2FKXA

Ribosomal protein s15 from thermus thermophilus, nmr recalculated structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S15
molecule tags Structural protein
source organism Thermus thermophilus
publication title The Conformational Landscape of the Ribosomal Protein S15 and Its Influence on the Protein Interaction with 16S RNA.
pubmed doi rcsb
total genus 26
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2fkxA00
4OX9O 2F4VO 4GKJO 4B3SO 3OTOO 4OPAA 5IT9N 4X62O 2DOSA 1XEQA 2UUCO 3JAMN 1DK1A 3SDLA 1XMQO 1HNXO 1IBMO 4JI0O 1XNRO 1AB3A 4LFBO 4JV5O 4JI4O 4YY3O 1X59A 4JI3O 1I94O 4LF4O 3T1HO 4JI5O 5BXZA 1YZBA 4AQYO 5LMUO 2UU9O 1N33O 3RT3C 4LFCO 4A5UB 2UUAO 5LMNO 4DV2O 1N34O 2JRIA 4GKKO 2DJVA 4JI2O 1F7YA 4X65O 2Z0AA 2UXBO 4DR7O 3M8AA 1R1BA 5LL6Y 1HR0O 5A2QN 1R6TA 4DR4O 5BY1A 2UUBO 4DR6O 1D2DA 5BR8O 1FKAO 4LFAO 4LF9O 4JI8O 4NXNO 4JYAO 2ZKOA 4LF8O 4DR1O 1NS1A 4DV7O 1HNWO 1HNZO 2UXCO 1G1XB 1IBKO 4KHPO 4LF6O 2UXDO 4YHHO 4DV6O 4JI7O 4OPHA 4JI6O 4JI1O 2N74A 4B3RO 4B3MO 2AGAA 1N32O 1IBLO 4DUZO 2VQEO 1A32A 5H5NA 4NXMO 2LW7A 4LF7O 4DR5O 1AILA 3O65A 4DV1O 1KUQA 4K0KO 4DV5O 1FYJA 4DR2O 4DR3O 2VQFO 1FJGO 4DV0O 2ZM6O 3J81N 1N36O 2E5LO 2FKXA 4DV4O 3R66A 1J5EO 2HHHO 3J7AU 3T1YO 4X66O 5IWAO 4DV3O 5FLXN 1XNQO 4X64O 4B3TO 1XMOO 4DUYO 3F5TA 4LF5O 3J80N
chains in the Genus database with same CATH superfamily
2F4VO 4AI8A 3VQXA 3CCJV 3D8CA 4RQEA 4RWUA 1YEWA 3E8BA 1OCCC 1I5YA 1GM8A 1QNMA 1TVKA 2DQ3A 5EC2C 1VQPV 5KHJA 1N36B 2Q7HA 1RPOA 4JI3O 1V9PA 4LWSB 2HP8A 3H1JH 4N23A 4TUYA 3P3PA 2X7RB 3A0BZ 3IAYA 4U3FH 1LNQA 4JI1B 1IVSA 1H2MA 2Q6AA 1KU9A 2YEVB 3B8NA 3STLC 4X65O 5EBMC 2BTQB 2MK3A 5EYPB 1JA8A 4DRXB 1BHAA 1N0JA 5LHIA 3WB0A 4NXNO 1CEZA 3OAAG 2HLDG 4I0XB 5IJ9B 1L1FA 4JASA 4QPKA 4JI1O 1WB7A 4I50B 2A9HA 4DV0B 1V55B 3RGBA 2LW7A 2R9IA 2W0FC 3CMEV 4PELA 1CP9A 3OMNB 5ITZB 1S77D 3RBZA 4RUEA 5KX5B 4DR2O 2EIMC 2PI4A 2VQFO 3SYCA 3F7VC 1N36O 3JASA 2YXLA 3MHHC 3CJHB 4I9WA 3IGAC 3DSQA 1S5HC 1Z5WA 3R66A 3FYEB 4YY3B 2PGGA 1J5EO 1LUVA 1S0VA 3HB3B 2ZNJA 5LOVA 1FXHA 5FPOA 1YHQV 1BHBA 4C7UA 1IBLB 4OX9O 4JI4B 2WPDG 5H6QA 4BIUA 1JR9A 3LDDA 4BW5A 1URFA 1Y4MA 3P3NA 1HNXO 1OCZC 1VF6C 4JI0O 1IBMO 4LBEC 2GDSA 3JARB 1X4TA 2PUSA 2JK5C 4JYCA 1K4DC 4O2AB 2ZXWB 3WG7C 4WCEV 1K34A 2QKCA 4FLWA 2YIBD 2LP7A 3HKCB 1VF5B 2LW1A 3FB6C 3OT7A 5CA1B 1P4RA 4EFEA 3B40A 3D3QA 5C93A 2Q69A 1N34O 1TAEA 4FVMA 5LGUA 1FXKC 3SPIA 2JJ1G 3KZIZ 4K8XA 3BFRA 2LQTA 3SJAC 2Q0AA 3E8GA 3ZHQA 2XAHA 1AR4A 3LSSA 5J2UA 1JJ2U 1AR1B 3CSXA 3K5NA 3KCYA 1P7GA 2B1IA 3A0RA 4FIPC 4CBCA 4PDMA 3ZHVA 1K8AW 4I9QA 4YJ2A 2H3OA 1OCCB 2Q7GA 3O65A 2WLIA 1AJPA 2DMXA 4K0KO 3ZBHA 2X6AA 4D7SA 3QO8A 3CYOA 4ZI7A 2EIJB 2UUCB 1M57C 1AI5A 1XREA 2Y48A 4GCZA 1K9MW 4X89A 2X6BA 4HNAA 1WJZA 1HNWB 2VS0A 4FLXA 1XNQO 3KKYA 3ZRVA 1M57B 2OWOA 4B7EA 4JGSA 3CE2A 3QNEA 4F6RA 1Q6IA 2Q67A 4G2KA 4FZ0A 3SR2C 5KUMA 4FM0A 2ZE8A 1VQ8V 1SESA 1B6QA 4LCUC 2N04A 2Y4TA 4B7KA 4A5UB 4YHHB 4DV3B 4UV8A 3CS5A 2Q73A 4B3TB 3Q4HA 1YJNV 4UV9A 2QWPB 1AJNA 3JD4A 3G6BA 3CHXA 3RVZA 3EVKA 1K5SA 5B66Z 3I55V 3DXRA 3RYFB 1BL8A 4ZOLB 3M8AA 3TXSA 4DR3B 5J2TB 3TETA 3AG2B 1B06A 1D5AA 1IURA 4P2ZA 1Q8IA 1QVGU 4DR6B 4JAAA 4AHCA 5EBWC 3CRMA 2DW4A 4KHPO 2IU3A 1WA8B 4YHHO 1LUWA 3GWOA 4DXWA 2YIBA 2FMLA 3JSLA 5BZBA 1PKXA 4IYHA 3SGIA 5JQGB 4ZKIA 2IH3C 1GTOA 3C90A 4YIOA 1PPJH 2P67A 2W0XA 1ZSPA 3W7SA 4DR3O 2Q5ZA 4QPJA 3BCCH 4LFAB 4J42A 3E22A 3IC9A 3G71V 5KHHA 2IJHA 3J7AU 2HG5C 1XL4A 4X1IB 4CH6A 4WFGA 5B3SB 4UCVA 1SETA 4IT5A 4X64O 4AQYB 4ZIBA 2ZINA 3VOUA 2ODMA 2AZ2A 3PN1A 3A0HZ 1NR7A 2JIZG 1YF2A 3LDCA 4B3SO 1SQFA 3ZHTA 4W4KA 1YTFD 2ZM6B 3BAAA 4CS4A 1TVKB 1OCOC 1P84F 3ZCCA 2RN9A 4X20B 1K7DA 2IJJA 1AB3A 1IZ3A 4I55A 1X59A 2ATKC 2CK3G 3OEHG 4LWSA 1N4CA 5FPRA 1COWG 2UXCB 1NR1A 3K04A 1XMOB 2AHYA 2VQFB 2IW5A 1BGYH 3P30A 1QR9A 4UFZA 3CCSV 2QKAA 2GUZA 1TUBA 3CMAV 3BABA 1WP7A 2UXXA 5JQGA 2DN9A 5B1AC 3R65A 2BTQA 1GN4A 1PV0A 4CZZA 2B1GA 3H01A 3ML0A 2KG7B 4IHJA 1JMKC 5BR8O 2UXBB 3E83A 4LFAO 1YXBA 4JYAO 1J95A 4PD4F 4ZHQB 2Q8VA 5F2VO 4JAUA 3ZRWA 2HJDA 2KSDA 4TWKA 5CA0B 1BQ0A 3F7YC 2MW2B 4J9ZB 4PA9A 2L35A 2P90A 4L8JA 4B3MO 2LFSA 2QSAA 3E86A 3SPCA 1V55C 3WFVA 1BT8A 2WA4A 5FNVA 4H0LB 2VQEO 2OCCB 4UCSA 1Q5OA 5DEDA 1HWYA 4PI2A 4UCOA 4GYCB 4LF9B 4DV5O 1Y76B 3UO3A 5KHGA 4QGPA 2WLMA 4WFEA 1R3KC 1GN6A 3JAWB 1NQTA 3H1LH 1MMMA 4O4IA 5C8YB 3ABTA 3CXCU 2VQEB 1VMGA 2QDOA 2QM7A 5KHIA 1U97A 2ITDC 1THZA 1PNKA 3A2FA 4EFBA 2XAJA 2XAFA 1Q43A 1O9HA 4JI4O 1CXZB 2AXTZ 3CCQV 3S3WA 1E1RG 2QTSA 5IYZA 1KQSU 3CC4V 1WPBA 4N21A 1XILA 1W59A 3THOA 2P22C 1L0NH 1OCZB 5FNVB 1QHTA 1QVFU 2ZDIA 1RPRA 4PV1B 3D36C 1XNRB 5CA0A 1SQPH 3D3IA 4FMTA 4CH5A 4FFBB 2ZD9A 4MT8A 1BSMA 1QR8A 1W2BU 3T4ZA 1NH2D 1K4CC 4K3AA 2Y0IA 4GX2A 3D36A 4NYKA 3L70H 1B04A 2QWOB 4FLYA 4OPHA 1NTZH 3CXHF 4B3RO 1M5IA 3E89A 2KQXA 1P49A 1ENVA 1R6NA 3JD2A 2Y0PA 2HEPA 1ZTEA 2F95B 4IIJB 3SYQA 2WLHA 3CCMV 3CRRA 3TCUA 4DR7B 4IYIA 2PYJA 1G4YB 1OJHA 4ZBMA 1HNZB 3RYIA 2FB5A 3L72H 2LJ2A 1BQZA 4QE9A 3KCXA 2CAZC 2DE0X 5D5QA 3ZRXA 2UXDB 1Z2GA 2HFEC 5L3BA 3OTFA 2CTPA 2LGQA 4O4JB 3JALB 3OFNG 1CPYA 3J80N 1HP8A 4OXSA 1FPOA 2M7WA 4I7ZB 2F43G 4TSFG 1H2GA 3IC7A 4B3SB 3CCEV 4L87A 3N2GB 4NXMB 3KG2A 4J41A 1N33B 5IYCO 2YIAA 3SYPA 5LOVB 1N33O 4WBNB 3H1HH 5LMNO 4FM2A 3B09A 4GKKO 3CP1A 1Y6XA 4HZ3A 1QLEB 2EJRA 4JTCB 1W0JG 1SQBH 3ZEDA 1F4MA 2ZE6A 1DGSA 2UUBO 3GWKC 2WLNA 1VIBA 2JVDA 2IJIA 3RYHA 4WFFA 3DC6A 2PYLA 1HNWO 4BIZA 3ZMZA 2XHBA 4JAVA 3L74H 2AHZA 1WAZA 2N74A 4DUYB 1UPGA 1IBLO 1TA8A 5LXTA 3HKDA 1SQVH 1AILA 1VP7A 2YXYA 1KP2A 4FJCC 4MS2A 4UB6Z 2F93B 4U7OA 4DR5B 4P9PA 1R6KA 3ETQA 4DR4B 2XT9A 5HFMA 4CC5A 4O4JA 2PTMA 2JJ2G 4FLUA 4UCTA 3UCSC 4DV4O 3OD4A 2X6CA 1S5JA 4I5SA 1XNQB 1ZLZA 3CX5F 1JX9A 3E8HA 3JD0A 4DV3O 2BSKB 1H2KA 3CC7V 2WLJA 2B9ZA 3OE7G 4DUYO 1EN4A 3SPGA 2IBZH 4WF9V 3RYCB 3QO5A 1XBLA 4FPPA 5J2UB 3FKSG 4X9QA 1BMFG 3SDLA 2Z5UA 2EIKC 3T2MA 2BCCH 3ZHUA 3K59A 5CBFA 4K8ZA 4JV5O 4B3RB 3UT5A 4YY3O 1IDSA 5KAIZ 4PI0A 2EX3A 4MTFA 3AG3B 1OV9A 2QM4A 5BXZA 4X1KB 2ZXWC 3RW0A 5DN6G 4F4LA 1I5XA 2A79B 4J80A 5TISZ 2IH1C 2CUGA 2RNBA 5IE9A 5B1OA 3MAQA 1T5EA 2K9PA 5BMVA 3QO7A 4LF7B 4E4EA 4HYOA 1EFRG 5A9GA 4DR6O 3GVMA 2QM8A 5CBGA 2VRZA 5KX5A 5LXTB 4G27B 2NN4A 3SJQC 4FK5C 2HJFC 3ASOC 2ZIOA 3K0GA 2ZT9B 3L9DA 4JI6O 3RYCA 5LGNA 3RN4A 2YSUB 4J9YB 1AI7A 3VBBA 4H13B 1ZAUA 4LH6A 2RQ6A 1P7BA 3K9AA 3AG1C 5KHKA 2VWKA 4DV0O 4JF3A 2W6IG 4GKKB 3CPWU 3NXSA 3ETGA 4ICGA 3N27A 3T1YO 1PP9H 4X66O 2GTAA 1NZ6A 2E74B 4X66B 4B3TO 4NTWA 2QWRB 1AP6A 2XOKG 1FFTB 4DO2A 1NI8A 3ZMSA 4UB8Z 1UFIA 2CTRA 4X1YA 1R73A 4NVPA 3UO2A 4DV6B 4MSWC 4JYAB 1FD9A 2WSSG 4LF4O 2EILC 4J7JA 2YI8A 4KXRA 2EULA 2HR3A 3STZC 1V54B 5J9PC 5LMUO 2BOCC 2E76B 2JGDB 3H9VA 4J7ZA 5JH7B 4G28B 4LNUA 2XNDG 2Q4PA 1VQNV 5CMUA 2OIGA 1VQ5V 2GSMB 1XHXA 1AI4A 4FLVA 5BR8B 2UXBO 5LL6Y 3ABLB 1XMQB 5JVDB 4TV9A 3U11A 1FJGB 1Q3EA 1EN5A 1SQQH 1WPXA 2JDIG 1VQ6V 2Q68A 2CE4A 1NH2B 1HW7A 2HVKC 4LFCB 3JCUZ 3JYCA 1GMGA 1JVMA 2OCHA 3CC2V 3ZN0A 3K06A 4DUZO 3DGEA 4NXMO 2E5LB 4X1YB 3L75H 2LGWA 1JOYA 1PM9A 3EFFK 3TGUH 4O2AA 2EIJC 1PNLA 2YDEA 4J10A 1SKVA 1HNXB 3JAKA 1RSOB 4DR2B 2P4KA 3C3SA 1N8RW 2ILMA 1VQOV 1HDJA 3ASNB 4X62B 2YIDA 5KLVH 2UUAB 2EIMB 1H2NA 1Z5VA 1PL4A 4QJFB 2OIEA 3CWBH 3SPHA 4HAMA 3WU2Z 3OTOO 3MDSA 4RO2A 2DOSA 3QG5A 4MW3A 3M99B 5H2FZ 3SJBC 1XMQO 3BHPA 3LSQA 3AG4C 1M56B 4UUJC 4QE7A 4K35A 1I7FA 4O4HA 3M7MX 4U3JB 3OW2U 2ZE7A 1YZBA 1SQGA 4X64B 4AQYO 1Y76A 4DV1B 4O4IB 3BA9A 1VQ9V 4LFCO 1Y74B 2UUAO 2CH7A 2X0LA 5L3FA 1Y67A 4TV9B 3JSNA 3K79A 1EM1A 4ZI7B 1YJ9V 1WNSA 2EBOA 5IJ9A 1R6TA 4PDLA 3ZN1A 3VQWA 1GN3A 1WP8A 2D3OW 3LUTB 2UXNA 1YJWV 1M1KW 2UXDO 4RAIA 1Q7YW 2YI9A 1FXVA 4R8CA 4TQDA 5HFLA 3IJ4A 2H8PC 2RMKB 3AEIA 4X1IA 3MHSC 1F4NA 4J7KA 1SRYA 4U7NA 5LMUB 3PJSK 2YICA 3FAVB 1VQ7V 2QWNB 5JJJB 4P30A 4FLTA 3J81N 2B5UA 3L73H 1SA0A 4O4HB 1IXBA 4DYLA 4TQFA 5DM6V 3AK2A 4X20A 2Y69B 1PNMA 3Q4HB 1S5LZ 4YJ3B 4XDKA 3RYFA 4ZOLA 1TUBB 3BEHA 1DK1A 3LDEA 3ETDA 2CGOA 5JWPA 3AG7A 4R50A 1SQXH 2QE7G 3QF7A 5KUKA 4RQFA 3ZJZA 4UCRA 1SERA 1GO3F 2V4DA 3K9SA 3BY6A 2CTWA 4ASUG 5L3DA 2ZIMA 5D5PA 4DV2O 1MOFA 4BWAA 2YUAA 5AG2A 1F23A 2DJVA 2EIKB 2OTJV 5CA1A 4PA3A 4LP8A 4TV8B 4DR7O 4DR4O 5BY1A 3OMIB 4LF5B 4R7CA 1I94B 1IX9A 2OTLV 1N34B 1FXKA 4EB6A 1MZEA 4GX0A 4DV6O 4TUYB 2DYRC 1RM1C 3OR7C 3FFQA 5LGTA 4X65B 3QTCA 2AGAA 1N32O 3JAWA 4PDRA 1DLBA 3E8FA 4DR5O 2A3QA 3U10A 4NXNB 1H8EG 5C8YA 3HKEB 1KKDA 2R72A 5GTHZ 4DUZB 3ZMTA 4KL1A 5FL7G 4DV4B 5EIBC 1V54C 3T4DA 4R6ZA 3CCUV 4LF8B 2EILB 4F6EA 2AW9A 4FLZA 1ZX3A 3AG1B 1MA1A 3RVYA 4X8AA 2KB1A 5GONA 4GKJO 4OGQB 5IDJA 1MNGA 4TV8A 1Q6UA 3T1CA 5L3CA 2R9AA 3RFRA 1GH6A 4ZHQA 3ASOB 1K92A 4FZ1A 3P32A 1AROP 4MVQA 3ZMVA 1M56C 4Q20A 3LNMB 1Q6HA 1JJOA 3W7TA 3CRAA 2R70A 2JS5A 2A0LA 5CB4B 1XL6A 1AVMA 1FFXA 4LF4B 2JRIA 3K5MA 3W7UA 2Q0OC 4JI7B 4XBFA 1OCOB 4IL6Z 5J2TA 4O2BA 2Y4UA 4GT1A 3K08A 5KA6A 4DW1A 3HKEA 1YDXA 5B1BB 1MG1A 3CCVV 1DF4A 1YITV 2F1MA 3A8TA 3ICXA 2FTKA 4MVRA 5LHHA 5EZYB 4LF8O 1ZL8A 4DR1O 1NVPD 5KAFZ 1KBHA 1U96A 5IJ0A 1Y66A 3T1YB 5H9CA 1QLNA 5B1AB 1EBOA 4FFKA 5CN0A 1H2LA 4PDVA 3C3TA 4DV1O 3E22B 1KUQA 4X1KA 3K5OA 2H94A 3GB7C 1SZXA 2QEXV 3JCZA 1EZJA 1BE3H 4JV5B 2ZM6O 1RFYA 3UKMA 1QCEA 3I5DA 2E5LO 3CD6V 1K5QA 4LH7A 4UCUA 3B2EE 5LHGA 2HKOA 3HPLC 2Y69C 3AK1A 5CB4A 2BE3A 4KP4A 3SJCC 5E79Z 2P7TC 2CGNA 3UM7A 4LF5O 4ABMA 2QA4V 1IBMB 5B3SC 3SYAA 4BW9A 1M93A 4OPAA 4I55B 4TOIA 5EBLC 5LP6C 2UUCO 1K3EA 3FB8C 4PA6A 2PZSA 3ASNC 1FFXB 1NVPB 5LA6B 1FS0G 1KC8W 1WLEA 4D7TA 3HKBA 1YI2V 2UU9O 5GW7A 3DTUB 3RT3C 5KMGB 4MVUA 3UQ8A 5B5EZ 3FYIB 3RYHB 1G6UA 3CRCA 4LF6B 1VF6A 1GAXA 2WWWA 3N2KA 2CTQA 3B8MA 1AJQA 4DV2B 3HR0A 1XOUA 1GM9A 1R1BA 4FM1A 2QKSA 4WFHA 4EKWA 3X2QB 4LF9O 1KP3A 1H2SB 1EZVH 4F6RB 2FL4A 1JCHA 5JJEB 5JH7A 4DV7O 1FAFA 4NTYA 3K58A 2GBOA 1IBKB 1M9NA 3ABLC 1B3QA 4YIPA 2GV9A 4GX5A 2RCVA 2PI5A 4LF7O 4JYBA 4X88A 2M6YA 1SS3A 2EINB 3VQYA 2KKWA 2DYSC 1FJGO 1N32B 1K33A 4MVZA 4CS2A 1VQLV 1MSWD 2RDCA 2YEVA 1OZ0A 4XDLA 2JEXA 4JI6B 4JZGA 1S3JA 4Z2WA 2OYQA 4RUFA 2QTOA 1JQ0A 4I4TA 1LR1A 1GM7A 4DW0A 2DWEC 2E75B 3SYOA 5JVDA 4H44B 1D5NA 1SF9A 3CCRV 2P5OA 5EK0A 3OTOB 2P06A 1GK9A 4DV5B 5JCOC 5IT9N 3G4SV 1XEQA 3H1IH 3JAMN 1JFFA 2QR4A 4MVMA 1I0HA 2DWDC 2F23A 1R3IC 3E2EA 1XNRO 4UVBA 1KMIZ 1KYOF 4LFBO 3ABMB 2ETNA 3EHBB 5BMVB 4I50A 1ORQC 3FD9A 4WFBV 1PL0A 3ZS8C 3T1HO 4JI5O 1H38A 3N2KB 1AI6A 3AG2C 3OM3B 3OUFA 1J5EB 3FX7A 3BA8A 1BCCH 5E1AC 1TGOA 5L3GA 4CH4A 4DK0A 4FFBA 4PHZA 3JAKB 1EN6A 3MD0A 1RSOA 3ZMUA 4JI2O 4NB5A 2F4VB 1QBZA 3CJHA 2XTAA 1F7YA 4MTXA 5GTIZ 2Z0AA 1H8HG 5B1NA 2NLJC 3WB2A 1Q86W 1UJWB 1R3LC 1GKFA 5A2QN 1DF5A 5EIBD 4KHPB 3WB1A 2N05A 4JI8O 2JGUA 4BR6A 3X2QC 3W7WA 1W0KG 4JI3B 3DC5A 2OT5A 2G38A 1Y74A 3BRCA 1G8MA 2CH7B 1BZKA 4EB6B 1M90W 4Q6GA 5LYJB 2A06H 4JZ2A 3DXRB 2GHYA 1Q82W 3JARA 2FYUH 1A32A 2E3CA 5CBHA 2LO1A 2R9RB 1NTKH 1AR5A 4JTDB 4JI8B 2KG7A 3G80A 2YXHA 4IIJA 4JI0B 3TK1A 1BS3A 1YCIA 1YVWA 1K73W 1XHZA 5JCOA 3ZX6A 3JD3A 2BOBC 5IWAO 1HR0B 2XAGA 3RYIB 2ZNIA 3HKCA 3I56V 4MTOA 3F5TA 1YTFB 1XDCA 2QWQB 5GONB 3APOA 3ABKC 2OCCC 2WLKA 4GUNA 1NBMG 4E2LA 4GX1A 4GLXA 4IGGA 4MW8A 3N2GA 2DYRB 1NTMH 3K5LA 2VWJA 1NU1H 1WN7A 2JEUA 2K1EA 3BPZA 2ITCC 2ADPA 4HBNA 3F5WC 3JATB 1I94O 1VQMV 1K97A 3CEIA 4LC1A 2WLLB 4D6TH 1MABG 1VEWA 2WLIB 3FAVA 4YJ3A 4TT3G 4KUMA 5DECA 2ZCEA 3BVOA 5CA3A 3AG4B 1ZUQA 4J11A 3O9OA 4OX9B 4WBNA 4QNHB 3AG3C 3K57A 5EYPA 1D2DA 1N0NA 1FKAO 4K0KB 1MSDA 2Z3YA 4MTGA 5EZYA 1IXMA 2ZKOA 1ZL8B 3W7XA 3OR6C 3U0ZA 2A7WA 2GUZB 3E35A 2L6LA 1YSCA 1F51A 3RWRD 1E1QG 1VQ4V 4GZRB 5IYZB 4LFBB 3B4SA 2V7QG 4Z1MG 1RP3B 5IYDO 2UU9B 4BIOA 4PA4A 2RJZA 1NT2B 2DYSB 2WAMA 3JATA 3CRQA 3ZIAG 3JASB 2WLLA 1VQKV 1SZTA 2BSKA 4W4LA 1S72V 4JI2B 1NJIW 1NKDA 3LNNA 5LP6A 4PJ0Z 2HHHO 4LNUB 4Z1VA 2IM9A 3OGCC 4U3JA 2PF4E 1XQ8A 3ABKB 3UT5B 2LFRA 4X62O 1S76D 1FXKB 4B08A 5IY5B 5JJNB 4WFAV 2C2AA 4MVOA 1OHHG 1ZWIC 2Q9LA 1TUEB 5IYBO 2BTOA 5K1PA 4DR1B 4UXNA 3HKBB 3TJTA 2ADQB 1XI1A 2EZOA 2D2CB 5K1XA 2CDYA 3ABUA 4JYYA 4UVCA 4JI5B 3T1HB 1L0LH 2XASA 4AILC 2XUMA 1VF7A 2YS8A 4O4LB 1OCRC 1E79G 3QVNA 3L71H 5LP6B 2IU0A 1NS1A 3OUSA 2HHHB 4KFMA 3S3XA 2JS3A 1KD1W 2F66C 2ZDIC 1SA0B 1KB9F 2GTSA 3ZRSA 4JI7O 4DK1A 4O2BB 5B1BC 2HVJC 2NNUA 1QU7A 2ZE5A 1YIJV 3TXQA 4H37A 4NTXA 4GKJB 3CB2A 1KKCA 3APQA 4YJ2B 2ZR2A 3FB7C 3OMAB 3SPJA 1FYJA 1QQCA 2EJ7A 1L8DA 3B77A 5KA5A 2NR5A 2FKXA 5H6RA 4CC6A 1DTOA 1SC5B 4HNAB 4PA7A 1R3JC 2XAQA 3G6EV 4NR1A 3FB5C 4I4TB 1WB8A 5FLXN 4LR3A 1XMOO 2ZR3A 4CS3A 2P4VA 3EXAA 2ZQMA 2QGNA 1QLEC 3G67A 4CH3A 5IJ0B 1PD3A 3ZRWB 1JFFB 4JPRA 3K0DA 3HKDB 1KECA 3NR7A 2V1DA 5LMNB 1US6A 3IFXA 4IHJB 3ETEA 3JALA 4EEQA 2O57A 3VQVA 2WA3A 3LSUA 3K3WA 4O4LA 3CCLV 1XUQA 2UUBB 4QIWF 2PY5A 2JGDA 3K03A 5IY5C 2AZ0A 2DQ0A 5LA6A 5IWAB 1HR0O 1M4UA 1Q81W 3ABMC 4JTAB 3H1KH 3ZHSA 4H33A 1OCRB 4BAYA 3AK3A 1ROPA 1VARA 4DRXA 1HNZO 2UXCO 1G1XB 1IBKO 4LF6O 5LYJA 1MZFA 1WA8A 4P9OA 3JD1A 4I0XA 5H5NA 4XDJA 5L3EA 3OGIB 3ZHRA 4UVAA 5KMGA 1Q90D 1JPXA 1GN2A 1I08A 1GRJA 4DV7B 5EC1C 5ITZA 2Q7EA 2EINC 3OEEG 2P6JA 3WG7B 4YXWG 4MVSA 2ARHA 4NKGB 1O9GA 2QJ1A 1RM1B 4B3MB 1AP5A 2YC0A 5LBQA 2IJKA 2EZPA 2W6JG
chains in the Genus database with same CATH topology
4OX9O 2F4VO 4GKJO 4B3SO 3OTOO 4OPAA 5IT9N 4X62O 2DOSA 1XEQA 2UUCO 3JAMN 1DK1A 3SDLA 1XMQO 1HNXO 1IBMO 4JI0O 1XNRO 1AB3A 4LFBO 4JV5O 4JI4O 4YY3O 1X59A 4JI3O 1I94O 4LF4O 3T1HO 4JI5O 5BXZA 1YZBA 4AQYO 5LMUO 2UU9O 1N33O 3RT3C 4LFCO 4A5UB 2UUAO 5LMNO 4DV2O 1N34O 2JRIA 4GKKO 2DJVA 4JI2O 1F7YA 4X65O 2Z0AA 2UXBO 4DR7O 3M8AA 1R1BA 5LL6Y 1HR0O 5A2QN 1R6TA 4DR4O 5BY1A 2UUBO 4DR6O 1D2DA 5BR8O 1FKAO 4LFAO 4LF9O 4JI8O 4NXNO 4JYAO 2ZKOA 4LF8O 4DR1O 1NS1A 4DV7O 1HNWO 1HNZO 2UXCO 1G1XB 1IBKO 4KHPO 4LF6O 2UXDO 4YHHO 4DV6O 4JI7O 4OPHA 4JI6O 4JI1O 2N74A 4B3RO 4B3MO 2AGAA 1N32O 1IBLO 4DUZO 2VQEO 1A32A 5H5NA 4NXMO 2LW7A 4LF7O 4DR5O 1AILA 3O65A 4DV1O 1KUQA 4K0KO 4DV5O 1FYJA 4DR2O 4DR3O 2VQFO 1FJGO 4DV0O 2ZM6O 3J81N 1N36O 2E5LO 2FKXA 4DV4O 3R66A 1J5EO 2HHHO 3J7AU 3T1YO 4X66O 5IWAO 4DV3O 5FLXN 1XNQO 4X64O 4B3TO 1XMOO 4DUYO 3F5TA 4LF5O 3J80N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 O;  2F4V O;  4GKJ O;  4B3S O;  3OTO O;  4OPA A;  5IT9 N;  4X62 O;  2DOS A;  1XEQ A;  2UUC O;  3JAM N;  1DK1 A;  3SDL A;  1XMQ O;  1HNX O;  1IBM O;  4JI0 O;  1XNR O;  1AB3 A;  4LFB O;  4JV5 O;  4JI4 O;  4YY3 O;  1X59 A;  4JI3 O;  1I94 O;  4LF4 O;  3T1H O;  4JI5 O;  5BXZ A;  1YZB A;  4AQY O;  5LMU O;  2UU9 O;  1N33 O;  3RT3 C;  4LFC O;  4A5U B;  2UUA O;  5LMN O;  4DV2 O;  1N34 O;  2JRI A;  4GKK O;  2DJV A;  4JI2 O;  1F7Y A;  4X65 O;  2Z0A A;  2UXB O;  4DR7 O;  3M8A A;  1R1B A;  5LL6 Y;  1HR0 O;  5A2Q N;  1R6T A;  4DR4 O;  5BY1 A;  2UUB O;  4DR6 O;  1D2D A;  5BR8 O;  1FKA O;  4LFA O;  4LF9 O;  4JI8 O;  4NXN O;  4JYA O;  2ZKO A;  4LF8 O;  4DR1 O;  1NS1 A;  4DV7 O;  1HNW O;  1HNZ O;  2UXC O;  1G1X B;  1IBK O;  4KHP O;  4LF6 O;  2UXD O;  4YHH O;  4DV6 O;  4JI7 O;  4OPH A;  4JI6 O;  4JI1 O;  2N74 A;  4B3R O;  4B3M O;  2AGA A;  1N32 O;  1IBL O;  4DUZ O;  2VQE O;  1A32 A;  5H5N A;  4NXM O;  2LW7 A;  4LF7 O;  4DR5 O;  1AIL A;  3O65 A;  4DV1 O;  1KUQ A;  4K0K O;  4DV5 O;  1FYJ A;  4DR2 O;  4DR3 O;  2VQF O;  1FJG O;  4DV0 O;  2ZM6 O;  3J81 N;  1N36 O;  2E5L O;  2FKX A;  4DV4 O;  3R66 A;  1J5E O;  2HHH O;  3J7A U;  3T1Y O;  4X66 O;  5IWA O;  4DV3 O;  5FLX N;  1XNQ O;  4X64 O;  4B3T O;  1XMO O;  4DUY O;  3F5T A;  4LF5 O;  3J80 N; 
#chains in the Genus database with same CATH topology
 2F4V O;  4AI8 A;  3VQX A;  3CCJ V;  3D8C A;  4RQE A;  4RWU A;  1YEW A;  3E8B A;  1OCC C;  1I5Y A;  1GM8 A;  1QNM A;  1TVK A;  2DQ3 A;  5EC2 C;  1VQP V;  5KHJ A;  1N36 B;  2Q7H A;  1RPO A;  4JI3 O;  1V9P A;  4LWS B;  2HP8 A;  3H1J H;  4N23 A;  4TUY A;  3P3P A;  2X7R B;  3A0B Z;  3IAY A;  4U3F H;  1LNQ A;  4JI1 B;  1IVS A;  1H2M A;  2Q6A A;  1KU9 A;  2YEV B;  3B8N A;  3STL C;  4X65 O;  5EBM C;  2BTQ B;  2MK3 A;  5EYP B;  1JA8 A;  4DRX B;  1BHA A;  1N0J A;  5LHI A;  3WB0 A;  4NXN O;  1CEZ A;  3OAA G;  2HLD G;  4I0X B;  5IJ9 B;  1L1F A;  4JAS A;  4QPK A;  4JI1 O;  1WB7 A;  4I50 B;  2A9H A;  4DV0 B;  1V55 B;  3RGB A;  2LW7 A;  2R9I A;  2W0F C;  3CME V;  4PEL A;  1CP9 A;  3OMN B;  5ITZ B;  1S77 D;  3RBZ A;  4RUE A;  5KX5 B;  4DR2 O;  2EIM C;  2PI4 A;  2VQF O;  3SYC A;  3F7V C;  1N36 O;  3JAS A;  2YXL A;  3MHH C;  3CJH B;  4I9W A;  3IGA C;  3DSQ A;  1S5H C;  1Z5W A;  3R66 A;  3FYE B;  4YY3 B;  2PGG A;  1J5E O;  1LUV A;  1S0V A;  3HB3 B;  2ZNJ A;  5LOV A;  1FXH A;  5FPO A;  1YHQ V;  1BHB A;  4C7U A;  1IBL B;  4OX9 O;  4JI4 B;  2WPD G;  5H6Q A;  4BIU A;  1JR9 A;  3LDD A;  4BW5 A;  1URF A;  1Y4M A;  3P3N A;  1HNX O;  1OCZ C;  1VF6 C;  4JI0 O;  1IBM O;  4LBE C;  2GDS A;  3JAR B;  1X4T A;  2PUS A;  2JK5 C;  4JYC A;  1K4D C;  4O2A B;  2ZXW B;  3WG7 C;  4WCE V;  1K34 A;  2QKC A;  4FLW A;  2YIB D;  2LP7 A;  3HKC B;  1VF5 B;  2LW1 A;  3FB6 C;  3OT7 A;  5CA1 B;  1P4R A;  4EFE A;  3B40 A;  3D3Q A;  5C93 A;  2Q69 A;  1N34 O;  1TAE A;  4FVM A;  5LGU A;  1FXK C;  3SPI A;  2JJ1 G;  3KZI Z;  4K8X A;  3BFR A;  2LQT A;  3SJA C;  2Q0A A;  3E8G A;  3ZHQ A;  2XAH A;  1AR4 A;  3LSS A;  5J2U A;  1JJ2 U;  1AR1 B;  3CSX A;  3K5N A;  3KCY A;  1P7G A;  2B1I A;  3A0R A;  4FIP C;  4CBC A;  4PDM A;  3ZHV A;  1K8A W;  4I9Q A;  4YJ2 A;  2H3O A;  1OCC B;  2Q7G A;  3O65 A;  2WLI A;  1AJP A;  2DMX A;  4K0K O;  3ZBH A;  2X6A A;  4D7S A;  3QO8 A;  3CYO A;  4ZI7 A;  2EIJ B;  2UUC B;  1M57 C;  1AI5 A;  1XRE A;  2Y48 A;  4GCZ A;  1K9M W;  4X89 A;  2X6B A;  4HNA A;  1WJZ A;  1HNW B;  2VS0 A;  4FLX A;  1XNQ O;  3KKY A;  3ZRV A;  1M57 B;  2OWO A;  4B7E A;  4JGS A;  3CE2 A;  3QNE A;  4F6R A;  1Q6I A;  2Q67 A;  4G2K A;  4FZ0 A;  3SR2 C;  5KUM A;  4FM0 A;  2ZE8 A;  1VQ8 V;  1SES A;  1B6Q A;  4LCU C;  2N04 A;  2Y4T A;  4B7K A;  4A5U B;  4YHH B;  4DV3 B;  4UV8 A;  3CS5 A;  2Q73 A;  4B3T B;  3Q4H A;  1YJN V;  4UV9 A;  2QWP B;  1AJN A;  3JD4 A;  3G6B A;  3CHX A;  3RVZ A;  3EVK A;  1K5S A;  5B66 Z;  3I55 V;  3DXR A;  3RYF B;  1BL8 A;  4ZOL B;  3M8A A;  3TXS A;  4DR3 B;  5J2T B;  3TET A;  3AG2 B;  1B06 A;  1D5A A;  1IUR A;  4P2Z A;  1Q8I A;  1QVG U;  4DR6 B;  4JAA A;  4AHC A;  5EBW C;  3CRM A;  2DW4 A;  4KHP O;  2IU3 A;  1WA8 B;  4YHH O;  1LUW A;  3GWO A;  4DXW A;  2YIB A;  2FML A;  3JSL A;  5BZB A;  1PKX A;  4IYH A;  3SGI A;  5JQG B;  4ZKI A;  2IH3 C;  1GTO A;  3C90 A;  4YIO A;  1PPJ H;  2P67 A;  2W0X A;  1ZSP A;  3W7S A;  4DR3 O;  2Q5Z A;  4QPJ A;  3BCC H;  4LFA B;  4J42 A;  3E22 A;  3IC9 A;  3G71 V;  5KHH A;  2IJH A;  3J7A U;  2HG5 C;  1XL4 A;  4X1I B;  4CH6 A;  4WFG A;  5B3S B;  4UCV A;  1SET A;  4IT5 A;  4X64 O;  4AQY B;  4ZIB A;  2ZIN A;  3VOU A;  2ODM A;  2AZ2 A;  3PN1 A;  3A0H Z;  1NR7 A;  2JIZ G;  1YF2 A;  3LDC A;  4B3S O;  1SQF A;  3ZHT A;  4W4K A;  1YTF D;  2ZM6 B;  3BAA A;  4CS4 A;  1TVK B;  1OCO C;  1P84 F;  3ZCC A;  2RN9 A;  4X20 B;  1K7D A;  2IJJ A;  1AB3 A;  1IZ3 A;  4I55 A;  1X59 A;  2ATK C;  2CK3 G;  3OEH G;  4LWS A;  1N4C A;  5FPR A;  1COW G;  2UXC B;  1NR1 A;  3K04 A;  1XMO B;  2AHY A;  2VQF B;  2IW5 A;  1BGY H;  3P30 A;  1QR9 A;  4UFZ A;  3CCS V;  2QKA A;  2GUZ A;  1TUB A;  3CMA V;  3BAB A;  1WP7 A;  2UXX A;  5JQG A;  2DN9 A;  5B1A C;  3R65 A;  2BTQ A;  1GN4 A;  1PV0 A;  4CZZ A;  2B1G A;  3H01 A;  3ML0 A;  2KG7 B;  4IHJ A;  1JMK C;  5BR8 O;  2UXB B;  3E83 A;  4LFA O;  1YXB A;  4JYA O;  1J95 A;  4PD4 F;  4ZHQ B;  2Q8V A;  5F2V O;  4JAU A;  3ZRW A;  2HJD A;  2KSD A;  4TWK A;  5CA0 B;  1BQ0 A;  3F7Y C;  2MW2 B;  4J9Z B;  4PA9 A;  2L35 A;  2P90 A;  4L8J A;  4B3M O;  2LFS A;  2QSA A;  3E86 A;  3SPC A;  1V55 C;  3WFV A;  1BT8 A;  2WA4 A;  5FNV A;  4H0L B;  2VQE O;  2OCC B;  4UCS A;  1Q5O A;  5DED A;  1HWY A;  4PI2 A;  4UCO A;  4GYC B;  4LF9 B;  4DV5 O;  1Y76 B;  3UO3 A;  5KHG A;  4QGP A;  2WLM A;  4WFE A;  1R3K C;  1GN6 A;  3JAW B;  1NQT A;  3H1L H;  1MMM A;  4O4I A;  5C8Y B;  3ABT A;  3CXC U;  2VQE B;  1VMG A;  2QDO A;  2QM7 A;  5KHI A;  1U97 A;  2ITD C;  1THZ A;  1PNK A;  3A2F A;  4EFB A;  2XAJ A;  2XAF A;  1Q43 A;  1O9H A;  4JI4 O;  1CXZ B;  2AXT Z;  3CCQ V;  3S3W A;  1E1R G;  2QTS A;  5IYZ A;  1KQS U;  3CC4 V;  1WPB A;  4N21 A;  1XIL A;  1W59 A;  3THO A;  2P22 C;  1L0N H;  1OCZ B;  5FNV B;  1QHT A;  1QVF U;  2ZDI A;  1RPR A;  4PV1 B;  3D36 C;  1XNR B;  5CA0 A;  1SQP H;  3D3I A;  4FMT A;  4CH5 A;  4FFB B;  2ZD9 A;  4MT8 A;  1BSM A;  1QR8 A;  1W2B U;  3T4Z A;  1NH2 D;  1K4C C;  4K3A A;  2Y0I A;  4GX2 A;  3D36 A;  4NYK A;  3L70 H;  1B04 A;  2QWO B;  4FLY A;  4OPH A;  1NTZ H;  3CXH F;  4B3R O;  1M5I A;  3E89 A;  2KQX A;  1P49 A;  1ENV A;  1R6N A;  3JD2 A;  2Y0P A;  2HEP A;  1ZTE A;  2F95 B;  4IIJ B;  3SYQ A;  2WLH A;  3CCM V;  3CRR A;  3TCU A;  4DR7 B;  4IYI A;  2PYJ A;  1G4Y B;  1OJH A;  4ZBM A;  1HNZ B;  3RYI A;  2FB5 A;  3L72 H;  2LJ2 A;  1BQZ A;  4QE9 A;  3KCX A;  2CAZ C;  2DE0 X;  5D5Q A;  3ZRX A;  2UXD B;  1Z2G A;  2HFE C;  5L3B A;  3OTF A;  2CTP A;  2LGQ A;  4O4J B;  3JAL B;  3OFN G;  1CPY A;  3J80 N;  1HP8 A;  4OXS A;  1FPO A;  2M7W A;  4I7Z B;  2F43 G;  4TSF G;  1H2G A;  3IC7 A;  4B3S B;  3CCE V;  4L87 A;  3N2G B;  4NXM B;  3KG2 A;  4J41 A;  1N33 B;  5IYC O;  2YIA A;  3SYP A;  5LOV B;  1N33 O;  4WBN B;  3H1H H;  5LMN O;  4FM2 A;  3B09 A;  4GKK O;  3CP1 A;  1Y6X A;  4HZ3 A;  1QLE B;  2EJR A;  4JTC B;  1W0J G;  1SQB H;  3ZED A;  1F4M A;  2ZE6 A;  1DGS A;  2UUB O;  3GWK C;  2WLN A;  1VIB A;  2JVD A;  2IJI A;  3RYH A;  4WFF A;  3DC6 A;  2PYL A;  1HNW O;  4BIZ A;  3ZMZ A;  2XHB A;  4JAV A;  3L74 H;  2AHZ A;  1WAZ A;  2N74 A;  4DUY B;  1UPG A;  1IBL O;  1TA8 A;  5LXT A;  3HKD A;  1SQV H;  1AIL A;  1VP7 A;  2YXY A;  1KP2 A;  4FJC C;  4MS2 A;  4UB6 Z;  2F93 B;  4U7O A;  4DR5 B;  4P9P A;  1R6K A;  3ETQ A;  4DR4 B;  2XT9 A;  5HFM A;  4CC5 A;  4O4J A;  2PTM A;  2JJ2 G;  4FLU A;  4UCT A;  3UCS C;  4DV4 O;  3OD4 A;  2X6C A;  1S5J A;  4I5S A;  1XNQ B;  1ZLZ A;  3CX5 F;  1JX9 A;  3E8H A;  3JD0 A;  4DV3 O;  2BSK B;  1H2K A;  3CC7 V;  2WLJ A;  2B9Z A;  3OE7 G;  4DUY O;  1EN4 A;  3SPG A;  2IBZ H;  4WF9 V;  3RYC B;  3QO5 A;  1XBL A;  4FPP A;  5J2U B;  3FKS G;  4X9Q A;  1BMF G;  3SDL A;  2Z5U A;  2EIK C;  3T2M A;  2BCC H;  3ZHU A;  3K59 A;  5CBF A;  4K8Z A;  4JV5 O;  4B3R B;  3UT5 A;  4YY3 O;  1IDS A;  5KAI Z;  4PI0 A;  2EX3 A;  4MTF A;  3AG3 B;  1OV9 A;  2QM4 A;  5BXZ A;  4X1K B;  2ZXW C;  3RW0 A;  5DN6 G;  4F4L A;  1I5X A;  2A79 B;  4J80 A;  5TIS Z;  2IH1 C;  2CUG A;  2RNB A;  5IE9 A;  5B1O A;  3MAQ A;  1T5E A;  2K9P A;  5BMV A;  3QO7 A;  4LF7 B;  4E4E A;  4HYO A;  1EFR G;  5A9G A;  4DR6 O;  3GVM A;  2QM8 A;  5CBG A;  2VRZ A;  5KX5 A;  5LXT B;  4G27 B;  2NN4 A;  3SJQ C;  4FK5 C;  2HJF C;  3ASO C;  2ZIO A;  3K0G A;  2ZT9 B;  3L9D A;  4JI6 O;  3RYC A;  5LGN A;  3RN4 A;  2YSU B;  4J9Y B;  1AI7 A;  3VBB A;  4H13 B;  1ZAU A;  4LH6 A;  2RQ6 A;  1P7B A;  3K9A A;  3AG1 C;  5KHK A;  2VWK A;  4DV0 O;  4JF3 A;  2W6I G;  4GKK B;  3CPW U;  3NXS A;  3ETG A;  4ICG A;  3N27 A;  3T1Y O;  1PP9 H;  4X66 O;  2GTA A;  1NZ6 A;  2E74 B;  4X66 B;  4B3T O;  4NTW A;  2QWR B;  1AP6 A;  2XOK G;  1FFT B;  4DO2 A;  1NI8 A;  3ZMS A;  4UB8 Z;  1UFI A;  2CTR A;  4X1Y A;  1R73 A;  4NVP A;  3UO2 A;  4DV6 B;  4MSW C;  4JYA B;  1FD9 A;  2WSS G;  4LF4 O;  2EIL C;  4J7J A;  2YI8 A;  4KXR A;  2EUL A;  2HR3 A;  3STZ C;  1V54 B;  5J9P C;  5LMU O;  2BOC C;  2E76 B;  2JGD B;  3H9V A;  4J7Z A;  5JH7 B;  4G28 B;  4LNU A;  2XND G;  2Q4P A;  1VQN V;  5CMU A;  2OIG A;  1VQ5 V;  2GSM B;  1XHX A;  1AI4 A;  4FLV A;  5BR8 B;  2UXB O;  5LL6 Y;  3ABL B;  1XMQ B;  5JVD B;  4TV9 A;  3U11 A;  1FJG B;  1Q3E A;  1EN5 A;  1SQQ H;  1WPX A;  2JDI G;  1VQ6 V;  2Q68 A;  2CE4 A;  1NH2 B;  1HW7 A;  2HVK C;  4LFC B;  3JCU Z;  3JYC A;  1GMG A;  1JVM A;  2OCH A;  3CC2 V;  3ZN0 A;  3K06 A;  4DUZ O;  3DGE A;  4NXM O;  2E5L B;  4X1Y B;  3L75 H;  2LGW A;  1JOY A;  1PM9 A;  3EFF K;  3TGU H;  4O2A A;  2EIJ C;  1PNL A;  2YDE A;  4J10 A;  1SKV A;  1HNX B;  3JAK A;  1RSO B;  4DR2 B;  2P4K A;  3C3S A;  1N8R W;  2ILM A;  1VQO V;  1HDJ A;  3ASN B;  4X62 B;  2YID A;  5KLV H;  2UUA B;  2EIM B;  1H2N A;  1Z5V A;  1PL4 A;  4QJF B;  2OIE A;  3CWB H;  3SPH A;  4HAM A;  3WU2 Z;  3OTO O;  3MDS A;  4RO2 A;  2DOS A;  3QG5 A;  4MW3 A;  3M99 B;  5H2F Z;  3SJB C;  1XMQ O;  3BHP A;  3LSQ A;  3AG4 C;  1M56 B;  4UUJ C;  4QE7 A;  4K35 A;  1I7F A;  4O4H A;  3M7M X;  4U3J B;  3OW2 U;  2ZE7 A;  1YZB A;  1SQG A;  4X64 B;  4AQY O;  1Y76 A;  4DV1 B;  4O4I B;  3BA9 A;  1VQ9 V;  4LFC O;  1Y74 B;  2UUA O;  2CH7 A;  2X0L A;  5L3F A;  1Y67 A;  4TV9 B;  3JSN A;  3K79 A;  1EM1 A;  4ZI7 B;  1YJ9 V;  1WNS A;  2EBO A;  5IJ9 A;  1R6T A;  4PDL A;  3ZN1 A;  3VQW A;  1GN3 A;  1WP8 A;  2D3O W;  3LUT B;  2UXN A;  1YJW V;  1M1K W;  2UXD O;  4RAI A;  1Q7Y W;  2YI9 A;  1FXV A;  4R8C A;  4TQD A;  5HFL A;  3IJ4 A;  2H8P C;  2RMK B;  3AEI A;  4X1I A;  3MHS C;  1F4N A;  4J7K A;  1SRY A;  4U7N A;  5LMU B;  3PJS K;  2YIC A;  3FAV B;  1VQ7 V;  2QWN B;  5JJJ B;  4P30 A;  4FLT A;  3J81 N;  2B5U A;  3L73 H;  1SA0 A;  4O4H B;  1IXB A;  4DYL A;  4TQF A;  5DM6 V;  3AK2 A;  4X20 A;  2Y69 B;  1PNM A;  3Q4H B;  1S5L Z;  4YJ3 B;  4XDK A;  3RYF A;  4ZOL A;  1TUB B;  3BEH A;  1DK1 A;  3LDE A;  3ETD A;  2CGO A;  5JWP A;  3AG7 A;  4R50 A;  1SQX H;  2QE7 G;  3QF7 A;  5KUK A;  4RQF A;  3ZJZ A;  4UCR A;  1SER A;  1GO3 F;  2V4D A;  3K9S A;  3BY6 A;  2CTW A;  4ASU G;  5L3D A;  2ZIM A;  5D5P A;  4DV2 O;  1MOF A;  4BWA A;  2YUA A;  5AG2 A;  1F23 A;  2DJV A;  2EIK B;  2OTJ V;  5CA1 A;  4PA3 A;  4LP8 A;  4TV8 B;  4DR7 O;  4DR4 O;  5BY1 A;  3OMI B;  4LF5 B;  4R7C A;  1I94 B;  1IX9 A;  2OTL V;  1N34 B;  1FXK A;  4EB6 A;  1MZE A;  4GX0 A;  4DV6 O;  4TUY B;  2DYR C;  1RM1 C;  3OR7 C;  3FFQ A;  5LGT A;  4X65 B;  3QTC A;  2AGA A;  1N32 O;  3JAW A;  4PDR A;  1DLB A;  3E8F A;  4DR5 O;  2A3Q A;  3U10 A;  4NXN B;  1H8E G;  5C8Y A;  3HKE B;  1KKD A;  2R72 A;  5GTH Z;  4DUZ B;  3ZMT A;  4KL1 A;  5FL7 G;  4DV4 B;  5EIB C;  1V54 C;  3T4D A;  4R6Z A;  3CCU V;  4LF8 B;  2EIL B;  4F6E A;  2AW9 A;  4FLZ A;  1ZX3 A;  3AG1 B;  1MA1 A;  3RVY A;  4X8A A;  2KB1 A;  5GON A;  4GKJ O;  4OGQ B;  5IDJ A;  1MNG A;  4TV8 A;  1Q6U A;  3T1C A;  5L3C A;  2R9A A;  3RFR A;  1GH6 A;  4ZHQ A;  3ASO B;  1K92 A;  4FZ1 A;  3P32 A;  1ARO P;  4MVQ A;  3ZMV A;  1M56 C;  4Q20 A;  3LNM B;  1Q6H A;  1JJO A;  3W7T A;  3CRA A;  2R70 A;  2JS5 A;  2A0L A;  5CB4 B;  1XL6 A;  1AVM A;  1FFX A;  4LF4 B;  2JRI A;  3K5M A;  3W7U A;  2Q0O C;  4JI7 B;  4XBF A;  1OCO B;  4IL6 Z;  5J2T A;  4O2B A;  2Y4U A;  4GT1 A;  3K08 A;  5KA6 A;  4DW1 A;  3HKE A;  1YDX A;  5B1B B;  1MG1 A;  3CCV V;  1DF4 A;  1YIT V;  2F1M A;  3A8T A;  3ICX A;  2FTK A;  4MVR A;  5LHH A;  5EZY B;  4LF8 O;  1ZL8 A;  4DR1 O;  1NVP D;  5KAF Z;  1KBH A;  1U96 A;  5IJ0 A;  1Y66 A;  3T1Y B;  5H9C A;  1QLN A;  5B1A B;  1EBO A;  4FFK A;  5CN0 A;  1H2L A;  4PDV A;  3C3T A;  4DV1 O;  3E22 B;  1KUQ A;  4X1K A;  3K5O A;  2H94 A;  3GB7 C;  1SZX A;  2QEX V;  3JCZ A;  1EZJ A;  1BE3 H;  4JV5 B;  2ZM6 O;  1RFY A;  3UKM A;  1QCE A;  3I5D A;  2E5L O;  3CD6 V;  1K5Q A;  4LH7 A;  4UCU A;  3B2E E;  5LHG A;  2HKO A;  3HPL C;  2Y69 C;  3AK1 A;  5CB4 A;  2BE3 A;  4KP4 A;  3SJC C;  5E79 Z;  2P7T C;  2CGN A;  3UM7 A;  4LF5 O;  4ABM A;  2QA4 V;  1IBM B;  5B3S C;  3SYA A;  4BW9 A;  1M93 A;  4OPA A;  4I55 B;  4TOI A;  5EBL C;  5LP6 C;  2UUC O;  1K3E A;  3FB8 C;  4PA6 A;  2PZS A;  3ASN C;  1FFX B;  1NVP B;  5LA6 B;  1FS0 G;  1KC8 W;  1WLE A;  4D7T A;  3HKB A;  1YI2 V;  2UU9 O;  5GW7 A;  3DTU B;  3RT3 C;  5KMG B;  4MVU A;  3UQ8 A;  5B5E Z;  3FYI B;  3RYH B;  1G6U A;  3CRC A;  4LF6 B;  1VF6 A;  1GAX A;  2WWW A;  3N2K A;  2CTQ A;  3B8M A;  1AJQ A;  4DV2 B;  3HR0 A;  1XOU A;  1GM9 A;  1R1B A;  4FM1 A;  2QKS A;  4WFH A;  4EKW A;  3X2Q B;  4LF9 O;  1KP3 A;  1H2S B;  1EZV H;  4F6R B;  2FL4 A;  1JCH A;  5JJE B;  5JH7 A;  4DV7 O;  1FAF A;  4NTY A;  3K58 A;  2GBO A;  1IBK B;  1M9N A;  3ABL C;  1B3Q A;  4YIP A;  2GV9 A;  4GX5 A;  2RCV A;  2PI5 A;  4LF7 O;  4JYB A;  4X88 A;  2M6Y A;  1SS3 A;  2EIN B;  3VQY A;  2KKW A;  2DYS C;  1FJG O;  1N32 B;  1K33 A;  4MVZ A;  4CS2 A;  1VQL V;  1MSW D;  2RDC A;  2YEV A;  1OZ0 A;  4XDL A;  2JEX A;  4JI6 B;  4JZG A;  1S3J A;  4Z2W A;  2OYQ A;  4RUF A;  2QTO A;  1JQ0 A;  4I4T A;  1LR1 A;  1GM7 A;  4DW0 A;  2DWE C;  2E75 B;  3SYO A;  5JVD A;  4H44 B;  1D5N A;  1SF9 A;  3CCR V;  2P5O A;  5EK0 A;  3OTO B;  2P06 A;  1GK9 A;  4DV5 B;  5JCO C;  5IT9 N;  3G4S V;  1XEQ A;  3H1I H;  3JAM N;  1JFF A;  2QR4 A;  4MVM A;  1I0H A;  2DWD C;  2F23 A;  1R3I C;  3E2E A;  1XNR O;  4UVB A;  1KMI Z;  1KYO F;  4LFB O;  3ABM B;  2ETN A;  3EHB B;  5BMV B;  4I50 A;  1ORQ C;  3FD9 A;  4WFB V;  1PL0 A;  3ZS8 C;  3T1H O;  4JI5 O;  1H38 A;  3N2K B;  1AI6 A;  3AG2 C;  3OM3 B;  3OUF A;  1J5E B;  3FX7 A;  3BA8 A;  1BCC H;  5E1A C;  1TGO A;  5L3G A;  4CH4 A;  4DK0 A;  4FFB A;  4PHZ A;  3JAK B;  1EN6 A;  3MD0 A;  1RSO A;  3ZMU A;  4JI2 O;  4NB5 A;  2F4V B;  1QBZ A;  3CJH A;  2XTA A;  1F7Y A;  4MTX A;  5GTI Z;  2Z0A A;  1H8H G;  5B1N A;  2NLJ C;  3WB2 A;  1Q86 W;  1UJW B;  1R3L C;  1GKF A;  5A2Q N;  1DF5 A;  5EIB D;  4KHP B;  3WB1 A;  2N05 A;  4JI8 O;  2JGU A;  4BR6 A;  3X2Q C;  3W7W A;  1W0K G;  4JI3 B;  3DC5 A;  2OT5 A;  2G38 A;  1Y74 A;  3BRC A;  1G8M A;  2CH7 B;  1BZK A;  4EB6 B;  1M90 W;  4Q6G A;  5LYJ B;  2A06 H;  4JZ2 A;  3DXR B;  2GHY A;  1Q82 W;  3JAR A;  2FYU H;  1A32 A;  2E3C A;  5CBH A;  2LO1 A;  2R9R B;  1NTK H;  1AR5 A;  4JTD B;  4JI8 B;  2KG7 A;  3G80 A;  2YXH A;  4IIJ A;  4JI0 B;  3TK1 A;  1BS3 A;  1YCI A;  1YVW A;  1K73 W;  1XHZ A;  5JCO A;  3ZX6 A;  3JD3 A;  2BOB C;  5IWA O;  1HR0 B;  2XAG A;  3RYI B;  2ZNI A;  3HKC A;  3I56 V;  4MTO A;  3F5T A;  1YTF B;  1XDC A;  2QWQ B;  5GON B;  3APO A;  3ABK C;  2OCC C;  2WLK A;  4GUN A;  1NBM G;  4E2L A;  4GX1 A;  4GLX A;  4IGG A;  4MW8 A;  3N2G A;  2DYR B;  1NTM H;  3K5L A;  2VWJ A;  1NU1 H;  1WN7 A;  2JEU A;  2K1E A;  3BPZ A;  2ITC C;  2ADP A;  4HBN A;  3F5W C;  3JAT B;  1I94 O;  1VQM V;  1K97 A;  3CEI A;  4LC1 A;  2WLL B;  4D6T H;  1MAB G;  1VEW A;  2WLI B;  3FAV A;  4YJ3 A;  4TT3 G;  4KUM A;  5DEC A;  2ZCE A;  3BVO A;  5CA3 A;  3AG4 B;  1ZUQ A;  4J11 A;  3O9O A;  4OX9 B;  4WBN A;  4QNH B;  3AG3 C;  3K57 A;  5EYP A;  1D2D A;  1N0N A;  1FKA O;  4K0K B;  1MSD A;  2Z3Y A;  4MTG A;  5EZY A;  1IXM A;  2ZKO A;  1ZL8 B;  3W7X A;  3OR6 C;  3U0Z A;  2A7W A;  2GUZ B;  3E35 A;  2L6L A;  1YSC A;  1F51 A;  3RWR D;  1E1Q G;  1VQ4 V;  4GZR B;  5IYZ B;  4LFB B;  3B4S A;  2V7Q G;  4Z1M G;  1RP3 B;  5IYD O;  2UU9 B;  4BIO A;  4PA4 A;  2RJZ A;  1NT2 B;  2DYS B;  2WAM A;  3JAT A;  3CRQ A;  3ZIA G;  3JAS B;  2WLL A;  1VQK V;  1SZT A;  2BSK A;  4W4L A;  1S72 V;  4JI2 B;  1NJI W;  1NKD A;  3LNN A;  5LP6 A;  4PJ0 Z;  2HHH O;  4LNU B;  4Z1V A;  2IM9 A;  3OGC C;  4U3J A;  2PF4 E;  1XQ8 A;  3ABK B;  3UT5 B;  2LFR A;  4X62 O;  1S76 D;  1FXK B;  4B08 A;  5IY5 B;  5JJN B;  4WFA V;  2C2A A;  4MVO A;  1OHH G;  1ZWI C;  2Q9L A;  1TUE B;  5IYB O;  2BTO A;  5K1P A;  4DR1 B;  4UXN A;  3HKB B;  3TJT A;  2ADQ B;  1XI1 A;  2EZO A;  2D2C B;  5K1X A;  2CDY A;  3ABU A;  4JYY A;  4UVC A;  4JI5 B;  3T1H B;  1L0L H;  2XAS A;  4AIL C;  2XUM A;  1VF7 A;  2YS8 A;  4O4L B;  1OCR C;  1E79 G;  3QVN A;  3L71 H;  5LP6 B;  2IU0 A;  1NS1 A;  3OUS A;  2HHH B;  4KFM A;  3S3X A;  2JS3 A;  1KD1 W;  2F66 C;  2ZDI C;  1SA0 B;  1KB9 F;  2GTS A;  3ZRS A;  4JI7 O;  4DK1 A;  4O2B B;  5B1B C;  2HVJ C;  2NNU A;  1QU7 A;  2ZE5 A;  1YIJ V;  3TXQ A;  4H37 A;  4NTX A;  4GKJ B;  3CB2 A;  1KKC A;  3APQ A;  4YJ2 B;  2ZR2 A;  3FB7 C;  3OMA B;  3SPJ A;  1FYJ A;  1QQC A;  2EJ7 A;  1L8D A;  3B77 A;  5KA5 A;  2NR5 A;  2FKX A;  5H6R A;  4CC6 A;  1DTO A;  1SC5 B;  4HNA B;  4PA7 A;  1R3J C;  2XAQ A;  3G6E V;  4NR1 A;  3FB5 C;  4I4T B;  1WB8 A;  5FLX N;  4LR3 A;  1XMO O;  2ZR3 A;  4CS3 A;  2P4V A;  3EXA A;  2ZQM A;  2QGN A;  1QLE C;  3G67 A;  4CH3 A;  5IJ0 B;  1PD3 A;  3ZRW B;  1JFF B;  4JPR A;  3K0D A;  3HKD B;  1KEC A;  3NR7 A;  2V1D A;  5LMN B;  1US6 A;  3IFX A;  4IHJ B;  3ETE A;  3JAL A;  4EEQ A;  2O57 A;  3VQV A;  2WA3 A;  3LSU A;  3K3W A;  4O4L A;  3CCL V;  1XUQ A;  2UUB B;  4QIW F;  2PY5 A;  2JGD A;  3K03 A;  5IY5 C;  2AZ0 A;  2DQ0 A;  5LA6 A;  5IWA B;  1HR0 O;  1M4U A;  1Q81 W;  3ABM C;  4JTA B;  3H1K H;  3ZHS A;  4H33 A;  1OCR B;  4BAY A;  3AK3 A;  1ROP A;  1VAR A;  4DRX A;  1HNZ O;  2UXC O;  1G1X B;  1IBK O;  4LF6 O;  5LYJ A;  1MZF A;  1WA8 A;  4P9O A;  3JD1 A;  4I0X A;  5H5N A;  4XDJ A;  5L3E A;  3OGI B;  3ZHR A;  4UVA A;  5KMG A;  1Q90 D;  1JPX A;  1GN2 A;  1I08 A;  1GRJ A;  4DV7 B;  5EC1 C;  5ITZ A;  2Q7E A;  2EIN C;  3OEE G;  2P6J A;  3WG7 B;  4YXW G;  4MVS A;  2ARH A;  4NKG B;  1O9G A;  2QJ1 A;  1RM1 B;  4B3M B;  1AP5 A;  2YC0 A;  5LBQ A;  2IJK A;  2EZP A;  2W6J G; 
#chains in the Genus database with same CATH homology
 4OX9 O;  2F4V O;  4GKJ O;  4B3S O;  3OTO O;  4OPA A;  5IT9 N;  4X62 O;  2DOS A;  1XEQ A;  2UUC O;  3JAM N;  1DK1 A;  3SDL A;  1XMQ O;  1HNX O;  1IBM O;  4JI0 O;  1XNR O;  1AB3 A;  4LFB O;  4JV5 O;  4JI4 O;  4YY3 O;  1X59 A;  4JI3 O;  1I94 O;  4LF4 O;  3T1H O;  4JI5 O;  5BXZ A;  1YZB A;  4AQY O;  5LMU O;  2UU9 O;  1N33 O;  3RT3 C;  4LFC O;  4A5U B;  2UUA O;  5LMN O;  4DV2 O;  1N34 O;  2JRI A;  4GKK O;  2DJV A;  4JI2 O;  1F7Y A;  4X65 O;  2Z0A A;  2UXB O;  4DR7 O;  3M8A A;  1R1B A;  5LL6 Y;  1HR0 O;  5A2Q N;  1R6T A;  4DR4 O;  5BY1 A;  2UUB O;  4DR6 O;  1D2D A;  5BR8 O;  1FKA O;  4LFA O;  4LF9 O;  4JI8 O;  4NXN O;  4JYA O;  2ZKO A;  4LF8 O;  4DR1 O;  1NS1 A;  4DV7 O;  1HNW O;  1HNZ O;  2UXC O;  1G1X B;  1IBK O;  4KHP O;  4LF6 O;  2UXD O;  4YHH O;  4DV6 O;  4JI7 O;  4OPH A;  4JI6 O;  4JI1 O;  2N74 A;  4B3R O;  4B3M O;  2AGA A;  1N32 O;  1IBL O;  4DUZ O;  2VQE O;  1A32 A;  5H5N A;  4NXM O;  2LW7 A;  4LF7 O;  4DR5 O;  1AIL A;  3O65 A;  4DV1 O;  1KUQ A;  4K0K O;  4DV5 O;  1FYJ A;  4DR2 O;  4DR3 O;  2VQF O;  1FJG O;  4DV0 O;  2ZM6 O;  3J81 N;  1N36 O;  2E5L O;  2FKX A;  4DV4 O;  3R66 A;  1J5E O;  2HHH O;  3J7A U;  3T1Y O;  4X66 O;  5IWA O;  4DV3 O;  5FLX N;  1XNQ O;  4X64 O;  4B3T O;  1XMO O;  4DUY O;  3F5T A;  4LF5 O;  3J80 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...