2FKXA

Ribosomal protein s15 from thermus thermophilus, nmr recalculated structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Conformational Landscape of the Ribosomal Protein S15 and Its Influence on the Protein Interaction with 16S RNA.
pubmed doi rcsb
molecule keywords 30S ribosomal protein S15
source organism Thermus thermophilus
molecule tags Structural protein
total genus 26
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2fkxA00
2UXBO 5IWAO 2FKXA 4JI2O 1F7YA 4JI7O 4JI1O 3OTOO 1HR0O 1FYJA 2E5LO 1N36O 4LF6O 5IT9N 1XMQO 3O65A 2AGAA 1X59A 4YY3O 1DK1A 4DV3O 3T1YO 4DV5O 5H5NA 3J7AU 2Z0AA 2JRIA 4JI6O 2N74A 2DJVA 1AILA 3SDLA 4B3SO 4A5UB 4X64O 1IBKO 4GKKO 2LW7A 4JYAO 4X65O 1YZBA 4JI0O 4DV2O 4DR1O 2UUBO 2UXDO 4DV0O 1N34O 4DR4O 4B3TO 1FJGO 3JAMN 4GKJO 3R66A 4JV5O 3M8AA 2HHHO 1KUQA 4X66O 2DOSA 4B3MO 1XEQA 1XMOO 4OPHA 2VQFO 5BR8O 1AB3A 4K0KO 4LFCO 2F4VO 1N33O 4DR3O 1XNRO 3F5TA 4LF5O 4KHPO 4LFBO 3T1HO 5A2QN 1NS1A 4DUYO 1IBMO 1G1XB 1HNWO 5LL6Y 1FKAO 4LF8O 4OX9O 4NXNO 4JI4O 1I94O 4JI3O 4DV1O 5LMUO 1HNZO 4LF4O 4DV6O 1N32O 4DUZO 3J81N 3RT3C 4YHHO 5BY1A 2UXCO 2ZM6O 4AQYO 4DR5O 1HNXO 1R6TA 1A32A 4X62O 4JI5O 4LF7O 4LFAO 2UUAO 1XNQO 1D2DA 5FLXN 3J80N 4DV7O 1IBLO 4DR7O 5BXZA 5LMNO 2UUCO 4NXMO 4B3RO 4DR6O 2VQEO 4OPAA 4JI8O 4LF9O 2ZKOA 1R1BA 2UU9O 1J5EO 4DR2O 4DV4O
chains in the Genus database with same CATH superfamily
4PHZA 2XHBA 4Z2WA 4UCUA 4JI2O 1F7YA 2IH3C 4JI7O 2YI8A 1M56C 3ABKC 4O4IA 4YJ3A 3OTOO 3CJHA 3B09A 1N0JA 4Q6GA 3JD2A 4DR5B 1HNXB 4TQDA 4FM0A 3E8BA 2IBZH 2QR4A 1PPJH 3H01A 2HG5C 5CA0A 3P32A 1BGYH 3K79A 1SZXA 5JH7B 4B7KA 4EFBA 3SYQA 4JI0O 4O2BA 4DR1O 4X8AA 1H2MA 2ZDIA 2ETNA 1GN2A 2YICA 1N34O 1CP9A 4JI2B 1VQ9V 2QWNB 4JI7B 2GTSA 2YS8A 1BQZA 3DXRA 1SQQH 4U7OA 1XMOO 3ABMB 4FM1A 1V55B 3HKEB 3OGCC 3A0HZ 2X6AA 1Z5VA 3CX5F 3RYCB 2WLLB 4DR3O 4DW1A 3F5TA 1E79G 4JI0B 1M93A 4DR1B 3OE7G 1SQVH 2B9ZA 4UCVA 3AG1C 1BQ0A 5JJJB 2BSKA 2EINB 1Y4MA 3CC2V 3RGBA 1K4CC 3SYAA 2RN9A 4DV5B 1OCCB 1NVPD 4YHHO 3OFNG 2A0LA 4FFBA 4AQYO 1BHBA 3ZHVA 3RFRA 3ZMTA 4EFEA 4NKGB 2P6JA 4PV1B 3VQWA 4CH5A 2X7RB 3BPZA 2WWWA 5GONB 4JAVA 3E86A 4JAUA 4NR1A 2FB5A 4JI8O 4U7NA 1OCRC 3JATB 1SESA 2BTQB 2JEXA 1YJWV 5J2TA 4DV4O 1KC8W 1GKFA 1S5LZ 2ZE8A 1ZL8A 4FK5C 3X2QB 4YHHB 4X1YA 1KQSU 1VMGA 3BY6A 1H2LA 1ZAUA 5FPRA 4F4LA 4UB6Z 3N2GA 5KAIZ 1VQNV 1VF7A 1IXBA 4I4TB 1W0JG 4JTDB 1GO3F 1U97A 2OCCC 3T4DA 2XAFA 4ZIBA 1HNZB 4WFGA 4YIOA 4JI8B 4TV9A 3BRCA 4MVQA 3MDSA 2YSUB 3JAMN 3ZN1A 4DV4B 2UXCB 4GKJO 1PM9A 2HHHO 1YJNV 1THZA 3H1LH 1WA8B 2YDEA 3RYFB 1R3LC 1AVMA 1WNSA 4MVMA 1H2SB 4N21A 1KYOF 2XUMA 3ZRSA 5KMGA 1W0KG 1KECA 3ZCCA 4FLYA 1PNLA 1AI5A 3Q4HB 4BR6A 3F5WC 4RWUA 2HKOA 3E83A 2XAGA 3ZHRA 3G71V 1ZTEA 1RPRA 3P30A 3W7SA 2HHHB 2UXNA 1E1RG 4DV6O 3CRMA 4IL6Z 3SR2C 1JVMA 2EIMC 5BY1A 1KMIZ 1JFFB 5L3BA 1SQPH 4X62O 3L74H 1NR1A 5C93A 4GUNA 4LFAO 2H8PC 1HW7A 2GBOA 2M7WA 1IXMA 3CHXA 3IC7A 1XNQO 1LUVA 1TVKA 2QGNA 2WA3A 3QO8A 1JPXA 1XBLA 3THOA 1OV9A 3ASNB 5LP6B 4PA7A 4JYCA 4DR6O 5B5EZ 4OPAA 4MTGA 5CA1A 3OT7A 1AI7A 5LGTA 5IYDO 3G6BA 1L0LH 2JJ2G 1TAEA 3ETDA 1EZJA 2A7WA 2IM9A 4UV8A 3SPJA 1W59A 1SRYA 1XMQO 3O65A 3A0BZ 3ZHQA 3D36C 1S0VA 1CXZB 3T1YO 1NT2B 3VQXA 4LFAB 1LR1A 1AR5A 1XNQB 4O2AB 2CTRA 1K97A 3ASOB 3SDLA 4A5UB 1PP9H 2AXTZ 4X65O 4JZGA 1Y74A 4IHJB 1OCOC 3JATA 2UXDO 1K3EA 4DV0O 2B1GA 5LA6B 1H2KA 4HBNA 3KCYA 2CUGA 2BTOA 3BHPA 2JS3A 3R66A 5BMVB 3FFQA 1XMQB 2QM8A 3WB0A 4CC5A 5LOVB 3UM7A 1IZ3A 2D2CB 1GAXA 2RMKB 4AHCA 2LFSA 4X65B 5B66Z 2FYUH 2UXDB 4DXWA 4DV0B 3MD0A 4TUYB 3K5MA 3JSLA 4TQFA 2EIJB 4P9OA 5KHJA 3F7YC 4BW5A 1I08A 5EK0A 1ENVA 3UO3A 4LBEC 4PDLA 4HYOA 4UCOA 1WN7A 4P9PA 4GZRB 2JIZG 5EBWC 3KZIZ 3L70H 4WFFA 1EN4A 2R9AA 3AG7A 4NTXA 2MK3A 2HR3A 4G28B 1K5SA 3Q4HA 1KKDA 3ABLC 3HKBB 2QDOA 2WSSG 5KX5B 4DW0A 2OWOA 2OIEA 5BXZA 2QKAA 4YXWG 4JZ2A 4O4LA 2A06H 3B40A 3WU2Z 1VQPV 1XL6A 2A3QA 3NR7A 1BS3A 1PL0A 1B3QA 1J95A 3D8CA 5IWAO 5J2UB 1JFFA 1SS3A 4KL1A 2Q0AA 2QWOB 5IY5B 4O4JA 1NTMH 2DYRC 4DV3O 4IIJA 2ODMA 4L8JA 2PUSA 2WPDG 3E22A 2Z0AA 3K9SA 1RSOB 1Q3EA 2GUZB 4JI6O 2DJVA 3JAWB 1MA1A 4JI4B 2LW7A 2IJJA 2Z5UA 4QE9A 2R70A 4HZ3A 3CCQV 3EHBB 1XOUA 5IWAB 4Z1MG 2BOCC 4FZ0A 4LH6A 2Y0PA 1K5QA 1E1QG 3LUTB 2UUCB 4JI6B 2ARHA 3H1HH 1ZUQA 1N33O 4IGGA 1FFXA 2EILC 4ZOLB 3RYIA 1FS0G 4NTYA 2EZPA 1FFTB 4XDJA 1QR8A 2F93B 3O9OA 4I0XB 4MTXA 4H44B 5LOVA 3BEHA 5FNVA 1S3JA 3AK3A 2ZT9B 2GV9A 2Q69A 1O9GA 4FFKA 3ZRWA 3S3XA 2CK3G 2EX3A 3CCUV 3AG2B 5ITZB 5IYZA 1N33B 1QLEB 4HNAA 1QVGU 2IU3A 2ZDIC 1VQ4V 4B3RO 3CRAA 2CTWA 3AG3C 1CPYA 1GN3A 2ZKOA 3K06A 2F1MA 3NXSA 1XL4A 3QTCA 4WFHA 1W2BU 2AHYA 2YIBA 3HKBA 3WB1A 3SJCC 1PNKA 1NU1H 3JAKB 1RM1C 3SPCA 3UT5B 3RVZA 2N74A 3K58A 2Q5ZA 2Y69C 3JALB 4NXNB 2LW1A 2RJZA 4B3RB 2UUBO 2HLDG 1PL4A 2AW9A 3CCLV 2OT5A 1VF5B 2DQ3A 2V1DA 3G67A 1SQBH 4D7TA 5EBMC 1ZWIC 1RSOA 2QWRB 3JCUZ 3EFFK 3CXCU 4X88A 3CEIA 2NLJC 1VQKV 2IJIA 3T1HO 3OGIB 4I55B 1Q86W 3SPGA 5LMUO 3CD6V 2DWEC 1WB8A 1RP3B 5H6RA 3C3TA 4ASUG 5B1AB 1WPBA 2ZIMA 5AG2A 1QBZA 1K9MW 3FB7C 2C2AA 3BCCH 3VOUA 3DGEA 2NN4A 2JVDA 5CB4B 4PA4A 3J80N 3T1HB 2DMXA 5LHGA 4WF9V 2WLNA 2CH7B 2ZR3A 2L6LA 3GVMA 1K8AW 1GMGA 1Y6XA 2DWDC 3BA9A 4U3JA 2KB1A 4J7ZA 1SA0A 3VBBA 5LMUB 2LO1A 1SQGA 4CS2A 3UO2A 2E5LO 1US6A 2AGAA 2CAZC 1G6UA 3F7VC 3CC4V 3J7AU 2P67A 1PD3A 5CMUA 1AILA 4B3SO 2F23A 4UCTA 1I7FA 3P3NA 2Q7EA 4JTCB 1R73A 2WLJA 3EXAA 5IDJA 2Y4UA 4FM2A 5EYPB 3IJ4A 4X9QA 1P7BA 1V55C 4XBFA 4YJ2A 3HB3B 3SGIA 4DR4O 5JVDA 2XAHA 2P4KA 4CH4A 4J41A 2HVKC 4PDRA 1NH2B 2E5LB 1Y76A 3MHHC 4RUEA 3UT5A 1L1FA 5L3GA 2EINC 2Z3YA 3QG5A 2F4VO 3OR6C 4H33A 1XNRO 2Q0OC 1WP7A 1NS1A 4RAIA 4DUYO 3BAAA 4DR4B 4LWSA 3H1JH 4OX9O 3OTOB 4U3FH 5IJ9B 3WG7B 4K3AA 1UJWB 3E8GA 2IH1C 3UQ8A 4LP8A 1Q6UA 3CCJV 5C8YA 1YTFB 2N04A 2XOKG 2CDYA 2QM4A 3H1IH 2LJ2A 3I5DA 3LDEA 3ZRXA 3CCRV 1MG1A 3ETQA 4MVZA 3R65A 4FZ1A 1XNRB 1GK9A 4I55A 1FXKA 1N34B 3JARB 4K8ZA 1SQFA 4CC6A 3X2QC 4UCRA 4ZHQB 2VQEO 1M56B 3ABKB 3N2KB 4OX9B 5HFLA 3OEHG 1F4MA 2JGUA 4GLXA 1XMOB 1R1BA 2F43G 3OTFA 4J7KA 5A9GA 3FKSG 5EIBC 5LYJB 4PELA 3K5NA 3PJSK 1BL8A 4NVPA 2AZ2A 4DR3B 1T5EA 5CA3A 4J80A 4DYLA 3W7TA 5EZYA 5L3FA 2V4DA 4KP4A 1EN5A 4FLVA 4ZI7A 3KKYA 1HP8A 4MTOA 1JX9A 2Q4PA 1B06A 4BWAA 1UFIA 4WBNB 4TSFG 2GDSA 2Y48A 3JD0A 4AQYB 1F4NA 3A0RA 4FVMA 4LNUA 5KLVH 4TV8A 4KXRA 3SYOA 1N4CA 3AEIA 1GRJA 1K4DC 4GCZA 4LR3A 1WLEA 3K9AA 4AILC 1OHHG 4JPRA 1K92A 4GX5A 4JF3A 3TXQA 2A9HA 1AP5A 2GHYA 1JCHA 5JH7A 5LHIA 3A8TA 3ZJZA 2ZM6O 2KKWA 5IJ0B 3ZEDA 3SJBC 1DGSA 4NB5A 2DN9A 4D7SA 2EULA 3LDCA 1OCRB 3FYIB 4DV7O 2V7QG 1VQOV 1I5YA 1XI1A 4GKJB 1SF9A 3ZBHA 2VWJA 1K34A 1Q6HA 3HKEA 4MW8A 1V54B 2QM7A 4I50B 2WLHA 4EEQA 2UU9O 3RYCA 3K59A 2WLLA 1QR9A 2ZM6B 1N36O 3BFRA 2OCCB 1ROPA 2XAJA 3APOA 4G27B 1YEWA 3RYHB 3STZC 4F6EA 2ZCEA 4X20B 4DV7B 3T2MA 4ZHQA 2VRZA 1D5NA 1MMMA 4X1KB 4N23A 2YXHA 3FAVB 5LHHA 4DV6B 2KG7B 3QF7A 3CSXA 2Q6AA 4L87A 5CBFA 2QJ1A 2DYSB 2ZXWB 2UU9B 5LYJA 1R6NA 1WAZA 5LGNA 4TT3G 3CC7V 2BOBC 5B1NA 4EKWA 4BAYA 4X66O 4X62B 1N36B 2E75B 2OYQA 1FAFA 1UPGA 4FJCC 1H8EG 5GONA 4QPKA 1AB3A 1YVWA 4BIUA 5JJNB 1AJNA 4DR6B 2BTQA 5DEDA 1XUQA 4OXSA 4Z1VA 2KSDA 2IW5A 1H2GA 2CGNA 3E2EA 2Q8VA 1FKAO 1L8DA 2EIMB 1MSDA 5KAFZ 2YEVB 3JD1A 1NVPB 1VIBA 1IURA 4H37A 4X66B 4R8CA 4I4TA 3T1YB 2UXXA 4MW3A 4CZZA 4FMTA 2NR5A 1QVFU 4QIWF 4JYYA 5DN6G 4PA9A 2ZIOA 2X6CA 3OUFA 1V9PA 3TCUA 3L72H 2ITDC 4H13B 1Q5OA 4NXMO 4CBCA 1G8MA 4UVAA 3E89A 1WA8A 3RYFA 1M90W 2XAQA 4MTFA 3K5LA 4P2ZA 2HP8A 2JDIG 4JI1O 1HR0O 3E35A 4YIPA 2PZSA 2GTAA 3L71H 4QGPA 3ZMUA 5FL7G 3ZN0A 1OCZC 5D5PA 1URFA 3QO7A 5CN0A 1KD1W 4KUMA 1HDJA 5IYCO 1IBKO 2QKCA 1IDSA 3DTUB 4NXMB 1I5XA 3IGAC 1PV0A 4J7JA 2H94A 3HPLC 1NI8A 2P22C 1KUQA 4JI1B 1HR0B 4X20A 2A79B 3SYPA 1K7DA 5LP6A 2CE4A 5H6QA 1S5JA 1S76D 2R9IA 1NQTA 1IBKB 4IYIA 4E2LA 3L75H 1G4YB 2PI5A 4LF5O 1O9HA 4DRXB 3FX7A 2HFEC 4WFBV 4CH3A 3ZMZA 2ZNIA 1WB7A 5KUMA 3CP1A 2HJFC 4MVUA 1H2NA 3E8HA 4F6RB 3ZHSA 4LF4O 4O2AA 4DV3B 4E4EA 1SZTA 3ABLB 3E8FA 1LNQA 2EJRA 4IHJA 3AK1A 5GW7A 3C3SA 2FMLA 3EVKA 5LA6A 4JI5O 5JWPA 4J10A 4LF5B 4DR7O 5BMVA 4K8XA 2YEVA 4PA3A 2JGDB 4R50A 3I55V 1BT8A 3K0DA 3ETGA 1TUEB 5KHIA 4LF4B 3CCMV 1J5EO 4CS3A 1QU7A 2FKXA 4ABMA 2IU0A 4DO2A 3APQA 4LF6O 1NKDA 1TUBB 4TUYA 1YI2V 4JI5B 1Y66A 3VQYA 1SETA 1D5AA 1R6KA 4FLTA 1AR4A 5B1BB 2W0XA 4C7UA 3FYEB 3ZRVA 2EJ7A 5FPOA 4B3TO 1VQLV 5B3SB 5L3EA 1J5EB 3ML0A 3HKCB 3UCSC 1RFYA 3SPIA 1M4UA 4BIZA 5KX5A 4OPHA 2JEUA 4X1IB 2PTMA 4KFMA 3IFXA 1AI4A 1FXKC 2WLIB 5JQGB 1XREA 3H1KH 3B4SA 1F51A 1JJ2U 4O4IB 3UKMA 4YJ3B 4LFBO 1EZVH 3CJHB 5J2UA 5A2QN 2MW2B 2LFRA 5B1AC 2N05A 3STLC 5LL6Y 4B3TB 5K1XA 2NNUA 1I94O 5DECA 4DV1O 5CA0B 2EBOA 5IYBO 2EIKC 1EN6A 2GUZA 3I56V 3JAWA 3K08A 4O2BB 3J81N 1R3KC 3D3QA 2YIAA 1IVSA 1A32A 1DF4A 4DRXA 3CE2A 2W6IG 2OTLV 2UUBB 4RQEA 5KHKA 1JMKC 1D2DA 5FLXN 4LFBB 1M57B 2B5UA 3DXRB 1YSCA 5LMNO 5GTHZ 1I94B 1Q6IA 4LF9O 4DV1B 4FLUA 4EB6B 2YC0A 3ZHTA 1RM1B 1XHXA 4O4HB 4UVCA 4PA6A 4ZOLA 1P4RA 5HFMA 2DQ0A 4YY3O 1Q7YW 5JCOA 4W4LA 2IJHA 4PJ0Z 4PI0A 1S72V 4I0XA 1KBHA 2P4VA 5LMNB 1ZLZA 4J9ZB 5IE9A 4MVOA 1GM8A 4FFBB 4DV2O 4X89A 3TETA 4LF9B 5EIBD 3CPWU 2K9PA 5ITZA 4JV5O 3M8AA 4NYKA 2WA4A 1MNGA 3K57A 2O57A 4YY3B 2P90A 1VARA 2PGGA 1FPOA 4LFCO 2ZR2A 5J2TB 3B8MA 2PYLA 4CS4A 1ZL8B 3ABMC 5E1AC 4X1YB 1VQ5V 4DV2B 3LNMB 3FB8C 3N2GB 3OM3B 3RVYA 2RNBA 3JAKA 4P30A 4JV5B 3OR7C 4X1IA 5H2FZ 3OEEG 4PD4F 4DUZO 1QQCA 2M6YA 2PI4A 3JALA 2Q73A 4TV9B 3ZS8C 3CB2A 4B3SB 4R7CA 5EC2C 4LFCB 3N27A 1BE3H 4LC1A 1OZ0A 1MABG 3GWOA 4DK0A 4MT8A 1OCCC 2UUAO 2QA4V 4HAMA 4PI2A 3T1CA 3CS5A 3TXSA 3DC6A 1R3JC 5KMGB 1Q81W 2B1IA 1AJQA 4QJFB 1BHAA 4DUZB 4QE7A 4DR2O 4QNHB 1S77D 2YUAA 1XHZA 2OTJV 1BMFG 2PYJA 2F4VB 1BCCH 2Q7HA 2ADQB 1LUWA 3AG4B 1JOYA 4DV5O 4DUYB 2UUAB 3U0ZA 3BABA 3MAQA 5KA6A 2JRIA 2Q68A 2YIDA 5F2VO 4EB6A 3QVNA 3WFVA 3G4SV 3CCVV 4O4HA 2Y4TA 3SYCA 1FJGO 2D3OW 4DR2B 1TVKB 1F23A 5CB4A 4XDKA 3ZMVA 4MVSA 4B3MO 4UFZA 1GTOA 1YDXA 2CH7A 4IT5A 4K35A 5LBQA 2VWKA 5CA1B 1SQXH 5GTIZ 1FD9A 4UB8Z 1JA8A 2ITCC 2VQEB 1IX9A 2CTQA 5BZBA 3CYOA 3H9VA 4I9QA 1KP2A 3WB2A 1FJGB 1BZKA 2DE0X 2IJKA 3M7MX 1YIJV 1HNZO 4B3MB 2CGOA 4GT1A 1Y74B 1B04A 4Q20A 4FLWA 3AG1B 2UXCO 1YF2A 5EYPA 3RW0A 2ZE6A 4BIOA 4GX0A 1NJIW 1V54C 3HKDB 1AROP 4J9YB 2YXLA 4I5SA 3VQVA 1VF6A 1IBLO 2YIBD 5LXTB 1GN4A 1Q90D 2LGWA 5E79Z 3LSQA 1QLNA 1XILA 3ASNC 5LP6C 4UV9A 1YITV 3CRRA 2RQ6A 3OMAB 2Y0IA 2LGQA 4NTWA 2XNDG 2ZQMA 3JD4A 1JJOA 1AR1B 1VEWA 5H5NA 2DYSC 2ZXWC 4UCSA 5IJ9A 1IBLB 3ZMSA 2ZNJA 1YZBA 1EM1A 3CWBH 2F95B 3ETEA 3M99B 4JTAB 2HVJC 3ASOC 3TJTA 1P7GA 5H9CA 1M1KW 3G80A 1B6QA 2DOSA 4UUJC 5KHHA 3JARA 4O4LB 1VP7A 1XEQA 2Q9LA 2VQFO 1P84F 4D6TH 2ZE5A 1KU9A 4WFEA 2WLMA 2QWPB 3N2KA 4K0KO 3RWRD 1AI6A 3K04A 3S3WA 2JS5A 2AZ0A 2ZINA 2OCHA 2GSMB 4KHPO 4O4JB 2QKSA 4IIJB 2RCVA 3CCEV 3E22B 3CRCA 4FIPC 1M9NA 4JI3O 3OMNB 4MVRA 4DK1A 4B08A 2AHZA 2EIJC 3B77A 2VQFB 3TGUH 4BW9A 2FTKA 4K0KB 4WBNA 1QNMA 2G38A 2L35A 4W4KA 3P3PA 4KHPB 2EZOA 1MZEA 1EBOA 1VQ8V 2RDCA 4JI3B 3PN1A 3FD9A 1FFXB 1VQMV 1Y67A 5L3CA 3K3WA 3RYIB 4UVBA 4RQFA 1FYJA 2E3CA 3ZIAG 1U96A 3HKDA 1YJ9V 4JASA 4R6ZA 3OW2U 1CEZA 1PKXA 3AK2A 5LXTA 2P5OA 5IY5C 5CBHA 5FNVB 4X64O 3ABTA 3ZRWB 2XTAA 3KCXA 5IJ0A 2R72A 2XASA 4WCEV 5IYZB 2JK5C 2P06A 1EFRG 3LSUA 4HNAB 3FB5C 1Q43A 3OD4A 2X6BA 1OCOB 3JCZA 3L9DA 4I50A 4X64B 2YI9A 1MZFA 1S5HC 1NBMG 1DTOA 2OIGA 3ICXA 1G1XB 1HWYA 2BE3A 1Z5WA 3OUSA 3RYHA 4JI4O 2Q7GA 2DW4A 2ATKC 5EC1C 1JR9A 5J9PC 1MOFA 1JQ0A 1P49A 4RUFA 4X1KA 5JCOC 3ABUA 2XT9A 3FAVA 2KG7A 3JASB 3L73H 1GM7A 2W0FC 3K0GA 1WP8A 3W7XA 2WAMA 3K03A 2UUCO 1ORQC 3AG2C 4AI8A 1XDCA 1L0NH 1QLEC 5DM6V 1H38A 5LGUA 4FPPA 1OCZB 4QPJA 5B1BC 1RPOA 3CXHF 4GYCB 4OGQB 2BCCH 4PDMA 5B3SC 5KUKA 1VQ7V 1TA8A 4GKKO 1COWG 2DYRB 3MHSC 2QTSA 4G2KA 4J11A 1SERA 1I0HA 2ILMA 1FXHA 2QWQB 2W6JG 1XQ8A 3OAAG 4J42A 4H0LB 4FLZA 2F66C 3D3IA 2HEPA 2WLKA 4U3JB 4DR7B 3K5OA 1NH2D 1SA0B 4JYBA 1YXBA 3D36A 2X0LA 4GKKB 1N0NA 1QHTA 4B7EA 5KHGA 5D5QA 3B2EE 4NXNO 4LF6B 1KKCA 2EILB 3T4ZA 1N32O 1NZ6A 3CMAV 1M57C 3RT3C 3QO5A 1YCIA 4I7ZB 3U11A 4YJ2B 3DSQA 3JSNA 1R6TA 3JD3A 2CTPA 5JVDB 4LF7O 2LP7A 1YTFD 1N8RW 2QTOA 1VQ6V 3RBZA 4CH6A 1K33A 2P7TC 1SC5B 4ICGA 1Y76B 2K1EA 4GX1A 3FB6C 3GWKC 3W7UA 2FL4A 1GM9A 5TISZ 1WPXA 2JJ1G 2PF4E 1N32B 3SJAC 2UXBO 4ZBMA 3GB7C 3ZHUA 5IT9N 4MSWC 3JASA 4LWSB 3CRQA 1X59A 3AG3B 1DK1A 1BSMA 5EBLC 1Q8IA 2QSAA 2R9RB 1NR7A 4LF7B 4LH7A 1QCEA 3CMEV 1SKVA 4F6RA 3A2FA 3BA8A 5C8YB 4JYAO 1Q82W 5KA5A 1X4TA 1MSWD 4JGSA 2ADPA 1GH6A 4MS2A 1DF5A 1ZX3A 2PY5A 1NTZH 2YXYA 2UXBB 2BSKB 1FXKB 2KQXA 2Y69B 4TWKA 3U10A 5JJEB 3OMIB 1K73W 4FLXA 4ZKIA 3QNEA 4WFAV 5BR8O 4LCUC 4TOIA 2JGDA 1VF6C 1TGOA 4I9WA 3G6EV 2QE7G 3DC5A 3TK1A 4JYAB 3IAYA 3CCSV 1YHQV 5K1PA 4RO2A 2EIKB 1IBMO 2E74B 3KG2A 1ZSPA 1R3IC 4LF8O 1HNWO 1TUBA 1KP3A 2VS0A 4IYHA 5EZYB 4UXNA 1Z2GA 5B1OA 3SPHA 2LQTA 1AJPA 4JAAA 3BVOA 4ZI7B 3RN4A 3ZX6A 1DLBA 2ZE7A 5BR8B 2Q67A 3LSSA 3WG7C 4GX2A 4DR5O 1HNXO 3W7WA 3JYCA 1KB9F 1PNMA 3LNNA 2E76B 3LDDA 3B8NA 2ZD9A 1NTKH 4LNUB 4PDVA 5L3DA 3HKCA 3HR0A 4TV8B 4XDLA 1H8HG 1IBMB 1AP6A 2HJDA 2H3OA 1HNWB 4LF8B 2QEXV 3C90A 3SJQC 5CBGA 1GN6A 1OJHA 1M5IA 3IC9A 1FXVA 3AG4C 2WLIA 5JQGA 1WJZA
chains in the Genus database with same CATH topology
2UXBO 5IWAO 2FKXA 4JI2O 1F7YA 4JI7O 4JI1O 3OTOO 1HR0O 1FYJA 2E5LO 1N36O 4LF6O 5IT9N 1XMQO 3O65A 2AGAA 1X59A 4YY3O 1DK1A 4DV3O 3T1YO 4DV5O 5H5NA 3J7AU 2Z0AA 2JRIA 4JI6O 2N74A 2DJVA 1AILA 3SDLA 4B3SO 4A5UB 4X64O 1IBKO 4GKKO 2LW7A 4JYAO 4X65O 1YZBA 4JI0O 4DV2O 4DR1O 2UUBO 2UXDO 4DV0O 1N34O 4DR4O 4B3TO 1FJGO 3JAMN 4GKJO 3R66A 4JV5O 3M8AA 2HHHO 1KUQA 4X66O 2DOSA 4B3MO 1XEQA 1XMOO 4OPHA 2VQFO 5BR8O 1AB3A 4K0KO 4LFCO 2F4VO 1N33O 4DR3O 1XNRO 3F5TA 4LF5O 4KHPO 4LFBO 3T1HO 5A2QN 1NS1A 4DUYO 1IBMO 1G1XB 1HNWO 5LL6Y 1FKAO 4LF8O 4OX9O 4NXNO 4JI4O 1I94O 4JI3O 4DV1O 5LMUO 1HNZO 4LF4O 4DV6O 1N32O 4DUZO 3J81N 3RT3C 4YHHO 5BY1A 2UXCO 2ZM6O 4AQYO 4DR5O 1HNXO 1R6TA 1A32A 4X62O 4JI5O 4LF7O 4LFAO 2UUAO 1XNQO 1D2DA 5FLXN 3J80N 4DV7O 1IBLO 4DR7O 5BXZA 5LMNO 2UUCO 4NXMO 4B3RO 4DR6O 2VQEO 4OPAA 4JI8O 4LF9O 2ZKOA 1R1BA 2UU9O 1J5EO 4DR2O 4DV4O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB O;  5IWA O;  2FKX A;  4JI2 O;  1F7Y A;  4JI7 O;  4JI1 O;  3OTO O;  1HR0 O;  1FYJ A;  2E5L O;  1N36 O;  4LF6 O;  5IT9 N;  1XMQ O;  3O65 A;  2AGA A;  1X59 A;  4YY3 O;  1DK1 A;  4DV3 O;  3T1Y O;  4DV5 O;  5H5N A;  3J7A U;  2Z0A A;  2JRI A;  4JI6 O;  2N74 A;  2DJV A;  1AIL A;  3SDL A;  4B3S O;  4A5U B;  4X64 O;  1IBK O;  4GKK O;  2LW7 A;  4JYA O;  4X65 O;  1YZB A;  4JI0 O;  4DV2 O;  4DR1 O;  2UUB O;  2UXD O;  4DV0 O;  1N34 O;  4DR4 O;  4B3T O;  1FJG O;  3JAM N;  4GKJ O;  3R66 A;  4JV5 O;  3M8A A;  2HHH O;  1KUQ A;  4X66 O;  2DOS A;  4B3M O;  1XEQ A;  1XMO O;  4OPH A;  2VQF O;  5BR8 O;  1AB3 A;  4K0K O;  4LFC O;  2F4V O;  1N33 O;  4DR3 O;  1XNR O;  3F5T A;  4LF5 O;  4KHP O;  4LFB O;  3T1H O;  5A2Q N;  1NS1 A;  4DUY O;  1IBM O;  1G1X B;  1HNW O;  5LL6 Y;  1FKA O;  4LF8 O;  4OX9 O;  4NXN O;  4JI4 O;  1I94 O;  4JI3 O;  4DV1 O;  5LMU O;  1HNZ O;  4LF4 O;  4DV6 O;  1N32 O;  4DUZ O;  3J81 N;  3RT3 C;  4YHH O;  5BY1 A;  2UXC O;  2ZM6 O;  4AQY O;  4DR5 O;  1HNX O;  1R6T A;  1A32 A;  4X62 O;  4JI5 O;  4LF7 O;  4LFA O;  2UUA O;  1XNQ O;  1D2D A;  5FLX N;  3J80 N;  4DV7 O;  1IBL O;  4DR7 O;  5BXZ A;  5LMN O;  2UUC O;  4NXM O;  4B3R O;  4DR6 O;  2VQE O;  4OPA A;  4JI8 O;  4LF9 O;  2ZKO A;  1R1B A;  2UU9 O;  1J5E O;  4DR2 O;  4DV4 O; 
#chains in the Genus database with same CATH topology
 4PHZ A;  2XHB A;  4Z2W A;  4UCU A;  4JI2 O;  1F7Y A;  2IH3 C;  4JI7 O;  2YI8 A;  1M56 C;  3ABK C;  4O4I A;  4YJ3 A;  3OTO O;  3CJH A;  3B09 A;  1N0J A;  4Q6G A;  3JD2 A;  4DR5 B;  1HNX B;  4TQD A;  4FM0 A;  3E8B A;  2IBZ H;  2QR4 A;  1PPJ H;  3H01 A;  2HG5 C;  5CA0 A;  3P32 A;  1BGY H;  3K79 A;  1SZX A;  5JH7 B;  4B7K A;  4EFB A;  3SYQ A;  4JI0 O;  4O2B A;  4DR1 O;  4X8A A;  1H2M A;  2ZDI A;  2ETN A;  1GN2 A;  2YIC A;  1N34 O;  1CP9 A;  4JI2 B;  1VQ9 V;  2QWN B;  4JI7 B;  2GTS A;  2YS8 A;  1BQZ A;  3DXR A;  1SQQ H;  4U7O A;  1XMO O;  3ABM B;  4FM1 A;  1V55 B;  3HKE B;  3OGC C;  3A0H Z;  2X6A A;  1Z5V A;  3CX5 F;  3RYC B;  2WLL B;  4DR3 O;  4DW1 A;  3F5T A;  1E79 G;  4JI0 B;  1M93 A;  4DR1 B;  3OE7 G;  1SQV H;  2B9Z A;  4UCV A;  3AG1 C;  1BQ0 A;  5JJJ B;  2BSK A;  2EIN B;  1Y4M A;  3CC2 V;  3RGB A;  1K4C C;  3SYA A;  2RN9 A;  4DV5 B;  1OCC B;  1NVP D;  4YHH O;  3OFN G;  2A0L A;  4FFB A;  4AQY O;  1BHB A;  3ZHV A;  3RFR A;  3ZMT A;  4EFE A;  4NKG B;  2P6J A;  4PV1 B;  3VQW A;  4CH5 A;  2X7R B;  3BPZ A;  2WWW A;  5GON B;  4JAV A;  3E86 A;  4JAU A;  4NR1 A;  2FB5 A;  4JI8 O;  4U7N A;  1OCR C;  3JAT B;  1SES A;  2BTQ B;  2JEX A;  1YJW V;  5J2T A;  4DV4 O;  1KC8 W;  1GKF A;  1S5L Z;  2ZE8 A;  1ZL8 A;  4FK5 C;  3X2Q B;  4YHH B;  4X1Y A;  1KQS U;  1VMG A;  3BY6 A;  1H2L A;  1ZAU A;  5FPR A;  4F4L A;  4UB6 Z;  3N2G A;  5KAI Z;  1VQN V;  1VF7 A;  1IXB A;  4I4T B;  1W0J G;  4JTD B;  1GO3 F;  1U97 A;  2OCC C;  3T4D A;  2XAF A;  4ZIB A;  1HNZ B;  4WFG A;  4YIO A;  4JI8 B;  4TV9 A;  3BRC A;  4MVQ A;  3MDS A;  2YSU B;  3JAM N;  3ZN1 A;  4DV4 B;  2UXC B;  4GKJ O;  1PM9 A;  2HHH O;  1YJN V;  1THZ A;  3H1L H;  1WA8 B;  2YDE A;  3RYF B;  1R3L C;  1AVM A;  1WNS A;  4MVM A;  1H2S B;  4N21 A;  1KYO F;  2XUM A;  3ZRS A;  5KMG A;  1W0K G;  1KEC A;  3ZCC A;  4FLY A;  1PNL A;  1AI5 A;  3Q4H B;  4BR6 A;  3F5W C;  4RWU A;  2HKO A;  3E83 A;  2XAG A;  3ZHR A;  3G71 V;  1ZTE A;  1RPR A;  3P30 A;  3W7S A;  2HHH B;  2UXN A;  1E1R G;  4DV6 O;  3CRM A;  4IL6 Z;  3SR2 C;  1JVM A;  2EIM C;  5BY1 A;  1KMI Z;  1JFF B;  5L3B A;  1SQP H;  4X62 O;  3L74 H;  1NR1 A;  5C93 A;  4GUN A;  4LFA O;  2H8P C;  1HW7 A;  2GBO A;  2M7W A;  1IXM A;  3CHX A;  3IC7 A;  1XNQ O;  1LUV A;  1TVK A;  2QGN A;  2WA3 A;  3QO8 A;  1JPX A;  1XBL A;  3THO A;  1OV9 A;  3ASN B;  5LP6 B;  4PA7 A;  4JYC A;  4DR6 O;  5B5E Z;  4OPA A;  4MTG A;  5CA1 A;  3OT7 A;  1AI7 A;  5LGT A;  5IYD O;  3G6B A;  1L0L H;  2JJ2 G;  1TAE A;  3ETD A;  1EZJ A;  2A7W A;  2IM9 A;  4UV8 A;  3SPJ A;  1W59 A;  1SRY A;  1XMQ O;  3O65 A;  3A0B Z;  3ZHQ A;  3D36 C;  1S0V A;  1CXZ B;  3T1Y O;  1NT2 B;  3VQX A;  4LFA B;  1LR1 A;  1AR5 A;  1XNQ B;  4O2A B;  2CTR A;  1K97 A;  3ASO B;  3SDL A;  4A5U B;  1PP9 H;  2AXT Z;  4X65 O;  4JZG A;  1Y74 A;  4IHJ B;  1OCO C;  3JAT A;  2UXD O;  1K3E A;  4DV0 O;  2B1G A;  5LA6 B;  1H2K A;  4HBN A;  3KCY A;  2CUG A;  2BTO A;  3BHP A;  2JS3 A;  3R66 A;  5BMV B;  3FFQ A;  1XMQ B;  2QM8 A;  3WB0 A;  4CC5 A;  5LOV B;  3UM7 A;  1IZ3 A;  2D2C B;  1GAX A;  2RMK B;  4AHC A;  2LFS A;  4X65 B;  5B66 Z;  2FYU H;  2UXD B;  4DXW A;  4DV0 B;  3MD0 A;  4TUY B;  3K5M A;  3JSL A;  4TQF A;  2EIJ B;  4P9O A;  5KHJ A;  3F7Y C;  4BW5 A;  1I08 A;  5EK0 A;  1ENV A;  3UO3 A;  4LBE C;  4PDL A;  4HYO A;  4UCO A;  1WN7 A;  4P9P A;  4GZR B;  2JIZ G;  5EBW C;  3KZI Z;  3L70 H;  4WFF A;  1EN4 A;  2R9A A;  3AG7 A;  4NTX A;  2MK3 A;  2HR3 A;  4G28 B;  1K5S A;  3Q4H A;  1KKD A;  3ABL C;  3HKB B;  2QDO A;  2WSS G;  5KX5 B;  4DW0 A;  2OWO A;  2OIE A;  5BXZ A;  2QKA A;  4YXW G;  4JZ2 A;  4O4L A;  2A06 H;  3B40 A;  3WU2 Z;  1VQP V;  1XL6 A;  2A3Q A;  3NR7 A;  1BS3 A;  1PL0 A;  1B3Q A;  1J95 A;  3D8C A;  5IWA O;  5J2U B;  1JFF A;  1SS3 A;  4KL1 A;  2Q0A A;  2QWO B;  5IY5 B;  4O4J A;  1NTM H;  2DYR C;  4DV3 O;  4IIJ A;  2ODM A;  4L8J A;  2PUS A;  2WPD G;  3E22 A;  2Z0A A;  3K9S A;  1RSO B;  1Q3E A;  2GUZ B;  4JI6 O;  2DJV A;  3JAW B;  1MA1 A;  4JI4 B;  2LW7 A;  2IJJ A;  2Z5U A;  4QE9 A;  2R70 A;  4HZ3 A;  3CCQ V;  3EHB B;  1XOU A;  5IWA B;  4Z1M G;  2BOC C;  4FZ0 A;  4LH6 A;  2Y0P A;  1K5Q A;  1E1Q G;  3LUT B;  2UUC B;  4JI6 B;  2ARH A;  3H1H H;  1ZUQ A;  1N33 O;  4IGG A;  1FFX A;  2EIL C;  4ZOL B;  3RYI A;  1FS0 G;  4NTY A;  2EZP A;  1FFT B;  4XDJ A;  1QR8 A;  2F93 B;  3O9O A;  4I0X B;  4MTX A;  4H44 B;  5LOV A;  3BEH A;  5FNV A;  1S3J A;  3AK3 A;  2ZT9 B;  2GV9 A;  2Q69 A;  1O9G A;  4FFK A;  3ZRW A;  3S3X A;  2CK3 G;  2EX3 A;  3CCU V;  3AG2 B;  5ITZ B;  5IYZ A;  1N33 B;  1QLE B;  4HNA A;  1QVG U;  2IU3 A;  2ZDI C;  1VQ4 V;  4B3R O;  3CRA A;  2CTW A;  3AG3 C;  1CPY A;  1GN3 A;  2ZKO A;  3K06 A;  2F1M A;  3NXS A;  1XL4 A;  3QTC A;  4WFH A;  1W2B U;  2AHY A;  2YIB A;  3HKB A;  3WB1 A;  3SJC C;  1PNK A;  1NU1 H;  3JAK B;  1RM1 C;  3SPC A;  3UT5 B;  3RVZ A;  2N74 A;  3K58 A;  2Q5Z A;  2Y69 C;  3JAL B;  4NXN B;  2LW1 A;  2RJZ A;  4B3R B;  2UUB O;  2HLD G;  1PL4 A;  2AW9 A;  3CCL V;  2OT5 A;  1VF5 B;  2DQ3 A;  2V1D A;  3G67 A;  1SQB H;  4D7T A;  5EBM C;  1ZWI C;  1RSO A;  2QWR B;  3JCU Z;  3EFF K;  3CXC U;  4X88 A;  3CEI A;  2NLJ C;  1VQK V;  2IJI A;  3T1H O;  3OGI B;  4I55 B;  1Q86 W;  3SPG A;  5LMU O;  3CD6 V;  2DWE C;  1WB8 A;  1RP3 B;  5H6R A;  3C3T A;  4ASU G;  5B1A B;  1WPB A;  2ZIM A;  5AG2 A;  1QBZ A;  1K9M W;  3FB7 C;  2C2A A;  3BCC H;  3VOU A;  3DGE A;  2NN4 A;  2JVD A;  5CB4 B;  4PA4 A;  3J80 N;  3T1H B;  2DMX A;  5LHG A;  4WF9 V;  2WLN A;  2CH7 B;  2ZR3 A;  2L6L A;  3GVM A;  1K8A W;  1GMG A;  1Y6X A;  2DWD C;  3BA9 A;  4U3J A;  2KB1 A;  4J7Z A;  1SA0 A;  3VBB A;  5LMU B;  2LO1 A;  1SQG A;  4CS2 A;  3UO2 A;  2E5L O;  1US6 A;  2AGA A;  2CAZ C;  1G6U A;  3F7V C;  3CC4 V;  3J7A U;  2P67 A;  1PD3 A;  5CMU A;  1AIL A;  4B3S O;  2F23 A;  4UCT A;  1I7F A;  3P3N A;  2Q7E A;  4JTC B;  1R73 A;  2WLJ A;  3EXA A;  5IDJ A;  2Y4U A;  4FM2 A;  5EYP B;  3IJ4 A;  4X9Q A;  1P7B A;  1V55 C;  4XBF A;  4YJ2 A;  3HB3 B;  3SGI A;  4DR4 O;  5JVD A;  2XAH A;  2P4K A;  4CH4 A;  4J41 A;  2HVK C;  4PDR A;  1NH2 B;  2E5L B;  1Y76 A;  3MHH C;  4RUE A;  3UT5 A;  1L1F A;  5L3G A;  2EIN C;  2Z3Y A;  3QG5 A;  2F4V O;  3OR6 C;  4H33 A;  1XNR O;  2Q0O C;  1WP7 A;  1NS1 A;  4RAI A;  4DUY O;  3BAA A;  4DR4 B;  4LWS A;  3H1J H;  4OX9 O;  3OTO B;  4U3F H;  5IJ9 B;  3WG7 B;  4K3A A;  1UJW B;  3E8G A;  2IH1 C;  3UQ8 A;  4LP8 A;  1Q6U A;  3CCJ V;  5C8Y A;  1YTF B;  2N04 A;  2XOK G;  2CDY A;  2QM4 A;  3H1I H;  2LJ2 A;  3I5D A;  3LDE A;  3ZRX A;  3CCR V;  1MG1 A;  3ETQ A;  4MVZ A;  3R65 A;  4FZ1 A;  1XNR B;  1GK9 A;  4I55 A;  1FXK A;  1N34 B;  3JAR B;  4K8Z A;  1SQF A;  4CC6 A;  3X2Q C;  4UCR A;  4ZHQ B;  2VQE O;  1M56 B;  3ABK B;  3N2K B;  4OX9 B;  5HFL A;  3OEH G;  1F4M A;  2JGU A;  4GLX A;  1XMO B;  1R1B A;  2F43 G;  3OTF A;  4J7K A;  5A9G A;  3FKS G;  5EIB C;  5LYJ B;  4PEL A;  3K5N A;  3PJS K;  1BL8 A;  4NVP A;  2AZ2 A;  4DR3 B;  1T5E A;  5CA3 A;  4J80 A;  4DYL A;  3W7T A;  5EZY A;  5L3F A;  2V4D A;  4KP4 A;  1EN5 A;  4FLV A;  4ZI7 A;  3KKY A;  1HP8 A;  4MTO A;  1JX9 A;  2Q4P A;  1B06 A;  4BWA A;  1UFI A;  4WBN B;  4TSF G;  2GDS A;  2Y48 A;  3JD0 A;  4AQY B;  1F4N A;  3A0R A;  4FVM A;  4LNU A;  5KLV H;  4TV8 A;  4KXR A;  3SYO A;  1N4C A;  3AEI A;  1GRJ A;  1K4D C;  4GCZ A;  4LR3 A;  1WLE A;  3K9A A;  4AIL C;  1OHH G;  4JPR A;  1K92 A;  4GX5 A;  4JF3 A;  3TXQ A;  2A9H A;  1AP5 A;  2GHY A;  1JCH A;  5JH7 A;  5LHI A;  3A8T A;  3ZJZ A;  2ZM6 O;  2KKW A;  5IJ0 B;  3ZED A;  3SJB C;  1DGS A;  4NB5 A;  2DN9 A;  4D7S A;  2EUL A;  3LDC A;  1OCR B;  3FYI B;  4DV7 O;  2V7Q G;  1VQO V;  1I5Y A;  1XI1 A;  4GKJ B;  1SF9 A;  3ZBH A;  2VWJ A;  1K34 A;  1Q6H A;  3HKE A;  4MW8 A;  1V54 B;  2QM7 A;  4I50 B;  2WLH A;  4EEQ A;  2UU9 O;  3RYC A;  3K59 A;  2WLL A;  1QR9 A;  2ZM6 B;  1N36 O;  3BFR A;  2OCC B;  1ROP A;  2XAJ A;  3APO A;  4G27 B;  1YEW A;  3RYH B;  3STZ C;  4F6E A;  2ZCE A;  4X20 B;  4DV7 B;  3T2M A;  4ZHQ A;  2VRZ A;  1D5N A;  1MMM A;  4X1K B;  4N23 A;  2YXH A;  3FAV B;  5LHH A;  4DV6 B;  2KG7 B;  3QF7 A;  3CSX A;  2Q6A A;  4L87 A;  5CBF A;  2QJ1 A;  2DYS B;  2ZXW B;  2UU9 B;  5LYJ A;  1R6N A;  1WAZ A;  5LGN A;  4TT3 G;  3CC7 V;  2BOB C;  5B1N A;  4EKW A;  4BAY A;  4X66 O;  4X62 B;  1N36 B;  2E75 B;  2OYQ A;  1FAF A;  1UPG A;  4FJC C;  1H8E G;  5GON A;  4QPK A;  1AB3 A;  1YVW A;  4BIU A;  5JJN B;  1AJN A;  4DR6 B;  2BTQ A;  5DED A;  1XUQ A;  4OXS A;  4Z1V A;  2KSD A;  2IW5 A;  1H2G A;  2CGN A;  3E2E A;  2Q8V A;  1FKA O;  1L8D A;  2EIM B;  1MSD A;  5KAF Z;  2YEV B;  3JD1 A;  1NVP B;  1VIB A;  1IUR A;  4H37 A;  4X66 B;  4R8C A;  4I4T A;  3T1Y B;  2UXX A;  4MW3 A;  4CZZ A;  4FMT A;  2NR5 A;  1QVF U;  4QIW F;  4JYY A;  5DN6 G;  4PA9 A;  2ZIO A;  2X6C A;  3OUF A;  1V9P A;  3TCU A;  3L72 H;  2ITD C;  4H13 B;  1Q5O A;  4NXM O;  4CBC A;  1G8M A;  4UVA A;  3E89 A;  1WA8 A;  3RYF A;  1M90 W;  2XAQ A;  4MTF A;  3K5L A;  4P2Z A;  2HP8 A;  2JDI G;  4JI1 O;  1HR0 O;  3E35 A;  4YIP A;  2PZS A;  2GTA A;  3L71 H;  4QGP A;  3ZMU A;  5FL7 G;  3ZN0 A;  1OCZ C;  5D5P A;  1URF A;  3QO7 A;  5CN0 A;  1KD1 W;  4KUM A;  1HDJ A;  5IYC O;  1IBK O;  2QKC A;  1IDS A;  3DTU B;  4NXM B;  1I5X A;  3IGA C;  1PV0 A;  4J7J A;  2H94 A;  3HPL C;  1NI8 A;  2P22 C;  1KUQ A;  4JI1 B;  1HR0 B;  4X20 A;  2A79 B;  3SYP A;  1K7D A;  5LP6 A;  2CE4 A;  5H6Q A;  1S5J A;  1S76 D;  2R9I A;  1NQT A;  1IBK B;  4IYI A;  4E2L A;  3L75 H;  1G4Y B;  2PI5 A;  4LF5 O;  1O9H A;  4DRX B;  3FX7 A;  2HFE C;  4WFB V;  4CH3 A;  3ZMZ A;  2ZNI A;  1WB7 A;  5KUM A;  3CP1 A;  2HJF C;  4MVU A;  1H2N A;  3E8H A;  4F6R B;  3ZHS A;  4LF4 O;  4O2A A;  4DV3 B;  4E4E A;  1SZT A;  3ABL B;  3E8F A;  1LNQ A;  2EJR A;  4IHJ A;  3AK1 A;  5GW7 A;  3C3S A;  2FML A;  3EVK A;  5LA6 A;  4JI5 O;  5JWP A;  4J10 A;  4LF5 B;  4DR7 O;  5BMV A;  4K8X A;  2YEV A;  4PA3 A;  2JGD B;  4R50 A;  3I55 V;  1BT8 A;  3K0D A;  3ETG A;  1TUE B;  5KHI A;  4LF4 B;  3CCM V;  1J5E O;  4CS3 A;  1QU7 A;  2FKX A;  4ABM A;  2IU0 A;  4DO2 A;  3APQ A;  4LF6 O;  1NKD A;  1TUB B;  4TUY A;  1YI2 V;  4JI5 B;  1Y66 A;  3VQY A;  1SET A;  1D5A A;  1R6K A;  4FLT A;  1AR4 A;  5B1B B;  2W0X A;  4C7U A;  3FYE B;  3ZRV A;  2EJ7 A;  5FPO A;  4B3T O;  1VQL V;  5B3S B;  5L3E A;  1J5E B;  3ML0 A;  3HKC B;  3UCS C;  1RFY A;  3SPI A;  1M4U A;  4BIZ A;  5KX5 A;  4OPH A;  2JEU A;  4X1I B;  2PTM A;  4KFM A;  3IFX A;  1AI4 A;  1FXK C;  2WLI B;  5JQG B;  1XRE A;  3H1K H;  3B4S A;  1F51 A;  1JJ2 U;  4O4I B;  3UKM A;  4YJ3 B;  4LFB O;  1EZV H;  3CJH B;  5J2U A;  5A2Q N;  2MW2 B;  2LFR A;  5B1A C;  2N05 A;  3STL C;  5LL6 Y;  4B3T B;  5K1X A;  2NNU A;  1I94 O;  5DEC A;  4DV1 O;  5CA0 B;  2EBO A;  5IYB O;  2EIK C;  1EN6 A;  2GUZ A;  3I56 V;  3JAW A;  3K08 A;  4O2B B;  3J81 N;  1R3K C;  3D3Q A;  2YIA A;  1IVS A;  1A32 A;  1DF4 A;  4DRX A;  3CE2 A;  2W6I G;  2OTL V;  2UUB B;  4RQE A;  5KHK A;  1JMK C;  1D2D A;  5FLX N;  4LFB B;  1M57 B;  2B5U A;  3DXR B;  1YSC A;  5LMN O;  5GTH Z;  1I94 B;  1Q6I A;  4LF9 O;  4DV1 B;  4FLU A;  4EB6 B;  2YC0 A;  3ZHT A;  1RM1 B;  1XHX A;  4O4H B;  4UVC A;  4PA6 A;  4ZOL A;  1P4R A;  5HFM A;  2DQ0 A;  4YY3 O;  1Q7Y W;  5JCO A;  4W4L A;  2IJH A;  4PJ0 Z;  4PI0 A;  1S72 V;  4I0X A;  1KBH A;  2P4V A;  5LMN B;  1ZLZ A;  4J9Z B;  5IE9 A;  4MVO A;  1GM8 A;  4FFB B;  4DV2 O;  4X89 A;  3TET A;  4LF9 B;  5EIB D;  3CPW U;  2K9P A;  5ITZ A;  4JV5 O;  3M8A A;  4NYK A;  2WA4 A;  1MNG A;  3K57 A;  2O57 A;  4YY3 B;  2P90 A;  1VAR A;  2PGG A;  1FPO A;  4LFC O;  2ZR2 A;  5J2T B;  3B8M A;  2PYL A;  4CS4 A;  1ZL8 B;  3ABM C;  5E1A C;  4X1Y B;  1VQ5 V;  4DV2 B;  3LNM B;  3FB8 C;  3N2G B;  3OM3 B;  3RVY A;  2RNB A;  3JAK A;  4P30 A;  4JV5 B;  3OR7 C;  4X1I A;  5H2F Z;  3OEE G;  4PD4 F;  4DUZ O;  1QQC A;  2M6Y A;  2PI4 A;  3JAL A;  2Q73 A;  4TV9 B;  3ZS8 C;  3CB2 A;  4B3S B;  4R7C A;  5EC2 C;  4LFC B;  3N27 A;  1BE3 H;  4LC1 A;  1OZ0 A;  1MAB G;  3GWO A;  4DK0 A;  4MT8 A;  1OCC C;  2UUA O;  2QA4 V;  4HAM A;  4PI2 A;  3T1C A;  3CS5 A;  3TXS A;  3DC6 A;  1R3J C;  5KMG B;  1Q81 W;  2B1I A;  1AJQ A;  4QJF B;  1BHA A;  4DUZ B;  4QE7 A;  4DR2 O;  4QNH B;  1S77 D;  2YUA A;  1XHZ A;  2OTJ V;  1BMF G;  2PYJ A;  2F4V B;  1BCC H;  2Q7H A;  2ADQ B;  1LUW A;  3AG4 B;  1JOY A;  4DV5 O;  4DUY B;  2UUA B;  3U0Z A;  3BAB A;  3MAQ A;  5KA6 A;  2JRI A;  2Q68 A;  2YID A;  5F2V O;  4EB6 A;  3QVN A;  3WFV A;  3G4S V;  3CCV V;  4O4H A;  2Y4T A;  3SYC A;  1FJG O;  2D3O W;  4DR2 B;  1TVK B;  1F23 A;  5CB4 A;  4XDK A;  3ZMV A;  4MVS A;  4B3M O;  4UFZ A;  1GTO A;  1YDX A;  2CH7 A;  4IT5 A;  4K35 A;  5LBQ A;  2VWK A;  5CA1 B;  1SQX H;  5GTI Z;  1FD9 A;  4UB8 Z;  1JA8 A;  2ITC C;  2VQE B;  1IX9 A;  2CTQ A;  5BZB A;  3CYO A;  3H9V A;  4I9Q A;  1KP2 A;  3WB2 A;  1FJG B;  1BZK A;  2DE0 X;  2IJK A;  3M7M X;  1YIJ V;  1HNZ O;  4B3M B;  2CGO A;  4GT1 A;  1Y74 B;  1B04 A;  4Q20 A;  4FLW A;  3AG1 B;  2UXC O;  1YF2 A;  5EYP A;  3RW0 A;  2ZE6 A;  4BIO A;  4GX0 A;  1NJI W;  1V54 C;  3HKD B;  1ARO P;  4J9Y B;  2YXL A;  4I5S A;  3VQV A;  1VF6 A;  1IBL O;  2YIB D;  5LXT B;  1GN4 A;  1Q90 D;  2LGW A;  5E79 Z;  3LSQ A;  1QLN A;  1XIL A;  3ASN C;  5LP6 C;  4UV9 A;  1YIT V;  3CRR A;  2RQ6 A;  3OMA B;  2Y0I A;  2LGQ A;  4NTW A;  2XND G;  2ZQM A;  3JD4 A;  1JJO A;  1AR1 B;  1VEW A;  5H5N A;  2DYS C;  2ZXW C;  4UCS A;  5IJ9 A;  1IBL B;  3ZMS A;  2ZNJ A;  1YZB A;  1EM1 A;  3CWB H;  2F95 B;  3ETE A;  3M99 B;  4JTA B;  2HVJ C;  3ASO C;  3TJT A;  1P7G A;  5H9C A;  1M1K W;  3G80 A;  1B6Q A;  2DOS A;  4UUJ C;  5KHH A;  3JAR A;  4O4L B;  1VP7 A;  1XEQ A;  2Q9L A;  2VQF O;  1P84 F;  4D6T H;  2ZE5 A;  1KU9 A;  4WFE A;  2WLM A;  2QWP B;  3N2K A;  4K0K O;  3RWR D;  1AI6 A;  3K04 A;  3S3W A;  2JS5 A;  2AZ0 A;  2ZIN A;  2OCH A;  2GSM B;  4KHP O;  4O4J B;  2QKS A;  4IIJ B;  2RCV A;  3CCE V;  3E22 B;  3CRC A;  4FIP C;  1M9N A;  4JI3 O;  3OMN B;  4MVR A;  4DK1 A;  4B08 A;  2AHZ A;  2EIJ C;  3B77 A;  2VQF B;  3TGU H;  4BW9 A;  2FTK A;  4K0K B;  4WBN A;  1QNM A;  2G38 A;  2L35 A;  4W4K A;  3P3P A;  4KHP B;  2EZO A;  1MZE A;  1EBO A;  1VQ8 V;  2RDC A;  4JI3 B;  3PN1 A;  3FD9 A;  1FFX B;  1VQM V;  1Y67 A;  5L3C A;  3K3W A;  3RYI B;  4UVB A;  4RQF A;  1FYJ A;  2E3C A;  3ZIA G;  1U96 A;  3HKD A;  1YJ9 V;  4JAS A;  4R6Z A;  3OW2 U;  1CEZ A;  1PKX A;  3AK2 A;  5LXT A;  2P5O A;  5IY5 C;  5CBH A;  5FNV B;  4X64 O;  3ABT A;  3ZRW B;  2XTA A;  3KCX A;  5IJ0 A;  2R72 A;  2XAS A;  4WCE V;  5IYZ B;  2JK5 C;  2P06 A;  1EFR G;  3LSU A;  4HNA B;  3FB5 C;  1Q43 A;  3OD4 A;  2X6B A;  1OCO B;  3JCZ A;  3L9D A;  4I50 A;  4X64 B;  2YI9 A;  1MZF A;  1S5H C;  1NBM G;  1DTO A;  2OIG A;  3ICX A;  1G1X B;  1HWY A;  2BE3 A;  1Z5W A;  3OUS A;  3RYH A;  4JI4 O;  2Q7G A;  2DW4 A;  2ATK C;  5EC1 C;  1JR9 A;  5J9P C;  1MOF A;  1JQ0 A;  1P49 A;  4RUF A;  4X1K A;  5JCO C;  3ABU A;  2XT9 A;  3FAV A;  2KG7 A;  3JAS B;  3L73 H;  1GM7 A;  2W0F C;  3K0G A;  1WP8 A;  3W7X A;  2WAM A;  3K03 A;  2UUC O;  1ORQ C;  3AG2 C;  4AI8 A;  1XDC A;  1L0N H;  1QLE C;  5DM6 V;  1H38 A;  5LGU A;  4FPP A;  1OCZ B;  4QPJ A;  5B1B C;  1RPO A;  3CXH F;  4GYC B;  4OGQ B;  2BCC H;  4PDM A;  5B3S C;  5KUK A;  1VQ7 V;  1TA8 A;  4GKK O;  1COW G;  2DYR B;  3MHS C;  2QTS A;  4G2K A;  4J11 A;  1SER A;  1I0H A;  2ILM A;  1FXH A;  2QWQ B;  2W6J G;  1XQ8 A;  3OAA G;  4J42 A;  4H0L B;  4FLZ A;  2F66 C;  3D3I A;  2HEP A;  2WLK A;  4U3J B;  4DR7 B;  3K5O A;  1NH2 D;  1SA0 B;  4JYB A;  1YXB A;  3D36 A;  2X0L A;  4GKK B;  1N0N A;  1QHT A;  4B7E A;  5KHG A;  5D5Q A;  3B2E E;  4NXN O;  4LF6 B;  1KKC A;  2EIL B;  3T4Z A;  1N32 O;  1NZ6 A;  3CMA V;  1M57 C;  3RT3 C;  3QO5 A;  1YCI A;  4I7Z B;  3U11 A;  4YJ2 B;  3DSQ A;  3JSN A;  1R6T A;  3JD3 A;  2CTP A;  5JVD B;  4LF7 O;  2LP7 A;  1YTF D;  1N8R W;  2QTO A;  1VQ6 V;  3RBZ A;  4CH6 A;  1K33 A;  2P7T C;  1SC5 B;  4ICG A;  1Y76 B;  2K1E A;  4GX1 A;  3FB6 C;  3GWK C;  3W7U A;  2FL4 A;  1GM9 A;  5TIS Z;  1WPX A;  2JJ1 G;  2PF4 E;  1N32 B;  3SJA C;  2UXB O;  4ZBM A;  3GB7 C;  3ZHU A;  5IT9 N;  4MSW C;  3JAS A;  4LWS B;  3CRQ A;  1X59 A;  3AG3 B;  1DK1 A;  1BSM A;  5EBL C;  1Q8I A;  2QSA A;  2R9R B;  1NR7 A;  4LF7 B;  4LH7 A;  1QCE A;  3CME V;  1SKV A;  4F6R A;  3A2F A;  3BA8 A;  5C8Y B;  4JYA O;  1Q82 W;  5KA5 A;  1X4T A;  1MSW D;  4JGS A;  2ADP A;  1GH6 A;  4MS2 A;  1DF5 A;  1ZX3 A;  2PY5 A;  1NTZ H;  2YXY A;  2UXB B;  2BSK B;  1FXK B;  2KQX A;  2Y69 B;  4TWK A;  3U10 A;  5JJE B;  3OMI B;  1K73 W;  4FLX A;  4ZKI A;  3QNE A;  4WFA V;  5BR8 O;  4LCU C;  4TOI A;  2JGD A;  1VF6 C;  1TGO A;  4I9W A;  3G6E V;  2QE7 G;  3DC5 A;  3TK1 A;  4JYA B;  3IAY A;  3CCS V;  1YHQ V;  5K1P A;  4RO2 A;  2EIK B;  1IBM O;  2E74 B;  3KG2 A;  1ZSP A;  1R3I C;  4LF8 O;  1HNW O;  1TUB A;  1KP3 A;  2VS0 A;  4IYH A;  5EZY B;  4UXN A;  1Z2G A;  5B1O A;  3SPH A;  2LQT A;  1AJP A;  4JAA A;  3BVO A;  4ZI7 B;  3RN4 A;  3ZX6 A;  1DLB A;  2ZE7 A;  5BR8 B;  2Q67 A;  3LSS A;  3WG7 C;  4GX2 A;  4DR5 O;  1HNX O;  3W7W A;  3JYC A;  1KB9 F;  1PNM A;  3LNN A;  2E76 B;  3LDD A;  3B8N A;  2ZD9 A;  1NTK H;  4LNU B;  4PDV A;  5L3D A;  3HKC A;  3HR0 A;  4TV8 B;  4XDL A;  1H8H G;  1IBM B;  1AP6 A;  2HJD A;  2H3O A;  1HNW B;  4LF8 B;  2QEX V;  3C90 A;  3SJQ C;  5CBG A;  1GN6 A;  1OJH A;  1M5I A;  3IC9 A;  1FXV A;  3AG4 C;  2WLI A;  5JQG A;  1WJZ A; 
#chains in the Genus database with same CATH homology
 2UXB O;  5IWA O;  2FKX A;  4JI2 O;  1F7Y A;  4JI7 O;  4JI1 O;  3OTO O;  1HR0 O;  1FYJ A;  2E5L O;  1N36 O;  4LF6 O;  5IT9 N;  1XMQ O;  3O65 A;  2AGA A;  1X59 A;  4YY3 O;  1DK1 A;  4DV3 O;  3T1Y O;  4DV5 O;  5H5N A;  3J7A U;  2Z0A A;  2JRI A;  4JI6 O;  2N74 A;  2DJV A;  1AIL A;  3SDL A;  4B3S O;  4A5U B;  4X64 O;  1IBK O;  4GKK O;  2LW7 A;  4JYA O;  4X65 O;  1YZB A;  4JI0 O;  4DV2 O;  4DR1 O;  2UUB O;  2UXD O;  4DV0 O;  1N34 O;  4DR4 O;  4B3T O;  1FJG O;  3JAM N;  4GKJ O;  3R66 A;  4JV5 O;  3M8A A;  2HHH O;  1KUQ A;  4X66 O;  2DOS A;  4B3M O;  1XEQ A;  1XMO O;  4OPH A;  2VQF O;  5BR8 O;  1AB3 A;  4K0K O;  4LFC O;  2F4V O;  1N33 O;  4DR3 O;  1XNR O;  3F5T A;  4LF5 O;  4KHP O;  4LFB O;  3T1H O;  5A2Q N;  1NS1 A;  4DUY O;  1IBM O;  1G1X B;  1HNW O;  5LL6 Y;  1FKA O;  4LF8 O;  4OX9 O;  4NXN O;  4JI4 O;  1I94 O;  4JI3 O;  4DV1 O;  5LMU O;  1HNZ O;  4LF4 O;  4DV6 O;  1N32 O;  4DUZ O;  3J81 N;  3RT3 C;  4YHH O;  5BY1 A;  2UXC O;  2ZM6 O;  4AQY O;  4DR5 O;  1HNX O;  1R6T A;  1A32 A;  4X62 O;  4JI5 O;  4LF7 O;  4LFA O;  2UUA O;  1XNQ O;  1D2D A;  5FLX N;  3J80 N;  4DV7 O;  1IBL O;  4DR7 O;  5BXZ A;  5LMN O;  2UUC O;  4NXM O;  4B3R O;  4DR6 O;  2VQE O;  4OPA A;  4JI8 O;  4LF9 O;  2ZKO A;  1R1B A;  2UU9 O;  1J5E O;  4DR2 O;  4DV4 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...