2FKOA

Structure of ph1591 from pyrococcus horikoshii ot3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
b'MAIYEINGKKPRIHPSAFVDENAVVIGDVVLEEKTSVWPSAVLRGDIEQIYVGKYSNVQDNVSIHTSHGYPTEIGEYVTIGHNAMVHGAKVGNYVIIGISSVILDGAKIGDHVIIGAGAVVPPNKEIPDYSLVLGVPGKVVRQLTEEEIEWTKKNAEIYVELAEKHIKGRKRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 173aa long hypothetical ferripyochelin binding protein
publication title Observation of a calcium-binding site in the gamma-class carbonic anhydrase from Pyrococcus horikoshii.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Lyase
total genus 65
structure length 173
sequence length 173
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 2fkoA00
1KK4A 1THJA 5DG3A 3D8VA 4KNXA 2TDTA 3MC4A 2WLFA 2OI5A 3DHOA 4EA9A 4G3SA 3HSQA 2ICYA 4M9CA 3VBKA 3BSSA 4G3PA 3IXCA 5DEPA 1J2ZA 2QIAA 2OEGA 3GUEA 3VBIA 1MR7A 3FSXA 2V0KA 1KRUA 3TDTA 1FXJA 3GOSA 4AA7A 3EH0A 4M2AA 4HCQA 4IHFA 3FSYA 3I3XA 1YP3A 3BXYA 4IHGA 1OCXA 3R1WA 3VBJA 1KGQA 3MQGA 3TIOA 4AAWA 3FSCA 1HM8A 5ADXV 3FOQA 3FWWA 2NPOA 4R7PA 3BFPA 2W0WA 3DJ4A 2IC7A 3PMOA 5DEMA 2JF3A 3R5DA 4N27A 2OEFA 2I5KA 3CJ8A 1QRGA 2VD4A 3R5BA 4M98A 4HZCA 3R0SA 4H7OA 2FKOA 1FWYA 1KGTA 5AFUU 1QREA 5AFUV 2IU9A 3VBMA 2V0JA 5L6SA 4N69A 1KRVA 3P47A 4MZUA 3C8VA 5U2KA 4M2BA 3KWDA 1G95A 1HM9A 2WLEA 3TV0A 3Q1XA 4E6UA 1HV9A 3FS8A 3VNPA 4J18A 1Z90A 5E3PA 3MQHA 1TDTA 3KWEA 4MYOA 1QRLA 3OU9A 2V0HA 3IGJA 4IHHA 4EAAA 2RIJA 2OI7A 5ADXU 1SSTA 5L6VA 1LXAA 3R3RA 1HM0A 3BRKX 3SRTA 1KK5A 3I3AA 4E1KA 4R36A 4E79A 4M99A 1SSQA 1SSMA 4HURA 2V0IA 3NZ2A 3EG4A 3P1BA 1S80A 2AQ9A 1MRLA 3FSBA 2QKXA 2OI6A 4N6AA 2ICXA 2GGOA 2WLDA 4N6BA 4DCLA 3D98A 3OTMA 3TK8A 3KWCA 3OUPA 2GGQA 3FTTA 1KHRA 1V3WA 3R8YA 3GVDA 4AC3A 1KK6A 3F1XA 2WLCA 2XATA 1KQAA 2JF2A 3T57A 4R37A 3OTZA 2IU8A 4G87A 1YP2A 3TISA 4ISXA 2IUAA 4MFGA 3SPTA 4FCEA 4E6TA 4KQLA 2V0LA 4K6RA 3VBLA 2VHEA 3ECTA 3JQYA 3EEVA 1V67A 3BSWA 2W0VA 4KNRA 5E3RA 3TWDA 3V4EA 3R2WA 1KRRA 4EA7A 4E75A 1MR9A 3BSYA 4G3QA 1QQ0A 1QRFA 4HUSA 3HJJA 4M28A 3DK5A 4EGGA 2QIVX 3VBNA 3OW5A 2WLGA 4HZDA 4EQYA 4EABA 4KPZA 3VBPA 3ST8A 1QRMA 4EA8A 5F42A 3R3IA 4KPXA 1XATA 1XHDA 4J09A 2P2OA 1YP4A 3R5AA 5E3QA 2Q4JA 3R5CA 1T3DA 1G97A
chains in the Genus database with same CATH superfamily
1KK4A 1THJA 5DG3A 3D8VA 4KNXA 2TDTA 1N4IA 3MC4A 2WLFA 2OI5A 3DHOA 4EA9A 4G3SA 3HSQA 2ICYA 4M9CA 3VBKA 3BSSA 4G3PA 3IXCA 5DEPA 1J2ZA 2QIAA 2OEGA 3GUEA 3VBIA 1MR7A 3FSXA 2V0KA 1KRUA 3TDTA 5ADXV 1FXJA 3GOSA 4AA7A 3EH0A 4M2AA 4HCQA 4IHFA 3OH3A 3FSYA 3I3XA 1YP3A 3BXYA 4IHGA 1OCXA 3GQAA 3R1WA 3VBJA 1KGQA 3MQGA 3TIOA 4AAWA 3FSCA 1HM8A 3GQ7A 3FOQA 3FWWA 2NPOA 1Z2FA 3BFPA 2W0WA 3DJ4A 4R7PA 2IC7A 3PMOA 3OGZA 2JF3A 3R5DA 4N27A 5DEMA 2OEFA 2I5KA 3CJ8A 1QRGA 2VD4A 3R5BA 4M98A 4HZCA 1L0SA 1M8NA 3GQ9A 3R0SA 4H7OA 2FKOA 1FWYA 1KGTA 5AFUU 1QREA 5AFUV 2IU9A 3VBMA 2V0JA 5L6SA 4N69A 1KRVA 3P47A 4MZUA 3C8VA 5U2KA 4M2BA 3KWDA 1G95A 1HM9A 2WLEA 3TV0A 3Q1XA 4E6UA 1HV9A 3FS8A 3VNPA 4J18A 1Z90A 5E3PA 3MQHA 1TDTA 3KWEA 4MYOA 1QRLA 3OU9A 2V0HA 3IGJA 4IHHA 4EAAA 2RIJA 2OI7A 5ADXU 1SSTA 5L6VA 1LXAA 3R3RA 1HM0A 3BRKX 3SRTA 1KK5A 3I3AA 4E1KA 4R36A 4E79A 4M99A 1SSQA 1SSMA 4HURA 3GQ8A 2V0IA 3NZ2A 3EG4A 3P1BA 1S80A 2AQ9A 1MRLA 3FSBA 2QKXA 2OI6A 4N6AA 2ICXA 2GGOA 2WLDA 4N6BA 4DCLA 3D98A 3OTMA 3TK8A 3KWCA 3OUPA 2GGQA 3FTTA 1KHRA 1V3WA 3R8YA 3GVDA 4AC3A 1KK6A 3F1XA 2WLCA 2XATA 1KQAA 2JF2A 3T57A 4R37A 3OTZA 2IU8A 4G87A 1YP2A 3TISA 4ISXA 2IUAA 4MFGA 3SPTA 4FCEA 4E6TA 4KQLA 2V0LA 4K6RA 3VBLA 2VHEA 3ECTA 3JQYA 3EEVA 3OH2A 1V67A 3BSWA 2W0VA 4KNRA 5E3RA 3TWDA 3V4EA 3R2WA 3OH1A 1KRRA 4EA7A 4E75A 1MR9A 3BSYA 4G3QA 1QQ0A 1QRFA 4HUSA 3HJJA 4M28A 3DK5A 4EGGA 2QIVX 3SUCA 3OW5A 3VBNA 2WLGA 4HZDA 4EQYA 4EABA 4KPZA 3VBPA 3ST8A 1EWWA 1QRMA 4EA8A 5F42A 3R3IA 4KPXA 1XATA 3OH0A 1XHDA 4J09A 3OH4A 2P2OA 1YP4A 3R5AA 5E3QA 2Q4JA 3R5CA 1T3DA 1G97A
chains in the Genus database with same CATH topology
1KK4A 1THJA 5DG3A 3D8VA 4KNXA 2TDTA 3MC4A 2WLFA 2OI5A 3DHOA 4EA9A 4G3SA 3HSQA 2ICYA 4M9CA 3VBKA 3BSSA 4G3PA 3IXCA 5DEPA 1J2ZA 2QIAA 2OEGA 3GUEA 3VBIA 1MR7A 3FSXA 2V0KA 1KRUA 3TDTA 1FXJA 3GOSA 4AA7A 3EH0A 4M2AA 4HCQA 4IHFA 3FSYA 3I3XA 1YP3A 3BXYA 4IHGA 1OCXA 3R1WA 3VBJA 1KGQA 3MQGA 3TIOA 4AAWA 3FSCA 1HM8A 5ADXV 3FOQA 3FWWA 2NPOA 4R7PA 3BFPA 2W0WA 3DJ4A 2IC7A 3PMOA 5DEMA 2JF3A 3R5DA 4N27A 2OEFA 2I5KA 3CJ8A 1QRGA 2VD4A 3R5BA 4M98A 4HZCA 3R0SA 4H7OA 2FKOA 1FWYA 1KGTA 5AFUU 1QREA 5AFUV 2IU9A 3VBMA 2V0JA 5L6SA 4N69A 1KRVA 3P47A 4MZUA 3C8VA 5U2KA 4M2BA 3KWDA 1G95A 1HM9A 2WLEA 3TV0A 3Q1XA 4E6UA 1HV9A 3FS8A 3VNPA 4J18A 1Z90A 5E3PA 3MQHA 1TDTA 3KWEA 4MYOA 1QRLA 3OU9A 2V0HA 3IGJA 4IHHA 4EAAA 2RIJA 2OI7A 5ADXU 1SSTA 5L6VA 1LXAA 3R3RA 1HM0A 3BRKX 3SRTA 1KK5A 3I3AA 4E1KA 4R36A 4E79A 4M99A 1SSQA 1SSMA 4HURA 2V0IA 3NZ2A 3EG4A 3P1BA 1S80A 2AQ9A 1MRLA 3FSBA 2QKXA 2OI6A 4N6AA 2ICXA 2GGOA 2WLDA 4N6BA 4DCLA 3D98A 3OTMA 3TK8A 3KWCA 3OUPA 2GGQA 3FTTA 1KHRA 1V3WA 3R8YA 3GVDA 4AC3A 1KK6A 3F1XA 2WLCA 2XATA 1KQAA 2JF2A 3T57A 4R37A 3OTZA 2IU8A 4G87A 1YP2A 3TISA 4ISXA 2IUAA 4MFGA 3SPTA 4FCEA 4E6TA 4KQLA 2V0LA 4K6RA 3VBLA 2VHEA 3ECTA 3JQYA 3EEVA 1V67A 3BSWA 2W0VA 4KNRA 5E3RA 3TWDA 3V4EA 3R2WA 1KRRA 4EA7A 4E75A 1MR9A 3BSYA 4G3QA 1QQ0A 1QRFA 4HUSA 3HJJA 4M28A 3DK5A 4EGGA 2QIVX 3VBNA 3OW5A 2WLGA 4HZDA 4EQYA 4EABA 4KPZA 3VBPA 3ST8A 1QRMA 4EA8A 5F42A 3R3IA 4KPXA 1XATA 1XHDA 4J09A 2P2OA 1YP4A 3R5AA 5E3QA 2Q4JA 3R5CA 1T3DA 1G97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KK4 A;  1THJ A;  5DG3 A;  3D8V A;  4KNX A;  2TDT A;  3MC4 A;  2WLF A;  2OI5 A;  3DHO A;  4EA9 A;  4G3S A;  3HSQ A;  2ICY A;  4M9C A;  3VBK A;  3BSS A;  4G3P A;  3IXC A;  5DEP A;  1J2Z A;  2QIA A;  2OEG A;  3GUE A;  3VBI A;  1MR7 A;  3FSX A;  2V0K A;  1KRU A;  3TDT A;  1FXJ A;  3GOS A;  4AA7 A;  3EH0 A;  4M2A A;  4HCQ A;  4IHF A;  3FSY A;  3I3X A;  1YP3 A;  3BXY A;  4IHG A;  1OCX A;  3R1W A;  3VBJ A;  1KGQ A;  3MQG A;  3TIO A;  4AAW A;  3FSC A;  1HM8 A;  5ADX V;  3FOQ A;  3FWW A;  2NPO A;  4R7P A;  3BFP A;  2W0W A;  3DJ4 A;  2IC7 A;  3PMO A;  5DEM A;  2JF3 A;  3R5D A;  4N27 A;  2OEF A;  2I5K A;  3CJ8 A;  1QRG A;  2VD4 A;  3R5B A;  4M98 A;  4HZC A;  3R0S A;  4H7O A;  2FKO A;  1FWY A;  1KGT A;  5AFU U;  1QRE A;  5AFU V;  2IU9 A;  3VBM A;  2V0J A;  5L6S A;  4N69 A;  1KRV A;  3P47 A;  4MZU A;  3C8V A;  5U2K A;  4M2B A;  3KWD A;  1G95 A;  1HM9 A;  2WLE A;  3TV0 A;  3Q1X A;  4E6U A;  1HV9 A;  3FS8 A;  3VNP A;  4J18 A;  1Z90 A;  5E3P A;  3MQH A;  1TDT A;  3KWE A;  4MYO A;  1QRL A;  3OU9 A;  2V0H A;  3IGJ A;  4IHH A;  4EAA A;  2RIJ A;  2OI7 A;  5ADX U;  1SST A;  5L6V A;  1LXA A;  3R3R A;  1HM0 A;  3BRK X;  3SRT A;  1KK5 A;  3I3A A;  4E1K A;  4R36 A;  4E79 A;  4M99 A;  1SSQ A;  1SSM A;  4HUR A;  2V0I A;  3NZ2 A;  3EG4 A;  3P1B A;  1S80 A;  2AQ9 A;  1MRL A;  3FSB A;  2QKX A;  2OI6 A;  4N6A A;  2ICX A;  2GGO A;  2WLD A;  4N6B A;  4DCL A;  3D98 A;  3OTM A;  3TK8 A;  3KWC A;  3OUP A;  2GGQ A;  3FTT A;  1KHR A;  1V3W A;  3R8Y A;  3GVD A;  4AC3 A;  1KK6 A;  3F1X A;  2WLC A;  2XAT A;  1KQA A;  2JF2 A;  3T57 A;  4R37 A;  3OTZ A;  2IU8 A;  4G87 A;  1YP2 A;  3TIS A;  4ISX A;  2IUA A;  4MFG A;  3SPT A;  4FCE A;  4E6T A;  4KQL A;  2V0L A;  4K6R A;  3VBL A;  2VHE A;  3ECT A;  3JQY A;  3EEV A;  1V67 A;  3BSW A;  2W0V A;  4KNR A;  5E3R A;  3TWD A;  3V4E A;  3R2W A;  1KRR A;  4EA7 A;  4E75 A;  1MR9 A;  3BSY A;  4G3Q A;  1QQ0 A;  1QRF A;  4HUS A;  3HJJ A;  4M28 A;  3DK5 A;  4EGG A;  2QIV X;  3VBN A;  3OW5 A;  2WLG A;  4HZD A;  4EQY A;  4EAB A;  4KPZ A;  3VBP A;  3ST8 A;  1QRM A;  4EA8 A;  5F42 A;  3R3I A;  4KPX A;  1XAT A;  1XHD A;  4J09 A;  2P2O A;  1YP4 A;  3R5A A;  5E3Q A;  2Q4J A;  3R5C A;  1T3D A;  1G97 A; 
#chains in the Genus database with same CATH topology
 1KK4 A;  1THJ A;  5DG3 A;  3D8V A;  4KNX A;  2TDT A;  1N4I A;  3MC4 A;  2WLF A;  2OI5 A;  3DHO A;  4EA9 A;  4G3S A;  3HSQ A;  2ICY A;  4M9C A;  3VBK A;  3BSS A;  4G3P A;  3IXC A;  5DEP A;  1J2Z A;  2QIA A;  2OEG A;  3GUE A;  3VBI A;  1MR7 A;  3FSX A;  2V0K A;  1KRU A;  3TDT A;  5ADX V;  1FXJ A;  3GOS A;  4AA7 A;  3EH0 A;  4M2A A;  4HCQ A;  4IHF A;  3OH3 A;  3FSY A;  3I3X A;  1YP3 A;  3BXY A;  4IHG A;  1OCX A;  3GQA A;  3R1W A;  3VBJ A;  1KGQ A;  3MQG A;  3TIO A;  4AAW A;  3FSC A;  1HM8 A;  3GQ7 A;  3FOQ A;  3FWW A;  2NPO A;  1Z2F A;  3BFP A;  2W0W A;  3DJ4 A;  4R7P A;  2IC7 A;  3PMO A;  3OGZ A;  2JF3 A;  3R5D A;  4N27 A;  5DEM A;  2OEF A;  2I5K A;  3CJ8 A;  1QRG A;  2VD4 A;  3R5B A;  4M98 A;  4HZC A;  1L0S A;  1M8N A;  3GQ9 A;  3R0S A;  4H7O A;  2FKO A;  1FWY A;  1KGT A;  5AFU U;  1QRE A;  5AFU V;  2IU9 A;  3VBM A;  2V0J A;  5L6S A;  4N69 A;  1KRV A;  3P47 A;  4MZU A;  3C8V A;  5U2K A;  4M2B A;  3KWD A;  1G95 A;  1HM9 A;  2WLE A;  3TV0 A;  3Q1X A;  4E6U A;  1HV9 A;  3FS8 A;  3VNP A;  4J18 A;  1Z90 A;  5E3P A;  3MQH A;  1TDT A;  3KWE A;  4MYO A;  1QRL A;  3OU9 A;  2V0H A;  3IGJ A;  4IHH A;  4EAA A;  2RIJ A;  2OI7 A;  5ADX U;  1SST A;  5L6V A;  1LXA A;  3R3R A;  1HM0 A;  3BRK X;  3SRT A;  1KK5 A;  3I3A A;  4E1K A;  4R36 A;  4E79 A;  4M99 A;  1SSQ A;  1SSM A;  4HUR A;  3GQ8 A;  2V0I A;  3NZ2 A;  3EG4 A;  3P1B A;  1S80 A;  2AQ9 A;  1MRL A;  3FSB A;  2QKX A;  2OI6 A;  4N6A A;  2ICX A;  2GGO A;  2WLD A;  4N6B A;  4DCL A;  3D98 A;  3OTM A;  3TK8 A;  3KWC A;  3OUP A;  2GGQ A;  3FTT A;  1KHR A;  1V3W A;  3R8Y A;  3GVD A;  4AC3 A;  1KK6 A;  3F1X A;  2WLC A;  2XAT A;  1KQA A;  2JF2 A;  3T57 A;  4R37 A;  3OTZ A;  2IU8 A;  4G87 A;  1YP2 A;  3TIS A;  4ISX A;  2IUA A;  4MFG A;  3SPT A;  4FCE A;  4E6T A;  4KQL A;  2V0L A;  4K6R A;  3VBL A;  2VHE A;  3ECT A;  3JQY A;  3EEV A;  3OH2 A;  1V67 A;  3BSW A;  2W0V A;  4KNR A;  5E3R A;  3TWD A;  3V4E A;  3R2W A;  3OH1 A;  1KRR A;  4EA7 A;  4E75 A;  1MR9 A;  3BSY A;  4G3Q A;  1QQ0 A;  1QRF A;  4HUS A;  3HJJ A;  4M28 A;  3DK5 A;  4EGG A;  2QIV X;  3SUC A;  3OW5 A;  3VBN A;  2WLG A;  4HZD A;  4EQY A;  4EAB A;  4KPZ A;  3VBP A;  3ST8 A;  1EWW A;  1QRM A;  4EA8 A;  5F42 A;  3R3I A;  4KPX A;  1XAT A;  3OH0 A;  1XHD A;  4J09 A;  3OH4 A;  2P2O A;  1YP4 A;  3R5A A;  5E3Q A;  2Q4J A;  3R5C A;  1T3D A;  1G97 A; 
#chains in the Genus database with same CATH homology
 1KK4 A;  1THJ A;  5DG3 A;  3D8V A;  4KNX A;  2TDT A;  3MC4 A;  2WLF A;  2OI5 A;  3DHO A;  4EA9 A;  4G3S A;  3HSQ A;  2ICY A;  4M9C A;  3VBK A;  3BSS A;  4G3P A;  3IXC A;  5DEP A;  1J2Z A;  2QIA A;  2OEG A;  3GUE A;  3VBI A;  1MR7 A;  3FSX A;  2V0K A;  1KRU A;  3TDT A;  1FXJ A;  3GOS A;  4AA7 A;  3EH0 A;  4M2A A;  4HCQ A;  4IHF A;  3FSY A;  3I3X A;  1YP3 A;  3BXY A;  4IHG A;  1OCX A;  3R1W A;  3VBJ A;  1KGQ A;  3MQG A;  3TIO A;  4AAW A;  3FSC A;  1HM8 A;  5ADX V;  3FOQ A;  3FWW A;  2NPO A;  4R7P A;  3BFP A;  2W0W A;  3DJ4 A;  2IC7 A;  3PMO A;  5DEM A;  2JF3 A;  3R5D A;  4N27 A;  2OEF A;  2I5K A;  3CJ8 A;  1QRG A;  2VD4 A;  3R5B A;  4M98 A;  4HZC A;  3R0S A;  4H7O A;  2FKO A;  1FWY A;  1KGT A;  5AFU U;  1QRE A;  5AFU V;  2IU9 A;  3VBM A;  2V0J A;  5L6S A;  4N69 A;  1KRV A;  3P47 A;  4MZU A;  3C8V A;  5U2K A;  4M2B A;  3KWD A;  1G95 A;  1HM9 A;  2WLE A;  3TV0 A;  3Q1X A;  4E6U A;  1HV9 A;  3FS8 A;  3VNP A;  4J18 A;  1Z90 A;  5E3P A;  3MQH A;  1TDT A;  3KWE A;  4MYO A;  1QRL A;  3OU9 A;  2V0H A;  3IGJ A;  4IHH A;  4EAA A;  2RIJ A;  2OI7 A;  5ADX U;  1SST A;  5L6V A;  1LXA A;  3R3R A;  1HM0 A;  3BRK X;  3SRT A;  1KK5 A;  3I3A A;  4E1K A;  4R36 A;  4E79 A;  4M99 A;  1SSQ A;  1SSM A;  4HUR A;  2V0I A;  3NZ2 A;  3EG4 A;  3P1B A;  1S80 A;  2AQ9 A;  1MRL A;  3FSB A;  2QKX A;  2OI6 A;  4N6A A;  2ICX A;  2GGO A;  2WLD A;  4N6B A;  4DCL A;  3D98 A;  3OTM A;  3TK8 A;  3KWC A;  3OUP A;  2GGQ A;  3FTT A;  1KHR A;  1V3W A;  3R8Y A;  3GVD A;  4AC3 A;  1KK6 A;  3F1X A;  2WLC A;  2XAT A;  1KQA A;  2JF2 A;  3T57 A;  4R37 A;  3OTZ A;  2IU8 A;  4G87 A;  1YP2 A;  3TIS A;  4ISX A;  2IUA A;  4MFG A;  3SPT A;  4FCE A;  4E6T A;  4KQL A;  2V0L A;  4K6R A;  3VBL A;  2VHE A;  3ECT A;  3JQY A;  3EEV A;  1V67 A;  3BSW A;  2W0V A;  4KNR A;  5E3R A;  3TWD A;  3V4E A;  3R2W A;  1KRR A;  4EA7 A;  4E75 A;  1MR9 A;  3BSY A;  4G3Q A;  1QQ0 A;  1QRF A;  4HUS A;  3HJJ A;  4M28 A;  3DK5 A;  4EGG A;  2QIV X;  3VBN A;  3OW5 A;  2WLG A;  4HZD A;  4EQY A;  4EAB A;  4KPZ A;  3VBP A;  3ST8 A;  1QRM A;  4EA8 A;  5F42 A;  3R3I A;  4KPX A;  1XAT A;  1XHD A;  4J09 A;  2P2O A;  1YP4 A;  3R5A A;  5E3Q A;  2Q4J A;  3R5C A;  1T3D A;  1G97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...