2FKXA

Ribosomal protein s15 from thermus thermophilus, nmr recalculated structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Conformational Landscape of the Ribosomal Protein S15 and Its Influence on the Protein Interaction with 16S RNA.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural protein
molecule keywords 30S ribosomal protein S15
total genus 26
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2fkxA00
4DV2O 4LF8O 3OTOO 1XNQO 1HNZO 4X62O 5IT9N 4X66O 2JRIA 1IBLO 2E5LO 5BY1A 4DR7O 4LFAO 4YHHO 2LW7A 4DV1O 2DJVA 1X59A 4DV5O 5H5NA 4JI1O 1I94O 5IWAO 1A32A 1AILA 4YY3O 4DR1O 1J5EO 3RT3C 1XNRO 1N32O 2UXDO 1R6TA 4NXMO 4DUYO 2UXCO 2VQEO 3J81N 4DV7O 1IBKO 4DR6O 4OX9O 4DUZO 4JI3O 4DR5O 5BR8O 4X65O 4LFCO 4KHPO 4LF4O 5FLXN 1F7YA 2DOSA 1XMQO 3T1HO 4JI8O 2HHHO 4JV5O 4LF9O 1FJGO 2AGAA 1HR0O 3J80N 1FKAO 4DR3O 2UUCO 1HNWO 4DV6O 4DV0O 4OPHA 4JI6O 4JI7O 4LF7O 4B3RO 4OPAA 4LF6O 5LL6Y 4JI0O 4JI2O 4NXNO 4DR4O 1IBMO 2VQFO 3JAMN 2UXBO 1FYJA 2UUBO 2F4VO 4LF5O 4B3MO 2Z0AA 1XEQA 4B3TO 1XMOO 4GKJO 2UU9O 5A2QN 4K0KO 3R66A 4AQYO 1N33O 1G1XB 3T1YO 4JI5O 2FKXA 4GKKO 4X64O 5LMUO 1D2DA 5LMNO 3F5TA 1NS1A 4JYAO 1N34O 1AB3A 3SDLA 1R1BA 2UUAO 1DK1A 4DR2O 2N74A 4DV4O 4JI4O 4B3SO 1KUQA 1HNXO 2ZKOA 3M8AA 5BXZA 4LFBO 3O65A 1YZBA 4A5UB 1N36O 4DV3O 3J7AU 2ZM6O
chains in the Genus database with same CATH superfamily
5EC1C 3AG7A 3JALB 4IYIA 5LYJA 3ETGA 3ABKB 1XNQO 4FLUA 2DMXA 4QE9A 4X66O 4U7NA 4KUMA 3QO7A 5LMNB 3ETDA 1VARA 4PJ0Z 1IURA 1UPGA 3SGIA 1N8RW 1SS3A 1IXBA 1CEZA 4EFEA 2CGOA 2CE4A 1AILA 4DR4B 3IAYA 1WJZA 2MW2B 1N32O 1PNLA 3ABUA 4H33A 2EBOA 1KKCA 1IBKO 4FZ0A 2ZD9A 5TISZ 2GTSA 3BA9A 3K9AA 2EJ7A 2ADQB 3ASOB 4P9OA 3EXAA 4NXMB 4J9ZB 1M90W 1SC5B 3RFRA 1WA8B 2E76B 1FPOA 2Z5UA 2UUCO 1GK9A 3B2EE 4LFCB 2LP7A 1Y76B 1QR8A 4CZZA 2PI5A 5KAFZ 4IT5A 3K79A 1K5QA 2YI9A 2UXDB 2UXBO 4IYHA 4B3MO 3CC7V 2IJKA 3FAVB 2LGWA 1M5IA 2Y4UA 1FXKB 5LOVB 1DF4A 4N23A 5EBWC 1AI4A 1K3EA 4IGGA 1KU9A 1D2DA 2FMLA 4KP4A 4HYOA 3UT5B 2PTMA 3JCZA 3ZN0A 4TOIA 4RQEA 3OUSA 2ADPA 4DRXA 2XNDG 1KC8W 2CTWA 2OIEA 1WNSA 3U10A 2AW9A 4DV3O 2XAFA 1NZ6A 1PNKA 3CRAA 3H01A 2ZM6O 5GW7A 2QWPB 4JI7B 3W7TA 3SYOA 2Q7GA 2AZ2A 4MVQA 5D5QA 2RDCA 4F4LA 4O4JA 1KECA 3I56V 5IYZA 1K34A 2P5OA 1GM8A 5JVDB 3UKMA 3ZMVA 3H9VA 2JGUA 1O9HA 2IJHA 2D3OW 2L35A 2A79B 1XHXA 4YHHO 2LW7A 1F4NA 4YIOA 4MTXA 3VBBA 5IWAO 1FD9A 1K33A 5EK0A 5FPOA 4TUYB 2XTAA 4X62B 3K0GA 1XILA 4DR6O 3BHPA 2EZOA 4P9PA 3HKEB 4DR5O 3S3WA 3OR6C 1PD3A 3B8MA 1R3JC 2EULA 2JEUA 5EIBC 5LGNA 1FJGO 4KFMA 4X65B 4JI7O 3K08A 3BAAA 4IL6Z 3CWBH 4CS4A 4K35A 5KUKA 5DECA 2P4VA 1HDJA 5ITZB 2VQFO 5B1AC 4HNAA 4R8CA 2A7WA 1GN2A 3HPLC 1QU7A 4RQFA 1XEQA 4B3TO 1XMOO 4X1IB 3TK1A 1M93A 2HEPA 4J7ZA 1VQPV 1G1XB 4XDKA 3RVZA 4QIWF 4YIPA 3RYIA 4Z1MG 1PL0A 3E86A 2P06A 3G6EV 2AXTZ 3SDLA 3P32A 1L1FA 1FFXB 4B3RB 2GHYA 3X2QB 1KUQA 3T4ZA 4WFBV 5E1AC 1NQTA 2RMKB 3BCCH 3OMIB 4A5UB 1AI7A 2F95B 3C90A 1S77D 4QPKA 3H1IH 3SYCA 3SPHA 4FLVA 2RJZA 2ZE7A 3AG1C 4X1YB 1ZL8B 4RWUA 3ZX6A 2JRIA 3L70H 2VWJA 2QM7A 3R65A 5BY1A 2WPDG 5LXTA 2V4DA 4I9QA 3HKCB 5LYJB 1X59A 5LHGA 2FL4A 1OZ0A 1SQFA 1OCZC 1I94O 1TA8A 4FFBB 3RT3C 2KQXA 4NXMO 2XAJA 4BIUA 2F4VB 5CBHA 4ZHQA 1S3JA 4MSWC 2R9RB 1JCHA 1Q3EA 1N32B 4P30A 2OCHA 3K57A 3ASNC 5LGUA 3ZMUA 4LNUB 3L9DA 4K8ZA 4DV6O 4JI1B 3RYFB 1MOFA 5B1OA 2Q5ZA 4MT8A 3DXRA 5BMVB 1V54B 3JYCA 3LUTB 2Q9LA 4OXSA 5CB4A 3R66A 3JSNA 4AQYO 5LA6A 2ZNJA 3STLC 4B3MB 3KCXA 1TVKB 1RM1C 4ZBMA 1NVPB 4FVMA 3SYQA 3FAVA 4D6TH 2LFRA 1DTOA 1NH2D 4Z1VA 2Q0OC 1QVFU 1HP8A 1SA0A 4G27B 1R73A 2B1IA 3EVKA 3Q4HA 4PHZA 4YHHB 2JS3A 1K5SA 2YI8A 3CXHF 2VRZA 2OCCC 1R6KA 1AJQA 1H2GA 1KMIZ 1S5HC 4O2AB 2UU9B 2DJVA 4E2LA 3WU2Z 4B3TB 4YJ3A 1YJ9V 3LDCA 5IYZB 4FLYA 1A32A 4LH6A 3JARA 3JD3A 3AG1B 3L72H 3C3SA 5KMGA 1KBHA 1SQPH 2YEVA 3VQYA 1F51A 4JASA 4NTYA 1HNXB 2ODMA 3IC9A 5CA1B 1SQVH 4PI0A 3MAQA 3K9SA 1VQNV 4I4TA 1ZLZA 4FIPC 1SQBH 2Q68A 3RYCA 4FJCC 1QNMA 3CEIA 3OEHG 1HNWO 4B3RO 3E22A 5EC2C 1YTFD 4K3AA 3UCSC 5IYCO 1I0HA 3ZHSA 4WBNB 4GUNA 3LSQA 2AHYA 1H2NA 1KKDA 4JAUA 3QF7A 4MVOA 3OD4A 3CSXA 3CE2A 5C93A 1JFFB 2EIKC 5CN0A 4GKKO 4WFHA 4HNAB 2HHHB 3JAWB 1JA8A 1NU1H 1IBLB 4O4IB 5H6RA 1AB3A 4DR2O 3OGIB 2ZXWC 3JATA 4LF4B 2JEXA 1DF5A 1ZAUA 3J7AU 2JK5C 1U97A 3ETQA 4DV7B 1IDSA 4GX5A 1F4MA 4X62O 3L71H 2WWWA 2HVJC 1US6A 2VS0A 4PDMA 4R6ZA 3LDEA 4H13B 5FL7G 4DXWA 4LF5B 3NXSA 3SJCC 2P7TC 4DR7O 1NI8A 1YXBA 4LFAO 3KZIZ 3CCQV 5A9GA 1VQMV 1W59A 2FTKA 2HVKC 1PM9A 3CHXA 3FB6C 2ARHA 4DR1O 1BCCH 4LWSB 1V55C 2EIMC 2AHZA 1R3LC 1JJOA 4CH5A 4DUYO 1YSCA 5LXTB 1P7GA 3J81N 3AEIA 3HKCA 4X20A 5KAIZ 1YIJV 3F7YC 2YIAA 1K9MW 2BTQA 4LF4O 5EYPB 1F7YA 1IXMA 1WN7A 2GTAA 1XREA 3T1HO 1GN6A 3D36C 2XT9A 1M56B 1RP3B 1L0LH 3T1HB 3RGBA 1XNRB 2N04A 4K0KB 3JAMN 3MDSA 1IBMB 2CGNA 2YSUB 4ASUG 2O57A 4PA3A 2UU9O 5A2QN 1R3IC 1RSOA 5LP6B 2FKXA 3FB5C 4X8AA 1L8DA 3G80A 5FNVA 3LSUA 1Z2GA 1CPYA 1VQ8V 2IH1C 1OCOC 5KX5B 4JI6B 1I5YA 1B06A 1HNXO 2ZKOA 2QKCA 1TVKA 3QTCA 2OT5A 4LF8B 2X6BA 4H37A 1Q81W 1S72V 4BIZA 3K06A 5EBMC 2VQEB 4GZRB 1XL6A 3T2MA 4JYCA 3CD6V 4PD4F 2LJ2A 1XDCA 2IJIA 2Y48A 1SA0B 3D36A 5L3BA 3ZIAG 4DV5O 4GYCB 5IYDO 3EFFK 2GSMB 2Q4PA 2RCVA 4X1KA 2BCCH 2QWRB 1JPXA 2EINB 2UXDO 2UXBB 2HKOA 4O2AA 4Z2WA 5DEDA 1VQ6V 1JQ0A 4OX9O 5JCOC 2LGQA 5EZYA 3CCJV 1TUBA 1MMMA 4KHPO 2JJ2G 4DK1A 4KXRA 1ROPA 4X89A 3VQXA 2BE3A 1LUWA 4MVRA 5KMGB 4I50A 3SPJA 3W7SA 4JI2O 2EINC 2ZCEA 4BR6A 1D5NA 4J41A 2Y4TA 5B5EZ 2B9ZA 1BZKA 1QHTA 4IIJA 5CA0B 4K0KO 2H3OA 4F6RA 2QKSA 1TAEA 2B5UA 5LMNO 3L73H 4JYAO 1ZTEA 1ZWIC 1S5LZ 4LF6B 4PDVA 2P4KA 1U96A 2M6YA 4P2ZA 3M8AA 4G2KA 1ZSPA 1Y74A 2E3CA 4O2BB 1W2BU 4O4IA 1M4UA 1LNQA 3SJAC 4DR2B 3SYAA 4LF8O 1KQSU 5IDJA 4DR6B 5KUMA 4DV1B 2N05A 4J7KA 4FK5C 1AVMA 1WB8A 1K4DC 1NR1A 2QDOA 3MD0A 4UCUA 4CBCA 4UUJC 3DGEA 3ZRSA 1VP7A 3ZMZA 2KG7B 2WLNA 1NR7A 2F66C 4IHJA 2DYRC 1SQGA 4JTAB 1YEWA 4MTFA 4DV2B 3QG5A 3ML0A 2V1DA 1FS0G 3CCMV 1GH6A 1ZX3A 3HKBB 2WA3A 4GX2A 4PDRA 2DWEC 5CBGA 2PYLA 3AG3C 3ABMB 2CK3G 4JI3B 4AI8A 4DK0A 4DR5B 4LF7O 2PF4E 3ZS8C 1NTMH 5EYPA 2ZE8A 1L0NH 2XAQA 4W4LA 2DQ0A 4UCRA 1YTFB 2JGDB 3QNEA 4CH4A 3VQVA 2XOKG 1D5AA 3KKYA 4J7JA 2LO1A 3D3QA 4JZ2A 1M56C 1YVWA 4NB5A 4W4KA 1LUVA 5GONA 1VQ7V 1OCCC 5KA5A 1VQOV 1XMOB 1N34O 2QWQB 1XQ8A 4JI0B 2F1MA 2QWOB 3FB8C 5LP6A 3STZC 1HNZB 4U3JA 1XMQB 2BSKA 4EKWA 1G6UA 2BOBC 1SZXA 3E35A 4TQDA 1LR1A 5LHIA 2XUMA 3JAKA 4FLZA 3DC6A 5IT9N 3H1KH 3CRRA 5LMUB 2V7QG 1KD1W 3K5OA 2ZNIA 4GCZA 2Q7EA 3E8BA 1OCRC 3CX5F 3WG7B 5JQGA 1Z5WA 4GT1A 4PV1B 1H8HG 1NTKH 1TGOA 3HKDA 5F2VO 1Y67A 2BOCC 4C7UA 3ZCCA 1R6TA 2JS5A 2W6JG 4GX1A 4X1KB 2WA4A 2Q0AA 1WP8A 3G6BA 3OUFA 1XMQO 2EIKB 1EM1A 4LF6O 5EZYB 1SKVA 4NXNO 2IJJA 3T4DA 2R9AA 4FLTA 4DR4O 1BQZA 3T1CA 3GB7C 3ZMSA 1Y76A 1IBMO 1BS3A 5B3SC 3RVYA 1QLEB 3ZHTA 1SESA 3BABA 3P30A 4X88A 4H0LB 1GKFA 3UO2A 1FXVA 1UFIA 4I50B 1VF7A 1DLBA 1AI5A 1Q7YW 3RYHA 2RN9A 3NR7A 1BHAA 3TXQA 2VQFB 4YY3B 1HW7A 2YXLA 3AG2B 5D5PA 4JV5B 2YXYA 4O4HB 1OCCB 1FXHA 1IZ3A 4IIJB 1SQQH 2X0LA 1R1BA 1BGYH 4DV4O 4JI4O 1G8MA 1W0KG 4H44B 2EZPA 4KL1A 4DRXB 3ZHRA 4DV4B 4JI4B 1VF6A 1AR4A 2IU0A 4ZOLA 1YCIA 2ZDIC 1VF5B 5JJJB 4I7ZB 2L6LA 1AP6A 4I5SA 1IBLO 1W0JG 1Y74B 3N2KA 1GM7A 1MSDA 3O9OA 3A0BZ 4DV1O 2XAHA 3JCUZ 2OIGA 2QE7G 5KLVH 5AG2A 3D8CA 1VQLV 3OMNB 5HFMA 2F23A 2A3QA 4CH3A 4BW9A 4LP8A 2UXCO 3CJHA 1NBMG 3BY6A 3JASA 4RUFA 4NVPA 5H2FZ 4DUZO 4MTGA 4N21A 3ABTA 2KG7A 4FFKA 1VIBA 3ASOC 2DOSA 2ZIMA 4TV9B 2HHHO 3CC4V 3ZBHA 3J80N 1EN6A 1N34B 3CCEV 4J9YB 2LQTA 4DV0O 2Y69B 2QTOA 3BVOA 4MVMA 4JYAB 3E89A 4L87A 1OCOB 4B08A 4X64B 1OHHG 4LF5O 3B4SA 1G4YB 2CTRA 5JWPA 4AHCA 2QSAA 3WG7C 2YIBD 1YJWV 2ATKC 3E8HA 4X1IA 1Q6UA 1RM1B 5CMUA 2PYJA 1EN5A 1FJGB 5C8YB 1GN3A 2ZR2A 1M57C 1NTZH 5B3SB 4J11A 3ZN1A 3UM7A 3SPIA 1VMGA 5IJ0A 1UJWB 2WLIA 2YICA 1URFA 3FFQA 4BIOA 2A9HA 1JOYA 5LP6C 1JVMA 2HR3A 2P22C 1IBKB 1AJNA 2ZQMA 2NN4A 2EJRA 4WFFA 5KA6A 2DN9A 4U3JB 3RN4A 3ZJZA 4HAMA 5B66Z 2DWDC 3B09A 3X2QC 3ZMTA 4X1YA 2W0XA 4JPRA 2Q67A 2XAGA 2WSSG 3RWRD 4UVBA 1EZVH 5KHJA 4I55A 4DR7B 5IYBO 4YY3O 2IW5A 1XNRO 3CCSV 4FFBA 3ZHVA 1Q6HA 3ETEA 3E8FA 5KHKA 1NH2B 5JQGB 1H2SB 1H2MA 3G4SV 1KP3A 4LFBB 4ZHQB 1WA8A 2KB1A 1VF6C 3BFRA 1B6QA 3G71V 4UCOA 3DTUB 3AK1A 2WAMA 4JI6O 1H2KA 5IY5B 1JR9A 3GVMA 4LNUA 4GX0A 5LL6Y 1N33B 4FPPA 1RFYA 3RYFA 5IE9A 1HWYA 2OCCB 1BQ0A 3TXSA 2X7RB 1FYJA 2UUBO 2GV9A 4OGQB 3SYPA 2P6JA 1VQKV 2Z0AA 4GKJO 3SR2C 4FLWA 2A0LA 4ICGA 1Y6XA 5L3FA 2UUCB 2HP8A 2NLJC 2NR5A 4JI2B 3JD0A 3RYHB 3ZEDA 3E8GA 1VEWA 1R3KC 3UQ8A 3LNMB 2F93B 2P90A 4KHPB 1ORQC 3SJQC 3M99B 1COWG 3N27A 3OR7C 4TV8B 1GMGA 1K73W 5JVDA 3CMAV 3TETA 3QO5A 2Z3YA 1IX9A 2Q73A 3Q4HB 1Q5OA 3CP1A 5JCOA 3AK3A 5IJ9A 3HR0A 4JI1O 1AROP 1Q8IA 3N2KB 4YJ3B 2ILMA 5IY5C 3M7MX 5K1PA 4ZI7B 2Q8VA 2HJDA 3HKEA 1WAZA 1K97A 5B1BB 5JJEB 3JARB 2QTSA 4JI8B 5BR8O 1N0NA 4DR3B 1WPBA 3OTFA 2YEVB 2UXCB 1FFTB 2RQ6A 3A0RA 5H6QA 5CA1A 4UCTA 5B1NA 3W7UA 4FM0A 3JASB 5JH7A 5ITZA 4F6EA 4Q20A 4QJFB 4TSFG 1J5EB 4TV9A 2EIJC 3E22B 2F4VO 1E79G 3OW2U 1BSMA 3OGCC 4RUEA 1RPRA 1EN4A 2P67A 2C2AA 3D3IA 4LH7A 4X64O 4MW8A 1B04A 2YC0A 1XL4A 2AZ0A 2IBZH 4LF9B 4LF7B 3JAWA 4UXNA 4R7CA 4UCSA 1P7BA 1XNQB 4LBEC 2CDYA 3O65A 3JATB 3CMEV 2GDSA 3AG4C 3E2EA 4BWAA 3AG4B 5C8YA 4DV2O 3RW0A 4XDJA 2GUZB 1SF9A 4UB8Z 5EIBD 5IJ0B 2WLIB 4XBFA 1PNMA 1M57B 2KKWA 5KHIA 4DUZB 4DYLA 1MG1A 1KP2A 2ZXWB 2H8PC 3EHBB 1MNGA 1EBOA 2E5LO 2ZT9B 3IFXA 1YITV 2R72A 1I94B 2WLKA 3IC7A 4QPJA 4D7TA 3THOA 1M9NA 3FB7C 3F7VC 4LFAB 3N2GB 2Y0PA 1GN4A 3BRCA 4I9WA 4DV3B 3H1JH 2VQEO 2QA4V 3AK2A 4WFEA 4DV7O 4LWSA 4R50A 2R70A 4X66B 2QJ1A 4LFCO 4X20B 4K8XA 2UXXA 4I55B 1H8EG 1TUEB 2ZINA 4NKGB 2QKAA 3CCRV 1GRJA 1OCZB 2AGAA 4JYBA 1YHQV 3ABKC 4OPHA 3S3XA 3DXRB 5BMVA 4DR1B 4QNHB 2QGNA 5CB4B 5LA6B 4QGPA 2FB5A 4LCUC 4UV8A 1Q6IA 1BHBA 1Y66A 1F23A 3BEHA 1THZA 2JIZG 1MA1A 2E75B 3CRCA 5GTIZ 3JD1A 5GTHZ 1NS1A 1EZJA 3P3PA 5B1AB 5FNVB 3WFVA 3APQA 2X6AA 1MZFA 4MW3A 1FAFA 1Q43A 1P4RA 1VQ4V 5KHGA 4ZIBA 1IVSA 3B40A 3A0HZ 3RBZA 5L3EA 1GM9A 3OTOB 4NTXA 1S0VA 3CYOA 1R6NA 3FYEB 3OMAB 1HNZO 3CCVV 4PDLA 1YF2A 5L3GA 1I5XA 3OT7A 3K03A 4Q6GA 2PUSA 3H1LH 1XOUA 1JX9A 1GO3F 2QM4A 3BPZA 1PPJH 4TV8A 5IWAB 3P3NA 1NKDA 2EX3A 2IM9A 3ABMC 5JJNB 5J2UB 5H5NA 4E4EA 5E79Z 1AJPA 3CCUV 2Y69C 4WFGA 2YIBA 3CB2A 1N0JA 4TT3G 5B1BC 1YJNV 3CPWU 2OTLV 1S76D 1E1RG 2EILB 4L8JA 3ZRXA 4I4TB 2JDIG 5IJ9B 4DV6B 3UO3A 1NT2B 3L74H 4LR3A 4X65O 3RYCB 1YDXA 4I0XA 3GWKC 1P49A 2ITCC 2HFEC 3ASNB 4ZI7A 4JV5O 2GBOA 4EB6B 4DR3O 1Z5VA 2PZSA 3ZRWA 2Q6AA 4RAIA 4OPAA 2ZR3A 4WBNA 1E1QG 4PI2A 1JJ2U 1CXZB 4JTCB 3I55V 3OE7G 4JTDB 1V54C 1BMFG 5LGTA 1Q82W 1JFFA 2R9IA 5JH7B 2WLHA 3KCYA 1KB9F 1BT8A 4FZ1A 3ZRVA 5CA0A 3JSLA 5H9CA 1P84F 2EIMB 5J9PC 2Y0IA 5BZBA 1HNWB 1ZUQA 2ZE5A 4YJ2A 2OTJV 4MVZA 1AR5A 2W6IG 1WLEA 2ETNA 5K1XA 1AR1B 3CS5A 3MHSC 2YDEA 1KYOF 4DW0A 3C3TA 2CAZC 4B3SO 2EIJB 1XBLA 1DGSA 2WLJA 3K3WA 4UVAA 5DM6V 4PA6A 4MTOA 4JAVA 4PA4A 4FM1A 1AP5A 2A06H 4YXWG 1MZEA 4DUYB 3OTOO 3APOA 4O2BA 1JMKC 1V55B 2PGGA 2K9PA 2LW1A 2YIDA 3VQWA 3FKSG 1XI1A 3CC2V 2BTOA 2JJ1G 4UCVA 1V9PA 1SERA 2F43G 4G28B 4B7KA 2GUZA 4BW5A 1PKXA 4DW1A 3T1YB 2MK3A 3OAAG 4B7EA 2WLLB 1SRYA 2BTQB 2OYQA 4IHJB 1QQCA 2DE0X 4UFZA 4DO2A 3FYIB 4TQFA 1AI6A 5FLXN 3CRMA 3N2GA 3ZHUA 3QVNA 1QBZA 4NR1A 4JYYA 4JI8O 3HKBA 1XHZA 4CS3A 1VQ5V 4UB6Z 2DYRB 1K4CC 1WB7A 4O4LA 2Q69A 2ZE6A 1XUQA 1CP9A 1MABG 2EILC 1NVPD 3BA8A 3LNNA 4TWKA 2ZDIA 5J2TB 1OCRB 2YUAA 2HJFC 1RSOB 3SPCA 1K7DA 1T5EA 3ABLC 2G38A 2UUBB 3TCUA 2CH7A 5KX5A 3E83A 2VWKA 3F5TA 4XDLA 3A2FA 4JGSA 5CA3A 3JALA 5GONB 2UUAO 1DK1A 2E5LB 2YXHA 2Q7HA 4LFBO 3KG2A 1YZBA 1K8AW 3W7WA 4RO2A 4HZ3A 2BSKB 4J80A 3WB2A 4ZKIA 3OEEG 3K5MA 3B77A 2CTQA 4U7OA 2B1GA 3W7XA 4CH6A 4OX9B 4LC1A 2M7WA 4PA7A 1MSWD 3JAKB 2D2CB 3MHHC 2QEXV 1S5JA 3CCLV 3U0ZA 1Q90D 2QR4A 4X9QA 1GTOA 2CTPA 2ITDC 1O9GA 1BL8A 4QE7A 3K0DA 3OFNG 2E74B 3HKDB 4PA9A 1TUBB 5J2UA 4FMTA 4U3FH 2UUAB 3JD4A 1ENVA 2NNUA 1N36B 4NTWA 3TGUH 3LDDA 3ABLB 2QM8A 1FKAO 4ABMA 1H38A 3AG2C 1PP9H 1PL4A 4CS2A 4D7SA 5CBFA 1FXKA 5LOVA 4JI0O 5HFLA 1SZTA 3K5LA 3ICXA 4I0XB 1WPXA 4AQYB 3K5NA 3UT5A 4EB6A 3L75H 3ZRWB 2UXNA 4F6RB 2JVDA 1I7FA 3GWOA 1N33O 2PI4A 4JZGA 1GAXA 1X4TA 2IU3A 2KSDA 4GKJB 1NJIW 3F5WC 4PELA 2ZM6B 1N4CA 4O4HA 4EFBA 3SJBC 4O4JB 3AG3B 5BXZA 2WLMA 3HB3B 4YJ2B 3DSQA 5LBQA 4MVSA 4FM2A 1QVGU 1Q86W 3VOUA 3K04A 5FPRA 1RPOA 4B3SB 2DW4A 3B8NA 4UVCA 4GLXA 4DV5B 3K59A 2H94A 3A8TA 2K1EA 2XASA 5BR8B 2IH3C 3CXCU 4ZOLB 4WFAV 2HLDG 2PY5A 5L3CA 1K92A 1OV9A 4TUYA 2OWOA 5LHHA 3IGAC 5EBLC 1H2LA 3CRQA 3LSSA 2QWNB 4MS2A 3K58A 1EFRG 3TJTA 2ZIOA 2DYSC 1J5EO 2HG5C 3IJ4A 4CC5A 4JAAA 4NYKA 5L3DA 3SPGA 4JI3O 3CJHB 1HR0B 1Y4MA 4JF3A 1BE3H 3DC5A 2XHBA 4EEQA 1VQ9V 3I5DA 2WLLA 1PV0A 1WP7A 1SQXH 1FXKC 4LF9O 3WB0A 1HR0O 2DQ3A 3FX7A 4J10A 4CC6A 5DN6G 1M1KW 1QR9A 4BAYA 3WB1A 2JGDA 2LFSA 1B3QA 4AILC 3FD9A 1YI2V 3RYIB 3PJSK 3PN1A 2RNBA 3OM3B 1I08A 4JI5B 1FFXA 2W0FC 4O4LB 4GKKB 2FYUH 3T1YO 3U11A 4JI5O 2DYSB 4UV9A 1SETA 2YS8A 5LMUO 4MVUA 5KHHA 5J2TA 3QO8A 3G67A 4FLXA 2X6CA 3JD2A 4HBNA 2CUGA 4WCEV 4DV0B 4NXNB 1J95A 2N74A 1OJHA 1QLEC 1QCEA 4WF9V 2CH7B 4J42A 1ZL8A 1QLNA 1N36O 3H1HH 3ZHQA
chains in the Genus database with same CATH topology
4DV2O 4LF8O 3OTOO 1XNQO 1HNZO 4X62O 5IT9N 4X66O 2JRIA 1IBLO 2E5LO 5BY1A 4DR7O 4LFAO 4YHHO 2LW7A 4DV1O 2DJVA 1X59A 4DV5O 5H5NA 4JI1O 1I94O 5IWAO 1A32A 1AILA 4YY3O 4DR1O 1J5EO 3RT3C 1XNRO 1N32O 2UXDO 1R6TA 4NXMO 4DUYO 2UXCO 2VQEO 3J81N 4DV7O 1IBKO 4DR6O 4OX9O 4DUZO 4JI3O 4DR5O 5BR8O 4X65O 4LFCO 4KHPO 4LF4O 5FLXN 1F7YA 2DOSA 1XMQO 3T1HO 4JI8O 2HHHO 4JV5O 4LF9O 1FJGO 2AGAA 1HR0O 3J80N 1FKAO 4DR3O 2UUCO 1HNWO 4DV6O 4DV0O 4OPHA 4JI6O 4JI7O 4LF7O 4B3RO 4OPAA 4LF6O 5LL6Y 4JI0O 4JI2O 4NXNO 4DR4O 1IBMO 2VQFO 3JAMN 2UXBO 1FYJA 2UUBO 2F4VO 4LF5O 4B3MO 2Z0AA 1XEQA 4B3TO 1XMOO 4GKJO 2UU9O 5A2QN 4K0KO 3R66A 4AQYO 1N33O 1G1XB 3T1YO 4JI5O 2FKXA 4GKKO 4X64O 5LMUO 1D2DA 5LMNO 3F5TA 1NS1A 4JYAO 1N34O 1AB3A 3SDLA 1R1BA 2UUAO 1DK1A 4DR2O 2N74A 4DV4O 4JI4O 4B3SO 1KUQA 1HNXO 2ZKOA 3M8AA 5BXZA 4LFBO 3O65A 1YZBA 4A5UB 1N36O 4DV3O 3J7AU 2ZM6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 O;  4LF8 O;  3OTO O;  1XNQ O;  1HNZ O;  4X62 O;  5IT9 N;  4X66 O;  2JRI A;  1IBL O;  2E5L O;  5BY1 A;  4DR7 O;  4LFA O;  4YHH O;  2LW7 A;  4DV1 O;  2DJV A;  1X59 A;  4DV5 O;  5H5N A;  4JI1 O;  1I94 O;  5IWA O;  1A32 A;  1AIL A;  4YY3 O;  4DR1 O;  1J5E O;  3RT3 C;  1XNR O;  1N32 O;  2UXD O;  1R6T A;  4NXM O;  4DUY O;  2UXC O;  2VQE O;  3J81 N;  4DV7 O;  1IBK O;  4DR6 O;  4OX9 O;  4DUZ O;  4JI3 O;  4DR5 O;  5BR8 O;  4X65 O;  4LFC O;  4KHP O;  4LF4 O;  5FLX N;  1F7Y A;  2DOS A;  1XMQ O;  3T1H O;  4JI8 O;  2HHH O;  4JV5 O;  4LF9 O;  1FJG O;  2AGA A;  1HR0 O;  3J80 N;  1FKA O;  4DR3 O;  2UUC O;  1HNW O;  4DV6 O;  4DV0 O;  4OPH A;  4JI6 O;  4JI7 O;  4LF7 O;  4B3R O;  4OPA A;  4LF6 O;  5LL6 Y;  4JI0 O;  4JI2 O;  4NXN O;  4DR4 O;  1IBM O;  2VQF O;  3JAM N;  2UXB O;  1FYJ A;  2UUB O;  2F4V O;  4LF5 O;  4B3M O;  2Z0A A;  1XEQ A;  4B3T O;  1XMO O;  4GKJ O;  2UU9 O;  5A2Q N;  4K0K O;  3R66 A;  4AQY O;  1N33 O;  1G1X B;  3T1Y O;  4JI5 O;  2FKX A;  4GKK O;  4X64 O;  5LMU O;  1D2D A;  5LMN O;  3F5T A;  1NS1 A;  4JYA O;  1N34 O;  1AB3 A;  3SDL A;  1R1B A;  2UUA O;  1DK1 A;  4DR2 O;  2N74 A;  4DV4 O;  4JI4 O;  4B3S O;  1KUQ A;  1HNX O;  2ZKO A;  3M8A A;  5BXZ A;  4LFB O;  3O65 A;  1YZB A;  4A5U B;  1N36 O;  4DV3 O;  3J7A U;  2ZM6 O; 
#chains in the Genus database with same CATH topology
 5EC1 C;  3AG7 A;  3JAL B;  4IYI A;  5LYJ A;  3ETG A;  3ABK B;  1XNQ O;  4FLU A;  2DMX A;  4QE9 A;  4X66 O;  4U7N A;  4KUM A;  3QO7 A;  5LMN B;  3ETD A;  1VAR A;  4PJ0 Z;  1IUR A;  1UPG A;  3SGI A;  1N8R W;  1SS3 A;  1IXB A;  1CEZ A;  4EFE A;  2CGO A;  2CE4 A;  1AIL A;  4DR4 B;  3IAY A;  1WJZ A;  2MW2 B;  1N32 O;  1PNL A;  3ABU A;  4H33 A;  2EBO A;  1KKC A;  1IBK O;  4FZ0 A;  2ZD9 A;  5TIS Z;  2GTS A;  3BA9 A;  3K9A A;  2EJ7 A;  2ADQ B;  3ASO B;  4P9O A;  3EXA A;  4NXM B;  4J9Z B;  1M90 W;  1SC5 B;  3RFR A;  1WA8 B;  2E76 B;  1FPO A;  2Z5U A;  2UUC O;  1GK9 A;  3B2E E;  4LFC B;  2LP7 A;  1Y76 B;  1QR8 A;  4CZZ A;  2PI5 A;  5KAF Z;  4IT5 A;  3K79 A;  1K5Q A;  2YI9 A;  2UXD B;  2UXB O;  4IYH A;  4B3M O;  3CC7 V;  2IJK A;  3FAV B;  2LGW A;  1M5I A;  2Y4U A;  1FXK B;  5LOV B;  1DF4 A;  4N23 A;  5EBW C;  1AI4 A;  1K3E A;  4IGG A;  1KU9 A;  1D2D A;  2FML A;  4KP4 A;  4HYO A;  3UT5 B;  2PTM A;  3JCZ A;  3ZN0 A;  4TOI A;  4RQE A;  3OUS A;  2ADP A;  4DRX A;  2XND G;  1KC8 W;  2CTW A;  2OIE A;  1WNS A;  3U10 A;  2AW9 A;  4DV3 O;  2XAF A;  1NZ6 A;  1PNK A;  3CRA A;  3H01 A;  2ZM6 O;  5GW7 A;  2QWP B;  4JI7 B;  3W7T A;  3SYO A;  2Q7G A;  2AZ2 A;  4MVQ A;  5D5Q A;  2RDC A;  4F4L A;  4O4J A;  1KEC A;  3I56 V;  5IYZ A;  1K34 A;  2P5O A;  1GM8 A;  5JVD B;  3UKM A;  3ZMV A;  3H9V A;  2JGU A;  1O9H A;  2IJH A;  2D3O W;  2L35 A;  2A79 B;  1XHX A;  4YHH O;  2LW7 A;  1F4N A;  4YIO A;  4MTX A;  3VBB A;  5IWA O;  1FD9 A;  1K33 A;  5EK0 A;  5FPO A;  4TUY B;  2XTA A;  4X62 B;  3K0G A;  1XIL A;  4DR6 O;  3BHP A;  2EZO A;  4P9P A;  3HKE B;  4DR5 O;  3S3W A;  3OR6 C;  1PD3 A;  3B8M A;  1R3J C;  2EUL A;  2JEU A;  5EIB C;  5LGN A;  1FJG O;  4KFM A;  4X65 B;  4JI7 O;  3K08 A;  3BAA A;  4IL6 Z;  3CWB H;  4CS4 A;  4K35 A;  5KUK A;  5DEC A;  2P4V A;  1HDJ A;  5ITZ B;  2VQF O;  5B1A C;  4HNA A;  4R8C A;  2A7W A;  1GN2 A;  3HPL C;  1QU7 A;  4RQF A;  1XEQ A;  4B3T O;  1XMO O;  4X1I B;  3TK1 A;  1M93 A;  2HEP A;  4J7Z A;  1VQP V;  1G1X B;  4XDK A;  3RVZ A;  4QIW F;  4YIP A;  3RYI A;  4Z1M G;  1PL0 A;  3E86 A;  2P06 A;  3G6E V;  2AXT Z;  3SDL A;  3P32 A;  1L1F A;  1FFX B;  4B3R B;  2GHY A;  3X2Q B;  1KUQ A;  3T4Z A;  4WFB V;  5E1A C;  1NQT A;  2RMK B;  3BCC H;  3OMI B;  4A5U B;  1AI7 A;  2F95 B;  3C90 A;  1S77 D;  4QPK A;  3H1I H;  3SYC A;  3SPH A;  4FLV A;  2RJZ A;  2ZE7 A;  3AG1 C;  4X1Y B;  1ZL8 B;  4RWU A;  3ZX6 A;  2JRI A;  3L70 H;  2VWJ A;  2QM7 A;  3R65 A;  5BY1 A;  2WPD G;  5LXT A;  2V4D A;  4I9Q A;  3HKC B;  5LYJ B;  1X59 A;  5LHG A;  2FL4 A;  1OZ0 A;  1SQF A;  1OCZ C;  1I94 O;  1TA8 A;  4FFB B;  3RT3 C;  2KQX A;  4NXM O;  2XAJ A;  4BIU A;  2F4V B;  5CBH A;  4ZHQ A;  1S3J A;  4MSW C;  2R9R B;  1JCH A;  1Q3E A;  1N32 B;  4P30 A;  2OCH A;  3K57 A;  3ASN C;  5LGU A;  3ZMU A;  4LNU B;  3L9D A;  4K8Z A;  4DV6 O;  4JI1 B;  3RYF B;  1MOF A;  5B1O A;  2Q5Z A;  4MT8 A;  3DXR A;  5BMV B;  1V54 B;  3JYC A;  3LUT B;  2Q9L A;  4OXS A;  5CB4 A;  3R66 A;  3JSN A;  4AQY O;  5LA6 A;  2ZNJ A;  3STL C;  4B3M B;  3KCX A;  1TVK B;  1RM1 C;  4ZBM A;  1NVP B;  4FVM A;  3SYQ A;  3FAV A;  4D6T H;  2LFR A;  1DTO A;  1NH2 D;  4Z1V A;  2Q0O C;  1QVF U;  1HP8 A;  1SA0 A;  4G27 B;  1R73 A;  2B1I A;  3EVK A;  3Q4H A;  4PHZ A;  4YHH B;  2JS3 A;  1K5S A;  2YI8 A;  3CXH F;  2VRZ A;  2OCC C;  1R6K A;  1AJQ A;  1H2G A;  1KMI Z;  1S5H C;  4O2A B;  2UU9 B;  2DJV A;  4E2L A;  3WU2 Z;  4B3T B;  4YJ3 A;  1YJ9 V;  3LDC A;  5IYZ B;  4FLY A;  1A32 A;  4LH6 A;  3JAR A;  3JD3 A;  3AG1 B;  3L72 H;  3C3S A;  5KMG A;  1KBH A;  1SQP H;  2YEV A;  3VQY A;  1F51 A;  4JAS A;  4NTY A;  1HNX B;  2ODM A;  3IC9 A;  5CA1 B;  1SQV H;  4PI0 A;  3MAQ A;  3K9S A;  1VQN V;  4I4T A;  1ZLZ A;  4FIP C;  1SQB H;  2Q68 A;  3RYC A;  4FJC C;  1QNM A;  3CEI A;  3OEH G;  1HNW O;  4B3R O;  3E22 A;  5EC2 C;  1YTF D;  4K3A A;  3UCS C;  5IYC O;  1I0H A;  3ZHS A;  4WBN B;  4GUN A;  3LSQ A;  2AHY A;  1H2N A;  1KKD A;  4JAU A;  3QF7 A;  4MVO A;  3OD4 A;  3CSX A;  3CE2 A;  5C93 A;  1JFF B;  2EIK C;  5CN0 A;  4GKK O;  4WFH A;  4HNA B;  2HHH B;  3JAW B;  1JA8 A;  1NU1 H;  1IBL B;  4O4I B;  5H6R A;  1AB3 A;  4DR2 O;  3OGI B;  2ZXW C;  3JAT A;  4LF4 B;  2JEX A;  1DF5 A;  1ZAU A;  3J7A U;  2JK5 C;  1U97 A;  3ETQ A;  4DV7 B;  1IDS A;  4GX5 A;  1F4M A;  4X62 O;  3L71 H;  2WWW A;  2HVJ C;  1US6 A;  2VS0 A;  4PDM A;  4R6Z A;  3LDE A;  4H13 B;  5FL7 G;  4DXW A;  4LF5 B;  3NXS A;  3SJC C;  2P7T C;  4DR7 O;  1NI8 A;  1YXB A;  4LFA O;  3KZI Z;  3CCQ V;  5A9G A;  1VQM V;  1W59 A;  2FTK A;  2HVK C;  1PM9 A;  3CHX A;  3FB6 C;  2ARH A;  4DR1 O;  1BCC H;  4LWS B;  1V55 C;  2EIM C;  2AHZ A;  1R3L C;  1JJO A;  4CH5 A;  4DUY O;  1YSC A;  5LXT B;  1P7G A;  3J81 N;  3AEI A;  3HKC A;  4X20 A;  5KAI Z;  1YIJ V;  3F7Y C;  2YIA A;  1K9M W;  2BTQ A;  4LF4 O;  5EYP B;  1F7Y A;  1IXM A;  1WN7 A;  2GTA A;  1XRE A;  3T1H O;  1GN6 A;  3D36 C;  2XT9 A;  1M56 B;  1RP3 B;  1L0L H;  3T1H B;  3RGB A;  1XNR B;  2N04 A;  4K0K B;  3JAM N;  3MDS A;  1IBM B;  2CGN A;  2YSU B;  4ASU G;  2O57 A;  4PA3 A;  2UU9 O;  5A2Q N;  1R3I C;  1RSO A;  5LP6 B;  2FKX A;  3FB5 C;  4X8A A;  1L8D A;  3G80 A;  5FNV A;  3LSU A;  1Z2G A;  1CPY A;  1VQ8 V;  2IH1 C;  1OCO C;  5KX5 B;  4JI6 B;  1I5Y A;  1B06 A;  1HNX O;  2ZKO A;  2QKC A;  1TVK A;  3QTC A;  2OT5 A;  4LF8 B;  2X6B A;  4H37 A;  1Q81 W;  1S72 V;  4BIZ A;  3K06 A;  5EBM C;  2VQE B;  4GZR B;  1XL6 A;  3T2M A;  4JYC A;  3CD6 V;  4PD4 F;  2LJ2 A;  1XDC A;  2IJI A;  2Y48 A;  1SA0 B;  3D36 A;  5L3B A;  3ZIA G;  4DV5 O;  4GYC B;  5IYD O;  3EFF K;  2GSM B;  2Q4P A;  2RCV A;  4X1K A;  2BCC H;  2QWR B;  1JPX A;  2EIN B;  2UXD O;  2UXB B;  2HKO A;  4O2A A;  4Z2W A;  5DED A;  1VQ6 V;  1JQ0 A;  4OX9 O;  5JCO C;  2LGQ A;  5EZY A;  3CCJ V;  1TUB A;  1MMM A;  4KHP O;  2JJ2 G;  4DK1 A;  4KXR A;  1ROP A;  4X89 A;  3VQX A;  2BE3 A;  1LUW A;  4MVR A;  5KMG B;  4I50 A;  3SPJ A;  3W7S A;  4JI2 O;  2EIN C;  2ZCE A;  4BR6 A;  1D5N A;  4J41 A;  2Y4T A;  5B5E Z;  2B9Z A;  1BZK A;  1QHT A;  4IIJ A;  5CA0 B;  4K0K O;  2H3O A;  4F6R A;  2QKS A;  1TAE A;  2B5U A;  5LMN O;  3L73 H;  4JYA O;  1ZTE A;  1ZWI C;  1S5L Z;  4LF6 B;  4PDV A;  2P4K A;  1U96 A;  2M6Y A;  4P2Z A;  3M8A A;  4G2K A;  1ZSP A;  1Y74 A;  2E3C A;  4O2B B;  1W2B U;  4O4I A;  1M4U A;  1LNQ A;  3SJA C;  4DR2 B;  3SYA A;  4LF8 O;  1KQS U;  5IDJ A;  4DR6 B;  5KUM A;  4DV1 B;  2N05 A;  4J7K A;  4FK5 C;  1AVM A;  1WB8 A;  1K4D C;  1NR1 A;  2QDO A;  3MD0 A;  4UCU A;  4CBC A;  4UUJ C;  3DGE A;  3ZRS A;  1VP7 A;  3ZMZ A;  2KG7 B;  2WLN A;  1NR7 A;  2F66 C;  4IHJ A;  2DYR C;  1SQG A;  4JTA B;  1YEW A;  4MTF A;  4DV2 B;  3QG5 A;  3ML0 A;  2V1D A;  1FS0 G;  3CCM V;  1GH6 A;  1ZX3 A;  3HKB B;  2WA3 A;  4GX2 A;  4PDR A;  2DWE C;  5CBG A;  2PYL A;  3AG3 C;  3ABM B;  2CK3 G;  4JI3 B;  4AI8 A;  4DK0 A;  4DR5 B;  4LF7 O;  2PF4 E;  3ZS8 C;  1NTM H;  5EYP A;  2ZE8 A;  1L0N H;  2XAQ A;  4W4L A;  2DQ0 A;  4UCR A;  1YTF B;  2JGD B;  3QNE A;  4CH4 A;  3VQV A;  2XOK G;  1D5A A;  3KKY A;  4J7J A;  2LO1 A;  3D3Q A;  4JZ2 A;  1M56 C;  1YVW A;  4NB5 A;  4W4K A;  1LUV A;  5GON A;  1VQ7 V;  1OCC C;  5KA5 A;  1VQO V;  1XMO B;  1N34 O;  2QWQ B;  1XQ8 A;  4JI0 B;  2F1M A;  2QWO B;  3FB8 C;  5LP6 A;  3STZ C;  1HNZ B;  4U3J A;  1XMQ B;  2BSK A;  4EKW A;  1G6U A;  2BOB C;  1SZX A;  3E35 A;  4TQD A;  1LR1 A;  5LHI A;  2XUM A;  3JAK A;  4FLZ A;  3DC6 A;  5IT9 N;  3H1K H;  3CRR A;  5LMU B;  2V7Q G;  1KD1 W;  3K5O A;  2ZNI A;  4GCZ A;  2Q7E A;  3E8B A;  1OCR C;  3CX5 F;  3WG7 B;  5JQG A;  1Z5W A;  4GT1 A;  4PV1 B;  1H8H G;  1NTK H;  1TGO A;  3HKD A;  5F2V O;  1Y67 A;  2BOC C;  4C7U A;  3ZCC A;  1R6T A;  2JS5 A;  2W6J G;  4GX1 A;  4X1K B;  2WA4 A;  2Q0A A;  1WP8 A;  3G6B A;  3OUF A;  1XMQ O;  2EIK B;  1EM1 A;  4LF6 O;  5EZY B;  1SKV A;  4NXN O;  2IJJ A;  3T4D A;  2R9A A;  4FLT A;  4DR4 O;  1BQZ A;  3T1C A;  3GB7 C;  3ZMS A;  1Y76 A;  1IBM O;  1BS3 A;  5B3S C;  3RVY A;  1QLE B;  3ZHT A;  1SES A;  3BAB A;  3P30 A;  4X88 A;  4H0L B;  1GKF A;  3UO2 A;  1FXV A;  1UFI A;  4I50 B;  1VF7 A;  1DLB A;  1AI5 A;  1Q7Y W;  3RYH A;  2RN9 A;  3NR7 A;  1BHA A;  3TXQ A;  2VQF B;  4YY3 B;  1HW7 A;  2YXL A;  3AG2 B;  5D5P A;  4JV5 B;  2YXY A;  4O4H B;  1OCC B;  1FXH A;  1IZ3 A;  4IIJ B;  1SQQ H;  2X0L A;  1R1B A;  1BGY H;  4DV4 O;  4JI4 O;  1G8M A;  1W0K G;  4H44 B;  2EZP A;  4KL1 A;  4DRX B;  3ZHR A;  4DV4 B;  4JI4 B;  1VF6 A;  1AR4 A;  2IU0 A;  4ZOL A;  1YCI A;  2ZDI C;  1VF5 B;  5JJJ B;  4I7Z B;  2L6L A;  1AP6 A;  4I5S A;  1IBL O;  1W0J G;  1Y74 B;  3N2K A;  1GM7 A;  1MSD A;  3O9O A;  3A0B Z;  4DV1 O;  2XAH A;  3JCU Z;  2OIG A;  2QE7 G;  5KLV H;  5AG2 A;  3D8C A;  1VQL V;  3OMN B;  5HFM A;  2F23 A;  2A3Q A;  4CH3 A;  4BW9 A;  4LP8 A;  2UXC O;  3CJH A;  1NBM G;  3BY6 A;  3JAS A;  4RUF A;  4NVP A;  5H2F Z;  4DUZ O;  4MTG A;  4N21 A;  3ABT A;  2KG7 A;  4FFK A;  1VIB A;  3ASO C;  2DOS A;  2ZIM A;  4TV9 B;  2HHH O;  3CC4 V;  3ZBH A;  3J80 N;  1EN6 A;  1N34 B;  3CCE V;  4J9Y B;  2LQT A;  4DV0 O;  2Y69 B;  2QTO A;  3BVO A;  4MVM A;  4JYA B;  3E89 A;  4L87 A;  1OCO B;  4B08 A;  4X64 B;  1OHH G;  4LF5 O;  3B4S A;  1G4Y B;  2CTR A;  5JWP A;  4AHC A;  2QSA A;  3WG7 C;  2YIB D;  1YJW V;  2ATK C;  3E8H A;  4X1I A;  1Q6U A;  1RM1 B;  5CMU A;  2PYJ A;  1EN5 A;  1FJG B;  5C8Y B;  1GN3 A;  2ZR2 A;  1M57 C;  1NTZ H;  5B3S B;  4J11 A;  3ZN1 A;  3UM7 A;  3SPI A;  1VMG A;  5IJ0 A;  1UJW B;  2WLI A;  2YIC A;  1URF A;  3FFQ A;  4BIO A;  2A9H A;  1JOY A;  5LP6 C;  1JVM A;  2HR3 A;  2P22 C;  1IBK B;  1AJN A;  2ZQM A;  2NN4 A;  2EJR A;  4WFF A;  5KA6 A;  2DN9 A;  4U3J B;  3RN4 A;  3ZJZ A;  4HAM A;  5B66 Z;  2DWD C;  3B09 A;  3X2Q C;  3ZMT A;  4X1Y A;  2W0X A;  4JPR A;  2Q67 A;  2XAG A;  2WSS G;  3RWR D;  4UVB A;  1EZV H;  5KHJ A;  4I55 A;  4DR7 B;  5IYB O;  4YY3 O;  2IW5 A;  1XNR O;  3CCS V;  4FFB A;  3ZHV A;  1Q6H A;  3ETE A;  3E8F A;  5KHK A;  1NH2 B;  5JQG B;  1H2S B;  1H2M A;  3G4S V;  1KP3 A;  4LFB B;  4ZHQ B;  1WA8 A;  2KB1 A;  1VF6 C;  3BFR A;  1B6Q A;  3G71 V;  4UCO A;  3DTU B;  3AK1 A;  2WAM A;  4JI6 O;  1H2K A;  5IY5 B;  1JR9 A;  3GVM A;  4LNU A;  4GX0 A;  5LL6 Y;  1N33 B;  4FPP A;  1RFY A;  3RYF A;  5IE9 A;  1HWY A;  2OCC B;  1BQ0 A;  3TXS A;  2X7R B;  1FYJ A;  2UUB O;  2GV9 A;  4OGQ B;  3SYP A;  2P6J A;  1VQK V;  2Z0A A;  4GKJ O;  3SR2 C;  4FLW A;  2A0L A;  4ICG A;  1Y6X A;  5L3F A;  2UUC B;  2HP8 A;  2NLJ C;  2NR5 A;  4JI2 B;  3JD0 A;  3RYH B;  3ZED A;  3E8G A;  1VEW A;  1R3K C;  3UQ8 A;  3LNM B;  2F93 B;  2P90 A;  4KHP B;  1ORQ C;  3SJQ C;  3M99 B;  1COW G;  3N27 A;  3OR7 C;  4TV8 B;  1GMG A;  1K73 W;  5JVD A;  3CMA V;  3TET A;  3QO5 A;  2Z3Y A;  1IX9 A;  2Q73 A;  3Q4H B;  1Q5O A;  3CP1 A;  5JCO A;  3AK3 A;  5IJ9 A;  3HR0 A;  4JI1 O;  1ARO P;  1Q8I A;  3N2K B;  4YJ3 B;  2ILM A;  5IY5 C;  3M7M X;  5K1P A;  4ZI7 B;  2Q8V A;  2HJD A;  3HKE A;  1WAZ A;  1K97 A;  5B1B B;  5JJE B;  3JAR B;  2QTS A;  4JI8 B;  5BR8 O;  1N0N A;  4DR3 B;  1WPB A;  3OTF A;  2YEV B;  2UXC B;  1FFT B;  2RQ6 A;  3A0R A;  5H6Q A;  5CA1 A;  4UCT A;  5B1N A;  3W7U A;  4FM0 A;  3JAS B;  5JH7 A;  5ITZ A;  4F6E A;  4Q20 A;  4QJF B;  4TSF G;  1J5E B;  4TV9 A;  2EIJ C;  3E22 B;  2F4V O;  1E79 G;  3OW2 U;  1BSM A;  3OGC C;  4RUE A;  1RPR A;  1EN4 A;  2P67 A;  2C2A A;  3D3I A;  4LH7 A;  4X64 O;  4MW8 A;  1B04 A;  2YC0 A;  1XL4 A;  2AZ0 A;  2IBZ H;  4LF9 B;  4LF7 B;  3JAW A;  4UXN A;  4R7C A;  4UCS A;  1P7B A;  1XNQ B;  4LBE C;  2CDY A;  3O65 A;  3JAT B;  3CME V;  2GDS A;  3AG4 C;  3E2E A;  4BWA A;  3AG4 B;  5C8Y A;  4DV2 O;  3RW0 A;  4XDJ A;  2GUZ B;  1SF9 A;  4UB8 Z;  5EIB D;  5IJ0 B;  2WLI B;  4XBF A;  1PNM A;  1M57 B;  2KKW A;  5KHI A;  4DUZ B;  4DYL A;  1MG1 A;  1KP2 A;  2ZXW B;  2H8P C;  3EHB B;  1MNG A;  1EBO A;  2E5L O;  2ZT9 B;  3IFX A;  1YIT V;  2R72 A;  1I94 B;  2WLK A;  3IC7 A;  4QPJ A;  4D7T A;  3THO A;  1M9N A;  3FB7 C;  3F7V C;  4LFA B;  3N2G B;  2Y0P A;  1GN4 A;  3BRC A;  4I9W A;  4DV3 B;  3H1J H;  2VQE O;  2QA4 V;  3AK2 A;  4WFE A;  4DV7 O;  4LWS A;  4R50 A;  2R70 A;  4X66 B;  2QJ1 A;  4LFC O;  4X20 B;  4K8X A;  2UXX A;  4I55 B;  1H8E G;  1TUE B;  2ZIN A;  4NKG B;  2QKA A;  3CCR V;  1GRJ A;  1OCZ B;  2AGA A;  4JYB A;  1YHQ V;  3ABK C;  4OPH A;  3S3X A;  3DXR B;  5BMV A;  4DR1 B;  4QNH B;  2QGN A;  5CB4 B;  5LA6 B;  4QGP A;  2FB5 A;  4LCU C;  4UV8 A;  1Q6I A;  1BHB A;  1Y66 A;  1F23 A;  3BEH A;  1THZ A;  2JIZ G;  1MA1 A;  2E75 B;  3CRC A;  5GTI Z;  3JD1 A;  5GTH Z;  1NS1 A;  1EZJ A;  3P3P A;  5B1A B;  5FNV B;  3WFV A;  3APQ A;  2X6A A;  1MZF A;  4MW3 A;  1FAF A;  1Q43 A;  1P4R A;  1VQ4 V;  5KHG A;  4ZIB A;  1IVS A;  3B40 A;  3A0H Z;  3RBZ A;  5L3E A;  1GM9 A;  3OTO B;  4NTX A;  1S0V A;  3CYO A;  1R6N A;  3FYE B;  3OMA B;  1HNZ O;  3CCV V;  4PDL A;  1YF2 A;  5L3G A;  1I5X A;  3OT7 A;  3K03 A;  4Q6G A;  2PUS A;  3H1L H;  1XOU A;  1JX9 A;  1GO3 F;  2QM4 A;  3BPZ A;  1PPJ H;  4TV8 A;  5IWA B;  3P3N A;  1NKD A;  2EX3 A;  2IM9 A;  3ABM C;  5JJN B;  5J2U B;  5H5N A;  4E4E A;  5E79 Z;  1AJP A;  3CCU V;  2Y69 C;  4WFG A;  2YIB A;  3CB2 A;  1N0J A;  4TT3 G;  5B1B C;  1YJN V;  3CPW U;  2OTL V;  1S76 D;  1E1R G;  2EIL B;  4L8J A;  3ZRX A;  4I4T B;  2JDI G;  5IJ9 B;  4DV6 B;  3UO3 A;  1NT2 B;  3L74 H;  4LR3 A;  4X65 O;  3RYC B;  1YDX A;  4I0X A;  3GWK C;  1P49 A;  2ITC C;  2HFE C;  3ASN B;  4ZI7 A;  4JV5 O;  2GBO A;  4EB6 B;  4DR3 O;  1Z5V A;  2PZS A;  3ZRW A;  2Q6A A;  4RAI A;  4OPA A;  2ZR3 A;  4WBN A;  1E1Q G;  4PI2 A;  1JJ2 U;  1CXZ B;  4JTC B;  3I55 V;  3OE7 G;  4JTD B;  1V54 C;  1BMF G;  5LGT A;  1Q82 W;  1JFF A;  2R9I A;  5JH7 B;  2WLH A;  3KCY A;  1KB9 F;  1BT8 A;  4FZ1 A;  3ZRV A;  5CA0 A;  3JSL A;  5H9C A;  1P84 F;  2EIM B;  5J9P C;  2Y0I A;  5BZB A;  1HNW B;  1ZUQ A;  2ZE5 A;  4YJ2 A;  2OTJ V;  4MVZ A;  1AR5 A;  2W6I G;  1WLE A;  2ETN A;  5K1X A;  1AR1 B;  3CS5 A;  3MHS C;  2YDE A;  1KYO F;  4DW0 A;  3C3T A;  2CAZ C;  4B3S O;  2EIJ B;  1XBL A;  1DGS A;  2WLJ A;  3K3W A;  4UVA A;  5DM6 V;  4PA6 A;  4MTO A;  4JAV A;  4PA4 A;  4FM1 A;  1AP5 A;  2A06 H;  4YXW G;  1MZE A;  4DUY B;  3OTO O;  3APO A;  4O2B A;  1JMK C;  1V55 B;  2PGG A;  2K9P A;  2LW1 A;  2YID A;  3VQW A;  3FKS G;  1XI1 A;  3CC2 V;  2BTO A;  2JJ1 G;  4UCV A;  1V9P A;  1SER A;  2F43 G;  4G28 B;  4B7K A;  2GUZ A;  4BW5 A;  1PKX A;  4DW1 A;  3T1Y B;  2MK3 A;  3OAA G;  4B7E A;  2WLL B;  1SRY A;  2BTQ B;  2OYQ A;  4IHJ B;  1QQC A;  2DE0 X;  4UFZ A;  4DO2 A;  3FYI B;  4TQF A;  1AI6 A;  5FLX N;  3CRM A;  3N2G A;  3ZHU A;  3QVN A;  1QBZ A;  4NR1 A;  4JYY A;  4JI8 O;  3HKB A;  1XHZ A;  4CS3 A;  1VQ5 V;  4UB6 Z;  2DYR B;  1K4C C;  1WB7 A;  4O4L A;  2Q69 A;  2ZE6 A;  1XUQ A;  1CP9 A;  1MAB G;  2EIL C;  1NVP D;  3BA8 A;  3LNN A;  4TWK A;  2ZDI A;  5J2T B;  1OCR B;  2YUA A;  2HJF C;  1RSO B;  3SPC A;  1K7D A;  1T5E A;  3ABL C;  2G38 A;  2UUB B;  3TCU A;  2CH7 A;  5KX5 A;  3E83 A;  2VWK A;  3F5T A;  4XDL A;  3A2F A;  4JGS A;  5CA3 A;  3JAL A;  5GON B;  2UUA O;  1DK1 A;  2E5L B;  2YXH A;  2Q7H A;  4LFB O;  3KG2 A;  1YZB A;  1K8A W;  3W7W A;  4RO2 A;  4HZ3 A;  2BSK B;  4J80 A;  3WB2 A;  4ZKI A;  3OEE G;  3K5M A;  3B77 A;  2CTQ A;  4U7O A;  2B1G A;  3W7X A;  4CH6 A;  4OX9 B;  4LC1 A;  2M7W A;  4PA7 A;  1MSW D;  3JAK B;  2D2C B;  3MHH C;  2QEX V;  1S5J A;  3CCL V;  3U0Z A;  1Q90 D;  2QR4 A;  4X9Q A;  1GTO A;  2CTP A;  2ITD C;  1O9G A;  1BL8 A;  4QE7 A;  3K0D A;  3OFN G;  2E74 B;  3HKD B;  4PA9 A;  1TUB B;  5J2U A;  4FMT A;  4U3F H;  2UUA B;  3JD4 A;  1ENV A;  2NNU A;  1N36 B;  4NTW A;  3TGU H;  3LDD A;  3ABL B;  2QM8 A;  1FKA O;  4ABM A;  1H38 A;  3AG2 C;  1PP9 H;  1PL4 A;  4CS2 A;  4D7S A;  5CBF A;  1FXK A;  5LOV A;  4JI0 O;  5HFL A;  1SZT A;  3K5L A;  3ICX A;  4I0X B;  1WPX A;  4AQY B;  3K5N A;  3UT5 A;  4EB6 A;  3L75 H;  3ZRW B;  2UXN A;  4F6R B;  2JVD A;  1I7F A;  3GWO A;  1N33 O;  2PI4 A;  4JZG A;  1GAX A;  1X4T A;  2IU3 A;  2KSD A;  4GKJ B;  1NJI W;  3F5W C;  4PEL A;  2ZM6 B;  1N4C A;  4O4H A;  4EFB A;  3SJB C;  4O4J B;  3AG3 B;  5BXZ A;  2WLM A;  3HB3 B;  4YJ2 B;  3DSQ A;  5LBQ A;  4MVS A;  4FM2 A;  1QVG U;  1Q86 W;  3VOU A;  3K04 A;  5FPR A;  1RPO A;  4B3S B;  2DW4 A;  3B8N A;  4UVC A;  4GLX A;  4DV5 B;  3K59 A;  2H94 A;  3A8T A;  2K1E A;  2XAS A;  5BR8 B;  2IH3 C;  3CXC U;  4ZOL B;  4WFA V;  2HLD G;  2PY5 A;  5L3C A;  1K92 A;  1OV9 A;  4TUY A;  2OWO A;  5LHH A;  3IGA C;  5EBL C;  1H2L A;  3CRQ A;  3LSS A;  2QWN B;  4MS2 A;  3K58 A;  1EFR G;  3TJT A;  2ZIO A;  2DYS C;  1J5E O;  2HG5 C;  3IJ4 A;  4CC5 A;  4JAA A;  4NYK A;  5L3D A;  3SPG A;  4JI3 O;  3CJH B;  1HR0 B;  1Y4M A;  4JF3 A;  1BE3 H;  3DC5 A;  2XHB A;  4EEQ A;  1VQ9 V;  3I5D A;  2WLL A;  1PV0 A;  1WP7 A;  1SQX H;  1FXK C;  4LF9 O;  3WB0 A;  1HR0 O;  2DQ3 A;  3FX7 A;  4J10 A;  4CC6 A;  5DN6 G;  1M1K W;  1QR9 A;  4BAY A;  3WB1 A;  2JGD A;  2LFS A;  1B3Q A;  4AIL C;  3FD9 A;  1YI2 V;  3RYI B;  3PJS K;  3PN1 A;  2RNB A;  3OM3 B;  1I08 A;  4JI5 B;  1FFX A;  2W0F C;  4O4L B;  4GKK B;  2FYU H;  3T1Y O;  3U11 A;  4JI5 O;  2DYS B;  4UV9 A;  1SET A;  2YS8 A;  5LMU O;  4MVU A;  5KHH A;  5J2T A;  3QO8 A;  3G67 A;  4FLX A;  2X6C A;  3JD2 A;  4HBN A;  2CUG A;  4WCE V;  4DV0 B;  4NXN B;  1J95 A;  2N74 A;  1OJH A;  1QLE C;  1QCE A;  4WF9 V;  2CH7 B;  4J42 A;  1ZL8 A;  1QLN A;  1N36 O;  3H1H H;  3ZHQ A; 
#chains in the Genus database with same CATH homology
 4DV2 O;  4LF8 O;  3OTO O;  1XNQ O;  1HNZ O;  4X62 O;  5IT9 N;  4X66 O;  2JRI A;  1IBL O;  2E5L O;  5BY1 A;  4DR7 O;  4LFA O;  4YHH O;  2LW7 A;  4DV1 O;  2DJV A;  1X59 A;  4DV5 O;  5H5N A;  4JI1 O;  1I94 O;  5IWA O;  1A32 A;  1AIL A;  4YY3 O;  4DR1 O;  1J5E O;  3RT3 C;  1XNR O;  1N32 O;  2UXD O;  1R6T A;  4NXM O;  4DUY O;  2UXC O;  2VQE O;  3J81 N;  4DV7 O;  1IBK O;  4DR6 O;  4OX9 O;  4DUZ O;  4JI3 O;  4DR5 O;  5BR8 O;  4X65 O;  4LFC O;  4KHP O;  4LF4 O;  5FLX N;  1F7Y A;  2DOS A;  1XMQ O;  3T1H O;  4JI8 O;  2HHH O;  4JV5 O;  4LF9 O;  1FJG O;  2AGA A;  1HR0 O;  3J80 N;  1FKA O;  4DR3 O;  2UUC O;  1HNW O;  4DV6 O;  4DV0 O;  4OPH A;  4JI6 O;  4JI7 O;  4LF7 O;  4B3R O;  4OPA A;  4LF6 O;  5LL6 Y;  4JI0 O;  4JI2 O;  4NXN O;  4DR4 O;  1IBM O;  2VQF O;  3JAM N;  2UXB O;  1FYJ A;  2UUB O;  2F4V O;  4LF5 O;  4B3M O;  2Z0A A;  1XEQ A;  4B3T O;  1XMO O;  4GKJ O;  2UU9 O;  5A2Q N;  4K0K O;  3R66 A;  4AQY O;  1N33 O;  1G1X B;  3T1Y O;  4JI5 O;  2FKX A;  4GKK O;  4X64 O;  5LMU O;  1D2D A;  5LMN O;  3F5T A;  1NS1 A;  4JYA O;  1N34 O;  1AB3 A;  3SDL A;  1R1B A;  2UUA O;  1DK1 A;  4DR2 O;  2N74 A;  4DV4 O;  4JI4 O;  4B3S O;  1KUQ A;  1HNX O;  2ZKO A;  3M8A A;  5BXZ A;  4LFB O;  3O65 A;  1YZB A;  4A5U B;  1N36 O;  4DV3 O;  3J7A U;  2ZM6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...