A 2GGQA 2V0IA 2WLCA 3I3XA 3IXCA 5DEPA 5E3QA 3P1BA 1FXJA 3FSCA 3VBIA 3BXYA 3T57A 2WLFA 3HSQA 2P2OA 3FSYA 1SSQA 2OEFA 3MC4A 2QIVX 4N27A 2OI5A 4E1KA 2ICYA 4IHFA 3KWDA 5L6SA 3R1WA 1HM8A 4E75A 1KK5A 3R5AA 3MQHA 3DJ4A 4HZCA 1KHRA 3EH0A 3KWEA 3MQGA 4IHHA 1Z90A 5AFUV 4E6UA 3R0SA 2W0WA 4N6BA 1QQ0A 3BSYA 2WLEA 5L6VA 4M28A 5AFUU 3NZ2A 3OUPA 4KPXA 3R8YA 3C8VA 2IUAA 4ISXA 3IGJA 3TIOA 3PMOA 5E3RA 4EGGA 1MR9A 5ADXV 1YP4A 4M99A 4KNRA 3R5DA 4IHGA 2FKOA 2IU9A 2Q4JA 1J2ZA 4KPZA 3R3RA 2OI6A 4AC3A 3HJJA 4G87A 1OCXA 4R7PA 5DEMA 3OU9A 3F1XA 2TDTA 3FSXA 3FSBA 3ST8A 4MFGA 2RIJA 2I5KA 4J09A 3CJ8A 1SSTA 3BSWA 4M98A 4EABA 3EG4A 3BFPA 5E3PA 3FTTA 4M9CA 1HM9A 1MRLA 1XHDA 2IC7A 3I3AA 1KRRA 4G3PA 3TV0A 3P47A 4N69A 4HZDA 1KGTA 5DG3A 1TDTA 3SPTA 4EAAA 3JQYA 1QRMA 4G3SA 4R37A 5F42A 3VBJA 3TDTA 4EA8A 1HM0A 4MYOA 3R3IA 3TK8A 5ADXU 1KQAA 2VHEA 4K6RA 1G95A 4AAWA 2XATA 4HCQA 3VBLA 4FCEA 1QRFA 1KRUA 1LXAA 3D98A 2QKXA 3EEVA 4MZUA 4EQYA 2V0LA 3VBNA 2OI7A 3VNPA 1QRGA 1KGQA 4M2AA 2GGOA 2WLGA 3VBMA 4DCLA 3FS8A 2IU8A 2OEGA 2V0HA 3GOSA 3BRKX 3SRTA 1KK4A 2V0JA 3DHOA 4R36A 3GVDA 3TWDA 1KK6A 1V3WA 3FOQA 3OTMA 2JF3A 1FWYA 2WLDA 4KNXA 4KQLA 1KRVA 3BSSA 4E79A 1MR7A 2VD4A 4H7OA 3Q1XA 2V0KA 1V67A 3GUEA 1G97A 3DK5A 3FWWA 1S80A 4E6TA 5U2KA 4EA7A 4M2BA 2JF2A 3ECTA 1SSMA 2ICXA 4EA9A 1XATA 3KWCA 4HURA 1YP3A 3OTZA 3TISA 4HUSA 3OW5A 3R5BA 2NPOA 4AA7A 3R2WA 1THJA 4N6AA 2W0VA 3R5CA 3D8VA 2AQ9A 1QREA 3V4EA 3VBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3D A;  4J18 A;  4G3Q A;  1QRL A;  2QIA A;  3VBP A;  1YP2 A;  1HV9 A;  2GGQ A;  2V0I A;  2WLC A;  3I3X A;  3IXC A;  5DEP A;  5E3Q A;  3P1B A;  1FXJ A;  3FSC A;  3VBI A;  3BXY A;  3T57 A;  2WLF A;  3HSQ A;  2P2O A;  3FSY A;  1SSQ A;  2OEF A;  3MC4 A;  2QIV X;  4N27 A;  2OI5 A;  4E1K A;  2ICY A;  4IHF A;  3KWD A;  5L6S A;  3R1W A;  1HM8 A;  4E75 A;  1KK5 A;  3R5A A;  3MQH A;  3DJ4 A;  4HZC A;  1KHR A;  3EH0 A;  3KWE A;  3MQG A;  4IHH A;  1Z90 A;  5AFU V;  4E6U A;  3R0S A;  2W0W A;  4N6B A;  1QQ0 A;  3BSY A;  2WLE A;  5L6V A;  4M28 A;  5AFU U;  3NZ2 A;  3OUP A;  4KPX A;  3R8Y A;  3C8V A;  2IUA A;  4ISX A;  3IGJ A;  3TIO A;  3PMO A;  5E3R A;  4EGG A;  1MR9 A;  5ADX V;  1YP4 A;  4M99 A;  4KNR A;  3R5D A;  4IHG A;  2FKO A;  2IU9 A;  2Q4J A;  1J2Z A;  4KPZ A;  3R3R A;  2OI6 A;  4AC3 A;  3HJJ A;  4G87 A;  1OCX A;  4R7P A;  5DEM A;  3OU9 A;  3F1X A;  2TDT A;  3FSX A;  3FSB A;  3ST8 A;  4MFG A;  2RIJ A;  2I5K A;  4J09 A;  3CJ8 A;  1SST A;  3BSW A;  4M98 A;  4EAB A;  3EG4 A;  3BFP A;  5E3P A;  3FTT A;  4M9C A;  1HM9 A;  1MRL A;  1XHD A;  2IC7 A;  3I3A A;  1KRR A;  4G3P A;  3TV0 A;  3P47 A;  4N69 A;  4HZD A;  1KGT A;  5DG3 A;  1TDT A;  3SPT A;  4EAA A;  3JQY A;  1QRM A;  4G3S A;  4R37 A;  5F42 A;  3VBJ A;  3TDT A;  4EA8 A;  1HM0 A;  4MYO A;  3R3I A;  3TK8 A;  5ADX U;  1KQA A;  2VHE A;  4K6R A;  1G95 A;  4AAW A;  2XAT A;  4HCQ A;  3VBL A;  4FCE A;  1QRF A;  1KRU A;  1LXA A;  3D98 A;  2QKX A;  3EEV A;  4MZU A;  4EQY A;  2V0L A;  3VBN A;  2OI7 A;  3VNP A;  1QRG A;  1KGQ A;  4M2A A;  2GGO A;  2WLG A;  3VBM A;  4DCL A;  3FS8 A;  2IU8 A;  2OEG A;  2V0H A;  3GOS A;  3BRK X;  3SRT A;  1KK4 A;  2V0J A;  3DHO A;  4R36 A;  3GVD A;  3TWD A;  1KK6 A;  1V3W A;  3FOQ A;  3OTM A;  2JF3 A;  1FWY A;  2WLD A;  4KNX A;  4KQL A;  1KRV A;  3BSS A;  4E79 A;  1MR7 A;  2VD4 A;  4H7O A;  3Q1X A;  2V0K A;  1V67 A;  3GUE A;  1G97 A;  3DK5 A;  3FWW A;  1S80 A;  4E6T A;  5U2K A;  4EA7 A;  4M2B A;  2JF2 A;  3ECT A;  1SSM A;  2ICX A;  4EA9 A;  1XAT A;  3KWC A;  4HUR A;  1YP3 A;  3OTZ A;  3TIS A;  4HUS A;  3OW5 A;  3R5B A;  2NPO A;  4AA7 A;  3R2W A;  1THJ A;  4N6A A;  2W0V A;  3R5C A;  3D8V A;  2AQ9 A;  1QRE A;  3V4E A;  3VBK A; 
#chains in the Genus database with same CATH topology
 1T3D A;  4J18 A;  4G3Q A;  1QRL A;  2QIA A;  3VBP A;  1YP2 A;  1HV9 A;  2GGQ A;  2V0I A;  2WLC A;  3I3X A;  3IXC A;  5DEP A;  5E3Q A;  3SUC A;  3P1B A;  1FXJ A;  3FSC A;  3VBI A;  3BXY A;  3T57 A;  3OH2 A;  2WLF A;  3HSQ A;  2P2O A;  3FSY A;  1SSQ A;  2OEF A;  3MC4 A;  2QIV X;  4N27 A;  2OI5 A;  4E1K A;  2ICY A;  4IHF A;  3KWD A;  5L6S A;  3R1W A;  1HM8 A;  4E75 A;  1KK5 A;  3R5A A;  3MQH A;  3DJ4 A;  4HZC A;  1KHR A;  3EH0 A;  3KWE A;  3MQG A;  4IHH A;  1Z90 A;  5AFU V;  4E6U A;  1EWW A;  3R0S A;  2W0W A;  4N6B A;  1QQ0 A;  3BSY A;  2WLE A;  5L6V A;  4M28 A;  5AFU U;  3NZ2 A;  3OUP A;  4KPX A;  3R8Y A;  3C8V A;  2IUA A;  4ISX A;  3IGJ A;  3TIO A;  3PMO A;  5E3R A;  4EGG A;  1MR9 A;  5ADX V;  1YP4 A;  4M99 A;  3OH0 A;  4KNR A;  3R5D A;  4IHG A;  2FKO A;  2IU9 A;  2Q4J A;  1J2Z A;  4KPZ A;  3R3R A;  2OI6 A;  4AC3 A;  3HJJ A;  3OGZ A;  4G87 A;  1OCX A;  4R7P A;  5DEM A;  3OU9 A;  3F1X A;  2TDT A;  3FSX A;  3FSB A;  3ST8 A;  4MFG A;  2RIJ A;  2I5K A;  4J09 A;  3GQA A;  3CJ8 A;  1SST A;  3BSW A;  4M98 A;  4EAB A;  3EG4 A;  3BFP A;  5E3P A;  3FTT A;  4M9C A;  1HM9 A;  1MRL A;  1XHD A;  2IC7 A;  3I3A A;  1KRR A;  4G3P A;  3TV0 A;  3P47 A;  4N69 A;  4HZD A;  1KGT A;  5DG3 A;  1TDT A;  3SPT A;  4EAA A;  3JQY A;  1QRM A;  4G3S A;  4R37 A;  5F42 A;  3VBJ A;  1N4I A;  3TDT A;  4EA8 A;  1HM0 A;  4MYO A;  3R3I A;  3TK8 A;  5ADX U;  1KQA A;  2VHE A;  4K6R A;  1G95 A;  4AAW A;  2XAT A;  4HCQ A;  3VBL A;  4FCE A;  1QRF A;  1KRU A;  1LXA A;  3D98 A;  1M8N A;  2QKX A;  3EEV A;  3GQ8 A;  4MZU A;  4EQY A;  2V0L A;  3VBN A;  2OI7 A;  3VNP A;  1QRG A;  1KGQ A;  4M2A A;  2GGO A;  2WLG A;  3VBM A;  4DCL A;  3FS8 A;  2IU8 A;  2OEG A;  2V0H A;  3GOS A;  3BRK X;  3SRT A;  1KK4 A;  2V0J A;  3DHO A;  4R36 A;  3GVD A;  3TWD A;  1KK6 A;  1V3W A;  3FOQ A;  3OTM A;  2JF3 A;  1FWY A;  2WLD A;  4KNX A;  4KQL A;  1KRV A;  3BSS A;  4E79 A;  1MR7 A;  3GQ9 A;  2VD4 A;  4H7O A;  3Q1X A;  2V0K A;  1V67 A;  1L0S A;  3GUE A;  1G97 A;  3DK5 A;  3GQ7 A;  3FWW A;  1S80 A;  3OH4 A;  4E6T A;  5U2K A;  4EA7 A;  4M2B A;  2JF2 A;  3ECT A;  3OH1 A;  1SSM A;  2ICX A;  4EA9 A;  1XAT A;  3KWC A;  4HUR A;  1YP3 A;  3OTZ A;  3TIS A;  4HUS A;  3OW5 A;  3R5B A;  2NPO A;  4AA7 A;  3OH3 A;  1THJ A;  1Z2F A;  3R2W A;  2W0V A;  3R5C A;  4N6A A;  3D8V A;  2AQ9 A;  1QRE A;  3V4E A;  3VBK A; 
#chains in the Genus database with same CATH homology
 1T3D A;  4J18 A;  4G3Q A;  1QRL A;  2QIA A;  3VBP A;  1YP2 A;  1HV9 A;  2GGQ A;  2V0I A;  2WLC A;  3I3X A;  3IXC A;  5DEP A;  5E3Q A;  3P1B A;  1FXJ A;  3FSC A;  3VBI A;  3BXY A;  3T57 A;  2WLF A;  3HSQ A;  2P2O A;  3FSY A;  1SSQ A;  2OEF A;  3MC4 A;  2QIV X;  4N27 A;  2OI5 A;  4E1K A;  2ICY A;  4IHF A;  3KWD A;  5L6S A;  3R1W A;  1HM8 A;  4E75 A;  1KK5 A;  3R5A A;  3MQH A;  3DJ4 A;  4HZC A;  1KHR A;  3EH0 A;  3KWE A;  3MQG A;  4IHH A;  1Z90 A;  5AFU V;  4E6U A;  3R0S A;  2W0W A;  4N6B A;  1QQ0 A;  3BSY A;  2WLE A;  5L6V A;  4M28 A;  5AFU U;  3NZ2 A;  3OUP A;  4KPX A;  3R8Y A;  3C8V A;  2IUA A;  4ISX A;  3IGJ A;  3TIO A;  3PMO A;  5E3R A;  4EGG A;  1MR9 A;  5ADX V;  1YP4 A;  4M99 A;  4KNR A;  3R5D A;  4IHG A;  2FKO A;  2IU9 A;  2Q4J A;  1J2Z A;  4KPZ A;  3R3R A;  2OI6 A;  4AC3 A;  3HJJ A;  4G87 A;  1OCX A;  4R7P A;  5DEM A;  3OU9 A;  3F1X A;  2TDT A;  3FSX A;  3FSB A;  3ST8 A;  4MFG A;  2RIJ A;  2I5K A;  4J09 A;  3CJ8 A;  1SST A;  3BSW A;  4M98 A;  4EAB A;  3EG4 A;  3BFP A;  5E3P A;  3FTT A;  4M9C A;  1HM9 A;  1MRL A;  1XHD A;  2IC7 A;  3I3A A;  1KRR A;  4G3P A;  3TV0 A;  3P47 A;  4N69 A;  4HZD A;  1KGT A;  5DG3 A;  1TDT A;  3SPT A;  4EAA A;  3JQY A;  1QRM A;  4G3S A;  4R37 A;  5F42 A;  3VBJ A;  3TDT A;  4EA8 A;  1HM0 A;  4MYO A;  3R3I A;  3TK8 A;  5ADX U;  1KQA A;  2VHE A;  4K6R A;  1G95 A;  4AAW A;  2XAT A;  4HCQ A;  3VBL A;  4FCE A;  1QRF A;  1KRU A;  1LXA A;  3D98 A;  2QKX A;  3EEV A;  4MZU A;  4EQY A;  2V0L A;  3VBN A;  2OI7 A;  3VNP A;  1QRG A;  1KGQ A;  4M2A A;  2GGO A;  2WLG A;  3VBM A;  4DCL A;  3FS8 A;  2IU8 A;  2OEG A;  2V0H A;  3GOS A;  3BRK X;  3SRT A;  1KK4 A;  2V0J A;  3DHO A;  4R36 A;  3GVD A;  3TWD A;  1KK6 A;  1V3W A;  3FOQ A;  3OTM A;  2JF3 A;  1FWY A;  2WLD A;  4KNX A;  4KQL A;  1KRV A;  3BSS A;  4E79 A;  1MR7 A;  2VD4 A;  4H7O A;  3Q1X A;  2V0K A;  1V67 A;  3GUE A;  1G97 A;  3DK5 A;  3FWW A;  1S80 A;  4E6T A;  5U2K A;  4EA7 A;  4M2B A;  2JF2 A;  3ECT A;  1SSM A;  2ICX A;  4EA9 A;  1XAT A;  3KWC A;  4HUR A;  1YP3 A;  3OTZ A;  3TIS A;  4HUS A;  3OW5 A;  3R5B A;  2NPO A;  4AA7 A;  3R2W A;  1THJ A;  4N6A A;  2W0V A;  3R5C A;  3D8V A;  2AQ9 A;  1QRE A;  3V4E A;  3VBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...