2FKXA

Ribosomal protein s15 from thermus thermophilus, nmr recalculated structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S15
publication title The Conformational Landscape of the Ribosomal Protein S15 and Its Influence on the Protein Interaction with 16S RNA.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural protein
total genus 26
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2fkxA00
1HNWO 4OX9O 4JI8O 4JI1O 4JV5O 5BXZA 4A5UB 4DR7O 4LF4O 4X65O 4B3RO 5BY1A 4DUYO 4DV0O 5A2QN 4JI0O 2DJVA 2Z0AA 4DUZO 4B3SO 4JI3O 4LF9O 3T1YO 2E5LO 3R66A 5IT9N 5LMUO 4DV2O 1YZBA 1F7YA 3J7AU 4DR6O 5LMNO 1KUQA 1N33O 3O65A 4K0KO 4NXMO 1N34O 4JI4O 4DV4O 5H5NA 4KHPO 4LF6O 2JRIA 1FYJA 4YY3O 1AILA 2DOSA 3F5TA 3J81N 4LFAO 2AGAA 2UUCO 2UUBO 5BR8O 1IBKO 1N36O 4DR4O 2UXBO 1FKAO 2LW7A 3M8AA 2VQEO 4DR5O 4B3TO 4GKKO 2ZKOA 4LFBO 1AB3A 4LFCO 1X59A 4DV7O 1R6TA 1XMQO 1DK1A 1XNQO 4JYAO 4X62O 1R1BA 4DR3O 1IBMO 4DV3O 3OTOO 4X66O 3J80N 5LL6Y 2UXDO 2UU9O 2VQFO 4AQYO 1A32A 1I94O 1XEQA 3JAMN 1G1XB 4JI2O 1HR0O 2UUAO 1HNXO 1NS1A 1J5EO 4JI7O 2ZM6O 4OPHA 1HNZO 1FJGO 1XMOO 1XNRO 4B3MO 4LF8O 4DR1O 4DV1O 4X64O 1N32O 4JI6O 3SDLA 5FLXN 4YHHO 2HHHO 3T1HO 4NXNO 2UXCO 4DR2O 4DV6O 3RT3C 4JI5O 4OPAA 4LF7O 2FKXA 4GKJO 1D2DA 2N74A 5IWAO 2F4VO 1IBLO 4DV5O 4LF5O
chains in the Genus database with same CATH superfamily
3SR2C 3TCUA 3L74H 4J9ZB 3ZCCA 3B2EE 3P3NA 1M56C 3CEIA 2CE4A 3LDEA 2QM4A 1NI8A 1RPRA 5A9GA 4BIUA 4N21A 1W59A 5IT9N 1JMKC 4DUYB 1EBOA 1JVMA 3C3SA 4TOIA 1IZ3A 4BIOA 2CH7A 3H1KH 3RVZA 1KUQA 4U7NA 3STLC 1YJNV 4X1KA 4RUEA 5HFMA 1TGOA 4E2LA 1VF6C 1CXZB 2A3QA 4LBEC 1TVKB 5EYPA 1XQ8A 1BE3H 5B1OA 1FFXA 2UUBO 4D6TH 4DV5O 2UXBO 4J7JA 1QLNA 2L6LA 2BTOA 2WLLA 4ASUG 2Y4TA 4O4LB 4FLYA 3ABLB 1L1FA 3P30A 3FX7A 4JYAO 1XNQO 2HKOA 1P49A 2H8PC 4P30A 2UU9O 4IHJB 1K7DA 2JGDB 4K0KB 3GWOA 5AG2A 5IJ9B 4I50A 2LGQA 4QJFB 2QEXV 3B8MA 1HNZO 3AG2B 4TWKA 1F4NA 4OGQB 4MT8A 2F66C 5LYJB 3E8BA 1DLBA 5JVDB 3ZRSA 5BZBA 3SPIA 3QO5A 2Q67A 4IL6Z 2FKXA 4PA9A 1HW7A 1OHHG 3HKCA 1NQTA 3KCYA 2F23A 4GKJB 3JARB 4RO2A 2NN4A 4PA6A 3ZMSA 4JPRA 3HKBB 1IX9A 1ZL8A 1J5EB 1XUQA 4MTGA 5ITZB 3T1CA 4JI1B 2CAZC 2Y0IA 2YIDA 2WLNA 2MK3A 2M6YA 3C90A 5FPRA 2JVDA 2BOCC 1Y74B 2LQTA 3K04A 5EIBD 4BWAA 3K0GA 2EZOA 3D3IA 3O65A 4MVMA 4LNUB 4NYKA 2V7QG 4O4IA 5B5EZ 1TA8A 3CMAV 3K58A 1GN2A 4QPJA 5EK0A 4I0XA 4HNAA 3ICXA 4LFAO 2HG5C 2KQXA 2W6JG 4NXMB 2Q7EA 1KP2A 4OXSA 2BTQA 2AZ2A 4DR5O 3L9DA 4JAAA 4CH3A 1D5NA 1BS3A 1XL6A 3TJTA 5LGNA 1DK1A 3BVOA 2QWRB 1IBMO 4TV8B 2WSSG 4FM2A 4H37A 4I55A 1GN6A 5DECA 4P9PA 1A32A 4NR1A 3RYIA 4YJ2A 1J95A 2LFRA 3RYHA 4PV1B 3BA8A 3DGEA 3CP1A 1L0NH 2ZT9B 1PD3A 3DSQA 4X1IA 5FLXN 5D5PA 1SF9A 3T1HO 1FJGB 4DR2O 4N23A 3I55V 3ASNB 2R9AA 5LA6A 2QWPB 3X2QB 4DR1B 3H1JH 1VQ5V 1FFTB 1K34A 1OCCB 4CS2A 3ZHUA 1AI6A 2IH1C 2MW2B 4X20B 1K4CC 1AI7A 4WBNB 1SERA 1WP7A 1O9HA 3E8FA 4JV5O 4UCOA 4GX2A 2CH7B 1VQ4V 3ZS8C 4X1KB 3APQA 3GVMA 2Y0PA 1GRJA 5IWAB 1LUWA 1E1QG 3VQXA 3FYEB 5EYPB 4WFBV 2YXHA 1FFXB 5L3GA 3J7AU 5EBWC 3ZMTA 4JI0B 2ZXWC 3AG7A 1NVPD 1MNGA 2NR5A 3LDDA 5E1AC 1SQFA 3IJ4A 3FB5C 3GB7C 1FYJA 3EHBB 5LP6A 1K9MW 4HAMA 4UVCA 3JD0A 4DV4B 2PI4A 3M8AA 2OIEA 2YIBA 1QR9A 4I50B 1FXVA 1CP9A 1X59A 2Q7GA 1IBKB 2GTAA 5EBMC 1N4CA 5IYZB 1QR8A 1VF5B 4EFEA 3HKDA 1VIBA 2QTOA 3E86A 3N2KA 3FB7C 2YIBD 1HR0O 2ADPA 2CTRA 2QWNB 1Q86W 4JI7O 2A79B 1EZJA 4OPHA 4K8ZA 4LF6B 3CS5A 1I94B 4GX5A 2Y48A 1Z5WA 3HKCB 1S77D 1JOYA 1MMMA 1Q6HA 4Z2WA 2CDYA 3QO7A 3RYFB 4GLXA 4LWSA 4B3MB 3JSLA 5EC2C 1DF5A 1ZL8B 4GZRB 4LF7O 1Y76B 3K5LA 4XDJA 4JASA 3VBBA 1M9NA 4R8CA 1I08A 1MG1A 3BY6A 3IC7A 4AQYB 5L3CA 4LF4O 1NBMG 4FZ0A 1VMGA 4O4IB 5IDJA 3CRRA 4HNAB 3VQWA 5IYBO 4DV2O 4FLVA 1YZBA 2V4DA 2XASA 1F7YA 2OCCB 2HJDA 4QIWF 4D7TA 4PI2A 5KA5A 2PTMA 3RN4A 3RWRD 2RNBA 5EIBC 2BTQB 4UV9A 4NTYA 2EIMC 3AG4B 5KUKA 5LMNB 3OGCC 1KB9F 4I55B 1WPXA 3A2FA 3RYIB 1FXHA 1PNLA 2ZNIA 1AR5A 3LSSA 4DV0B 3D36A 3RYHB 2WLKA 4B3SB 3ZMVA 3D8CA 3ABTA 2UXXA 4DR3O 1RP3B 1KMIZ 1YVWA 2AHYA 2VQFO 3U0ZA 5J2TA 3L72H 3SPGA 5JWPA 1HDJA 1E1RG 2LJ2A 4PI0A 5LA6B 3STZC 3OTOB 1WB7A 2DQ3A 2LW1A 1S5HC 1JCHA 2BE3A 1S0VA 4LF8O 2DYSC 1N32O 4JI2B 1ZTEA 2QWOB 1JQ0A 4JI6O 1NVPB 3W7TA 5H6QA 1NU1H 3NXSA 3OUFA 3JD1A 5CA1A 1SRYA 3OD4A 1P7GA 1BMFG 4IIJA 1XHXA 1GO3F 3B4SA 1PL0A 3MAQA 4UFZA 2EBOA 2XHBA 1R3IC 3T4ZA 5JCOC 4PD4F 4DV5B 2ZM6B 3OT7A 2OCHA 2HJFC 1Q43A 4FJCC 1KQSU 3NR7A 2Q5ZA 4JGSA 1E79G 2GSMB 5LP6B 3T1YO 2E5LO 1VP7A 3CMEV 3CYOA 4J11A 4JZ2A 4WFEA 1MZFA 2K9PA 2ZCEA 4DR6O 1WA8A 3A0RA 4UCSA 4YJ3A 5KLVH 3K3WA 3BABA 4DK1A 3CJHA 4RQFA 2F4VB 1K5SA 2ZQMA 3ZHVA 4C7UA 5IJ0A 3HKDB 3FFQA 4NB5A 2UUCO 2NNUA 1VQ8V 1QLEB 4FMTA 4U7OA 3MHHC 1N36O 2DQ0A 3N2KB 1B04A 2LW7A 2VQEO 5DN6G 5KX5A 3THOA 4K35A 1DF4A 1PP9H 2ZKOA 4TT3G 2UUBB 3QTCA 2GV9A 2JS3A 2UXBB 2ZE6A 3CCEV 1ZWIC 3ZJZA 1VQ6V 5EC1C 2GBOA 3OMIB 4UCRA 2ZR2A 4LWSB 3ZN1A 3UKMA 1G1XB 1XNQB 3ZN0A 5B3SB 2EULA 1HWYA 4YY3B 2UU9B 4DV1O 3G6EV 2XAJA 4LH7A 3BEHA 1HNZB 1M56B 1X4TA 1QBZA 2ZDIA 3QF7A 1QVFU 1I0HA 3ETEA 5DEDA 1QLEC 5BMVB 4LR3A 4B08A 2ZIMA 4AI8A 1WNSA 3CRCA 3CPWU 4X66B 3M7MX 1F51A 2AHZA 2JJ1G 1QHTA 1YIJV 1I5XA 2DWDC 4O2AB 2UUAB 2EINC 4KP4A 3K79A 4TUYA 3HR0A 1V55C 2YEVA 2D3OW 1BQZA 1SQQH 1Q5OA 4LF9O 4YIOA 5B3SC 3JSNA 3N2GB 2XAFA 3RFRA 1Y4MA 2B1GA 1M93A 3I56V 3I5DA 4YIPA 4TQFA 3RBZA 1YJ9V 2ARHA 2QSAA 1QCEA 4KL1A 1G6UA 3JD2A 2VWJA 3OAAG 3WU2Z 1QU7A 2JRIA 2B5UA 1AILA 4F6RA 1NTMH 2K1EA 4JTCB 2YIAA 4WFFA 3K08A 3ETGA 5J2TB 3CCMV 1KKCA 2QGNA 2KG7A 4LFAB 2EJ7A 4GKKO 2EILC 4LFBO 1UJWB 3CCVV 2PI5A 5LXTA 1R6TA 1JR9A 3C3TA 1GM8A 1Q8IA 4DR5B 3CCRV 2KSDA 3JATB 4MW8A 1M57C 2RCVA 3U11A 2FMLA 3LDCA 1MSWD 1H2KA 3AG1C 3VOUA 5CA1B 1Z5VA 3FB8C 3D36C 1BQ0A 4IIJB 3B40A 1THZA 4BW9A 4F4LA 1URFA 2UXCO 2BSKA 4PDMA 4JI5O 3QG5A 1ROPA 3WFVA 4PDVA 4HZ3A 1UPGA 2EX3A 4GYCB 3T1HB 4RWUA 2OYQA 2KKWA 2RMKB 2N74A 2QE7G 4BW5A 3JASA 4DR2B 3E8HA 2YS8A 4AHCA 4HYOA 1KP3A 3KG2A 4JI8O 3Q4HA 1PV0A 3FD9A 1Q3EA 3W7UA 1WA8B 3DXRA 2LP7A 4IYIA 3RYCB 1S5JA 2P6JA 1Y6XA 2DMXA 3CJHB 2F93B 1PM9A 4R7CA 3UM7A 5IJ0B 3K03A 3CC2V 3CCLV 5JQGA 5H9CA 4CC6A 2WAMA 2E75B 1SKVA 3CCUV 1N33O 5KX5B 3OEHG 3JD4A 3OUSA 1RFYA 5LBQA 1IXMA 2DWEC 3BAAA 5JJJB 2BOBC 2ADQB 1BHAA 4X89A 2Q8VA 3AG3C 1VQOV 3LNNA 5BR8O 2XT9A 2WLMA 4E4EA 2PGGA 4I4TA 2GUZB 3SPCA 4JI3B 4FLWA 4DV7O 1XMQO 4H33A 3AEIA 5LL6Y 1VQPV 5FNVA 3MD0A 1OCOC 2YXLA 4MSWC 1H2NA 3T2MA 1Q6IA 1HNXO 2JDIG 2HVJC 1U96A 1DGSA 5GONA 2NLJC 4UB6Z 1HR0B 3KZIZ 2PYLA 1T5EA 4CH4A 4DRXB 1WP8A 1AJQA 2FL4A 4NXNO 4DV6O 3B8NA 3G80A 1H8EG 1N0NA 4TUYB 4MVOA 4FVMA 2YEVB 1MABG 4B7KA 1AJPA 4DV3B 3ZRXA 3ABKB 1LR1A 4LF7B 1HNWO 4OX9O 2ZXWB 4UCTA 4PHZA 4DYLA 5GTHZ 1OZ0A 5JCOA 4W4LA 5KHGA 2ZDIC 4WFHA 1LNQA 4DUZO 3B77A 2YDEA 2Q6AA 4DO2A 1PL4A 1XI1A 3SYAA 4QPKA 4F6RB 4LF4B 3ZRWA 5K1PA 2WWWA 5B1AB 3CC4V 5CB4A 4PA7A 3G67A 2X7RB 2KG7B 4K0KO 3G71V 4JI4O 3K57A 1YCIA 2ZIOA 1NR1A 4H44B 2YICA 5LXTB 1P84F 1IBLB 1SA0A 5EBLC 3J81N 4MW3A 3SYQA 3OMAB 4DR4O 2IJJA 3ABKC 2OWOA 1I5YA 2A7WA 1B6QA 3H1HH 3WB1A 2WLLB 2HP8A 4FIPC 4QGPA 4X62O 4XDKA 1AROP 4FM0A 4GX1A 3JCZA 3JAMN 2BSKB 1GKFA 5IYDO 3SJQC 5B1AC 4DR3B 3JALA 1J5EO 1GK9A 1BCCH 2VQFB 4O2BA 3JASB 2EJRA 5KHIA 1YJWV 3Q4HB 3TK1A 2UXNA 2HHHO 1WAZA 3ABMB 1VQMV 3DXRB 2FYUH 4PDRA 3ZEDA 3W7XA 1K73W 4LF8B 5L3EA 2GHYA 4OPAA 3RGBA 1N32B 2YI9A 3L70H 1CEZA 1K8AW 4LC1A 3SJBC 2RDCA 4CH6A 4X88A 4X1YA 4NVPA 2ZR3A 2UXDB 5JQGB 4P2ZA 3ZHQA 4R6ZA 2EZPA 2ODMA 2IM9A 5BXZA 3H1IH 1FXKA 4DR7O 1Q6UA 1P7BA 3FYIB 4B3RO 4ZHQA 3CCSV 3CRQA 3U10A 1XMOB 2EIMB 2Q9LA 4ZOLA 5JH7A 1ZLZA 3UCSC 5CA3A 1CPYA 1Q90D 3CXHF 5L3FA 5LMUO 4KFMA 1AI5A 2OIGA 3K06A 1S72V 4I4TB 3RW0A 1BSMA 3T1YB 2ATKC 1GN4A 2E5LB 2R72A 5D5QA 5LHGA 3K9AA 3OW2U 1KD1W 4RQEA 3ABMC 1COWG 4KHPO 4EB6A 1WJZA 3IFXA 2P22C 1I7FA 4I0XB 4XBFA 3G4SV 5FNVB 3OFNG 4B3TO 3DC6A 3UT5A 4LFCO 1AR1B 2ILMA 1F4MA 2DN9A 2DYSB 2VQEB 3OTFA 5FL7G 2PYJA 4Q6GA 3J80N 3ZRVA 1YF2A 3S3WA 1N34B 1AI4A 3P32A 3JAWA 4I9WA 4YJ2B 5CN0A 4BIZA 3QVNA 4UVBA 1IXBA 3ASOB 3SJAC 1KECA 4CZZA 4X64O 3L71H 1NTZH 2X6AA 5K1XA 4J7KA 3ETDA 3OM3B 1S5LZ 1KKDA 2ETNA 4X1IB 2WLIA 3WB0A 4DV1B 4P9OA 2R70A 1V54C 1R6KA 2GTSA 2Y69B 5CBFA 4LF5O 3A0HZ 3L73H 1PKXA 2A0LA 5C8YA 5CB4B 2OTLV 1V9PA 3T4DA 5B1BC 3CCJV 4CS4A 4PJ0Z 4Z1VA 1PNMA 1SA0B 2P67A 5F2VO 1SZXA 1VARA 2Q69A 3R66A 2YC0A 3SPJA 3SJCC 2B9ZA 3ASOC 4LF9B 4GX0A 3JAKA 3OR7C 3K5MA 1GM7A 2Q73A 2R9RB 4LCUC 3TXQA 1NR7A 1VQ9V 4LF6O 5KMGA 2P06A 3HPLC 3F7YC 4MVUA 1K5QA 4O4LA 3APOA 4BAYA 1Y67A 2HLDG 2Y69C 1SC5B 2KB1A 3TXSA 1KC8W 1OCZC 3JALB 1TUEB 2PF4E 4G27B 2JGUA 3TGUH 3BA9A 4O2BB 1AP5A 3G6BA 4O4HA 1K33A 1WN7A 1Z2GA 1H2GA 4X8AA 2CUGA 2XOKG 2Q0OC 4GKKB 1MZEA 1S76D 1TAEA 3K59A 2P90A 3TETA 4AQYO 3CXCU 4JZGA 1XEQA 4UV8A 3BCCH 3CE2A 4BR6A 1NS1A 2IW5A 4F6EA 2QTSA 3WB2A 2F43G 1XOUA 3ML0A 4RUFA 2A9HA 1TUBA 2DE0X 3K9SA 2QJ1A 4YHHO 2QA4V 3LSUA 1FXKB 2EINB 2JIZG 1YHQV 1V55B 4ZHQB 4HBNA 2ZINA 1SQBH 4ZOLB 4JYAB 2ZE7A 3WG7C 3VQYA 2X6BA 4ABMA 3ZBHA 2AXTZ 2LFSA 1RPOA 5BY1A 1YSCA 1G4YB 3HB3B 4DV0O 2QKSA 4PA3A 1F23A 4B3SO 1XHZA 4EB6B 5KHKA 2JEXA 3OR6C 4EKWA 2G38A 2OT5A 1SESA 3O9OA 4FLZA 2QM7A 2QM8A 2EILB 1Y66A 3JCUZ 3W7WA 1Q7YW 1FXKC 3P3PA 5H5NA 2XTAA 1H8HG 2BCCH 1RSOA 2DOSA 1GM9A 1N33B 2QR4A 5KAFZ 1VQNV 2F95B 5TISZ 4ICGA 5H2FZ 4JTDB 1M57B 2W6IG 1KYOF 2WLJA 4X9QA 1AJNA 4FLXA 3JAWB 1FD9A 3AG1B 2CGOA 1BL8A 3VQVA 5BR8B 4EFBA 1AVMA 1JJOA 1VF7A 3F7VC 4W4KA 4KUMA 2E74B 2Z5UA 3OEEG 1BHBA 1H2SB 4DV7B 2JEUA 1XREA 1L0LH 2ZM6O 3ZMZA 2RN9A 2RQ6A 1JPXA 4NKGB 1HNXB 3E8GA 3SDLA 5HFLA 1W0JG 5C8YB 4FFKA 3RT3C 1K92A 2FB5A 4K3AA 4WFGA 4X20A 2F1MA 3DTUB 4WBNA 4FFBA 2YI8A 3LUTB 1IBMB 4NXNB 4DV6B 1M4UA 2F4VO 1NH2B 2B1IA 2X0LA 2EIKB 3R65A 1YXBA 4DXWA 4J9YB 2V1DA 3JAKB 3CRAA 3ZIAG 4X65O 1NJIW 2DYRC 2ZD9A 4KXRA 1HNWB 4OX9B 2DJVA 1GTOA 5JJNB 2X6CA 1Q82W 1VQ7V 5KMGB 3AG3B 1HP8A 4JTAB 1EN5A 1IVSA 4DUZB 5C93A 4L8JA 1YITV 1JA8A 4YJ3B 4O4HB 4YY3O 2IJKA 2DW4A 1AP6A 1GN3A 4WF9V 4JI4B 4JV5B 1R6NA 5IYCO 4QNHB 1OCOB 1DTOA 3K5NA 1D5AA 1FKAO 3ZHRA 3PN1A 3HKEA 2Z3YA 5IYZA 2EIKC 1PPJH 1SQXH 1TUBB 4DR4B 1LUVA 1YTFD 4X66O 4ZKIA 4AILC 3GWKC 1MOFA 2ZE5A 3OGIB 4UB8Z 3CWBH 2UUAO 1KU9A 1S3JA 4X62B 3F5WC 4TQDA 1WLEA 5L3DA 2E76B 5KAIZ 1QVGU 3ABLC 1XL4A 2EIJB 1XNRO 4MVQA 1SS3A 2HR3A 3RYFA 1VQLV 2H3OA 1P4RA 1Y76A 4J41A 5J9PC 4WFAV 2ZE8A 4FK5C 3JYCA 2HHHB 3BHPA 3AG2C 1JX9A 1XILA 2CTPA 3A0BZ 3ABUA 4ZBMA 5LHHA 2ZNJA 1YDXA 3L75H 3LNMB 4JI7B 1SQPH 5FPOA 4PDLA 1Q81W 5GW7A 4DUYO 3EFFK 3KKYA 3LSQA 3M99B 1RSOB 4DR7B 3CX5F 2ITDC 4B3RB 3H1LH 4MTXA 1GAXA 2P5OA 2ITCC 2EIJC 2IJIA 3CSXA 2AZ0A 1IDSA 1JFFA 3AK3A 4J42A 4NTXA 1FPOA 5LMUB 3UO3A 2L35A 2AGAA 2IU0A 1N0JA 1O9GA 1G8MA 5B1NA 4KHPB 4LH6A 2Q68A 1YI2V 4K8XA 2Q0AA 2XAHA 2QKCA 2XAGA 4FLUA 2P4VA 4FPPA 3B09A 4GCZA 2P4KA 3K5OA 4DV2B 3SYCA 3QNEA 1EFRG 3E35A 4B3TB 3OE7G 1GH6A 4L87A 4LFCB 3H9VA 4MVRA 2PZSA 2QWQB 4ZI7A 3CD6V 4JYBA 3OMNB 4ZIBA 3QO8A 3ETQA 1K3EA 4LP8A 5CMUA 2W0XA 1AR4A 4EEQA 3IAYA 1XBLA 1SETA 2LO1A 3E83A 4FFBB 1KBHA 2LGWA 2H94A 1JJ2U 2M7WA 1H38A 1US6A 3H01A 1W2BU 5KHHA 1R3KC 1ZX3A 4X64B 2JK5C 5B66Z 4GKJO 1XDCA 1IURA 1EM1A 4U3JA 1K97A 4JI1O 3A8TA 3BFRA 2XUMA 1MA1A 4PA4A 1ZAUA 3ASNC 4LF5B 1QQCA 3X2QC 2Z0AA 2WA4A 4JI3O 4DW1A 3SPHA 1K4DC 1OCCC 1YTFB 4YXWG 4JI6B 2C2AA 2YSUB 1OJHA 5E79Z 2OTJV 3MDSA 3S3XA 3ZMUA 5L3BA 3HKEB 4NXMO 3CB2A 5EZYA 4JF3A 1FS0G 2O57A 4JYCA 5KHJA 5LOVA 3IC9A 5H6RA 4JYYA 4I9QA 3BPZA 1M5IA 3AK2A 2VRZA 4G2KA 3AK1A 5GTIZ 2N05A 1U97A 4CH5A 1SQVH 4DV3O 4DR6B 1R3LC 1YEWA 5CA0A 5J2UA 4DK0A 4G28B 1V54B 3ZX6A 4J80A 2XNDG 4CC5A 4O4JA 1FJGO 1WPBA 4I7ZB 4DR1O 2UUCB 1H2LA 1N36B 5GONB 3MHSC 1EZVH 1QNMA 5BMVA 4I5SA 5B1BB 4XDLA 4TV9A 4IYHA 3E22A 4H13B 4CS3A 1D2DA 1FAFA 4YHHB 1PNKA 1BT8A 5IWAO 1IBLO 4O2AA 3CRMA 5LGTA 1VF6A 4Q20A 1GMGA 2HFEC 1VEWA 4A5UB 1L8DA 1OV9A 1JFFB 1W0KG 5KUMA 1WB8A 1BZKA 3FAVA 4FZ1A 4JI0O 1ZUQA 2QDOA 2RJZA 3N2GA 3K0DA 3IGAC 1H2MA 2Q4PA 4GT1A 2IU3A 5IE9A 3N27A 3ZRWB 3ZHSA 1OCZB 1OCRB 4DV4O 1R3JC 5LGUA 2GDSA 1EN4A 4CBCA 2WPDG 2CK3G 4MTOA 4D7SA 2W0FC 4U3FH 4ZI7B 1IBKO 2OCCC 1M90W 3EXAA 3SGIA 1B06A 1AB3A 1TVKA 2VWKA 3SYOA 1ENVA 4MS2A 1EN6A 3AG4C 3ZHTA 3JATA 1R1BA 3SYPA 2XAQA 3E2EA 1UFIA 4UXNA 2UXDO 1I94O 4PELA 1M1KW 4MTFA 1NH2D 2IJHA 3W7SA 4J10A 5JJEB 3CHXA 3E89A 1XMOO 3WG7B 3BRCA 1OCRC 4R50A 4B3MO 3D3QA 4U3JB 4FLTA 4FM1A 4JAVA 1VQKV 2HEPA 4IHJA 2JGDA 3FKSG 3PJSK 1SQGA 5IJ9A 4LFBB 1R73A 3UQ8A 4UCVA 4Z1MG 2JJ2G 5LYJA 2N04A 5CBHA 2PUSA 3KCXA 3RYCA 5JVDA 4X1YB 2E3CA 1NZ6A 5CBGA 4UCUA 2IBZH 5EZYB 4TSFG 2Y4UA 5DM6V 2CTQA 2D2CB 5A2QN 4WCEV 2CGNA 4DW0A 4IT5A 5KA6A 2R9IA 4J7ZA 5IY5B 2YUAA 4X65B 5LOVB 1NKDA 5JH7B 2P7TC 4MVZA 2CTWA 2UXCB 3JARA 4JI5B 5LMNO 1N8RW 3HKBA 1N34O 1SZTA 4QE9A 2VS0A 4IGGA 4NTWA 4B7EA 5ITZA 2WA3A 3UO2A 1RM1B 3F5TA 2HVKC 1NT2B 5LP6C 4JI8B 1Y74A 2GUZA 5CA0B 3FB6C 3DC5A 5J2UB 2AW9A 2QKAA 1BGYH 4LNUA 4O4JB 1ZSPA 2PY5A 4MVSA 4JAUA 3UT5B 1NTKH 1ORQC 4UVAA 3OTOO 3RVYA 3JD3A 4GUNA 5IY5C 2A06H 4JI2O 4TV9B 3E22B 2JS5A 3CCQV 2YXYA 4DRXA 1MSDA 2FTKA 4TV8A 1RM1C 4QE7A 5LHIA 2WLHA 1XNRB 2DYRB 1B3QA 3CC7V 3FAVB 2Q7HA 3EVKA 1XMQB 2WLIB 2IH3C 4UUJC 4H0LB 4RAIA
chains in the Genus database with same CATH topology
1HNWO 4OX9O 4JI8O 4JI1O 4JV5O 5BXZA 4A5UB 4DR7O 4LF4O 4X65O 4B3RO 5BY1A 4DUYO 4DV0O 5A2QN 4JI0O 2DJVA 2Z0AA 4DUZO 4B3SO 4JI3O 4LF9O 3T1YO 2E5LO 3R66A 5IT9N 5LMUO 4DV2O 1YZBA 1F7YA 3J7AU 4DR6O 5LMNO 1KUQA 1N33O 3O65A 4K0KO 4NXMO 1N34O 4JI4O 4DV4O 5H5NA 4KHPO 4LF6O 2JRIA 1FYJA 4YY3O 1AILA 2DOSA 3F5TA 3J81N 4LFAO 2AGAA 2UUCO 2UUBO 5BR8O 1IBKO 1N36O 4DR4O 2UXBO 1FKAO 2LW7A 3M8AA 2VQEO 4DR5O 4B3TO 4GKKO 2ZKOA 4LFBO 1AB3A 4LFCO 1X59A 4DV7O 1R6TA 1XMQO 1DK1A 1XNQO 4JYAO 4X62O 1R1BA 4DR3O 1IBMO 4DV3O 3OTOO 4X66O 3J80N 5LL6Y 2UXDO 2UU9O 2VQFO 4AQYO 1A32A 1I94O 1XEQA 3JAMN 1G1XB 4JI2O 1HR0O 2UUAO 1HNXO 1NS1A 1J5EO 4JI7O 2ZM6O 4OPHA 1HNZO 1FJGO 1XMOO 1XNRO 4B3MO 4LF8O 4DR1O 4DV1O 4X64O 1N32O 4JI6O 3SDLA 5FLXN 4YHHO 2HHHO 3T1HO 4NXNO 2UXCO 4DR2O 4DV6O 3RT3C 4JI5O 4OPAA 4LF7O 2FKXA 4GKJO 1D2DA 2N74A 5IWAO 2F4VO 1IBLO 4DV5O 4LF5O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW O;  4OX9 O;  4JI8 O;  4JI1 O;  4JV5 O;  5BXZ A;  4A5U B;  4DR7 O;  4LF4 O;  4X65 O;  4B3R O;  5BY1 A;  4DUY O;  4DV0 O;  5A2Q N;  4JI0 O;  2DJV A;  2Z0A A;  4DUZ O;  4B3S O;  4JI3 O;  4LF9 O;  3T1Y O;  2E5L O;  3R66 A;  5IT9 N;  5LMU O;  4DV2 O;  1YZB A;  1F7Y A;  3J7A U;  4DR6 O;  5LMN O;  1KUQ A;  1N33 O;  3O65 A;  4K0K O;  4NXM O;  1N34 O;  4JI4 O;  4DV4 O;  5H5N A;  4KHP O;  4LF6 O;  2JRI A;  1FYJ A;  4YY3 O;  1AIL A;  2DOS A;  3F5T A;  3J81 N;  4LFA O;  2AGA A;  2UUC O;  2UUB O;  5BR8 O;  1IBK O;  1N36 O;  4DR4 O;  2UXB O;  1FKA O;  2LW7 A;  3M8A A;  2VQE O;  4DR5 O;  4B3T O;  4GKK O;  2ZKO A;  4LFB O;  1AB3 A;  4LFC O;  1X59 A;  4DV7 O;  1R6T A;  1XMQ O;  1DK1 A;  1XNQ O;  4JYA O;  4X62 O;  1R1B A;  4DR3 O;  1IBM O;  4DV3 O;  3OTO O;  4X66 O;  3J80 N;  5LL6 Y;  2UXD O;  2UU9 O;  2VQF O;  4AQY O;  1A32 A;  1I94 O;  1XEQ A;  3JAM N;  1G1X B;  4JI2 O;  1HR0 O;  2UUA O;  1HNX O;  1NS1 A;  1J5E O;  4JI7 O;  2ZM6 O;  4OPH A;  1HNZ O;  1FJG O;  1XMO O;  1XNR O;  4B3M O;  4LF8 O;  4DR1 O;  4DV1 O;  4X64 O;  1N32 O;  4JI6 O;  3SDL A;  5FLX N;  4YHH O;  2HHH O;  3T1H O;  4NXN O;  2UXC O;  4DR2 O;  4DV6 O;  3RT3 C;  4JI5 O;  4OPA A;  4LF7 O;  2FKX A;  4GKJ O;  1D2D A;  2N74 A;  5IWA O;  2F4V O;  1IBL O;  4DV5 O;  4LF5 O; 
#chains in the Genus database with same CATH topology
 3SR2 C;  3TCU A;  3L74 H;  4J9Z B;  3ZCC A;  3B2E E;  3P3N A;  1M56 C;  3CEI A;  2CE4 A;  3LDE A;  2QM4 A;  1NI8 A;  1RPR A;  5A9G A;  4BIU A;  4N21 A;  1W59 A;  5IT9 N;  1JMK C;  4DUY B;  1EBO A;  1JVM A;  3C3S A;  4TOI A;  1IZ3 A;  4BIO A;  2CH7 A;  3H1K H;  3RVZ A;  1KUQ A;  4U7N A;  3STL C;  1YJN V;  4X1K A;  4RUE A;  5HFM A;  1TGO A;  4E2L A;  1VF6 C;  1CXZ B;  2A3Q A;  4LBE C;  1TVK B;  5EYP A;  1XQ8 A;  1BE3 H;  5B1O A;  1FFX A;  2UUB O;  4D6T H;  4DV5 O;  2UXB O;  4J7J A;  1QLN A;  2L6L A;  2BTO A;  2WLL A;  4ASU G;  2Y4T A;  4O4L B;  4FLY A;  3ABL B;  1L1F A;  3P30 A;  3FX7 A;  4JYA O;  1XNQ O;  2HKO A;  1P49 A;  2H8P C;  4P30 A;  2UU9 O;  4IHJ B;  1K7D A;  2JGD B;  4K0K B;  3GWO A;  5AG2 A;  5IJ9 B;  4I50 A;  2LGQ A;  4QJF B;  2QEX V;  3B8M A;  1HNZ O;  3AG2 B;  4TWK A;  1F4N A;  4OGQ B;  4MT8 A;  2F66 C;  5LYJ B;  3E8B A;  1DLB A;  5JVD B;  3ZRS A;  5BZB A;  3SPI A;  3QO5 A;  2Q67 A;  4IL6 Z;  2FKX A;  4PA9 A;  1HW7 A;  1OHH G;  3HKC A;  1NQT A;  3KCY A;  2F23 A;  4GKJ B;  3JAR B;  4RO2 A;  2NN4 A;  4PA6 A;  3ZMS A;  4JPR A;  3HKB B;  1IX9 A;  1ZL8 A;  1J5E B;  1XUQ A;  4MTG A;  5ITZ B;  3T1C A;  4JI1 B;  2CAZ C;  2Y0I A;  2YID A;  2WLN A;  2MK3 A;  2M6Y A;  3C90 A;  5FPR A;  2JVD A;  2BOC C;  1Y74 B;  2LQT A;  3K04 A;  5EIB D;  4BWA A;  3K0G A;  2EZO A;  3D3I A;  3O65 A;  4MVM A;  4LNU B;  4NYK A;  2V7Q G;  4O4I A;  5B5E Z;  1TA8 A;  3CMA V;  3K58 A;  1GN2 A;  4QPJ A;  5EK0 A;  4I0X A;  4HNA A;  3ICX A;  4LFA O;  2HG5 C;  2KQX A;  2W6J G;  4NXM B;  2Q7E A;  1KP2 A;  4OXS A;  2BTQ A;  2AZ2 A;  4DR5 O;  3L9D A;  4JAA A;  4CH3 A;  1D5N A;  1BS3 A;  1XL6 A;  3TJT A;  5LGN A;  1DK1 A;  3BVO A;  2QWR B;  1IBM O;  4TV8 B;  2WSS G;  4FM2 A;  4H37 A;  4I55 A;  1GN6 A;  5DEC A;  4P9P A;  1A32 A;  4NR1 A;  3RYI A;  4YJ2 A;  1J95 A;  2LFR A;  3RYH A;  4PV1 B;  3BA8 A;  3DGE A;  3CP1 A;  1L0N H;  2ZT9 B;  1PD3 A;  3DSQ A;  4X1I A;  5FLX N;  5D5P A;  1SF9 A;  3T1H O;  1FJG B;  4DR2 O;  4N23 A;  3I55 V;  3ASN B;  2R9A A;  5LA6 A;  2QWP B;  3X2Q B;  4DR1 B;  3H1J H;  1VQ5 V;  1FFT B;  1K34 A;  1OCC B;  4CS2 A;  3ZHU A;  1AI6 A;  2IH1 C;  2MW2 B;  4X20 B;  1K4C C;  1AI7 A;  4WBN B;  1SER A;  1WP7 A;  1O9H A;  3E8F A;  4JV5 O;  4UCO A;  4GX2 A;  2CH7 B;  1VQ4 V;  3ZS8 C;  4X1K B;  3APQ A;  3GVM A;  2Y0P A;  1GRJ A;  5IWA B;  1LUW A;  1E1Q G;  3VQX A;  3FYE B;  5EYP B;  4WFB V;  2YXH A;  1FFX B;  5L3G A;  3J7A U;  5EBW C;  3ZMT A;  4JI0 B;  2ZXW C;  3AG7 A;  1NVP D;  1MNG A;  2NR5 A;  3LDD A;  5E1A C;  1SQF A;  3IJ4 A;  3FB5 C;  3GB7 C;  1FYJ A;  3EHB B;  5LP6 A;  1K9M W;  4HAM A;  4UVC A;  3JD0 A;  4DV4 B;  2PI4 A;  3M8A A;  2OIE A;  2YIB A;  1QR9 A;  4I50 B;  1FXV A;  1CP9 A;  1X59 A;  2Q7G A;  1IBK B;  2GTA A;  5EBM C;  1N4C A;  5IYZ B;  1QR8 A;  1VF5 B;  4EFE A;  3HKD A;  1VIB A;  2QTO A;  3E86 A;  3N2K A;  3FB7 C;  2YIB D;  1HR0 O;  2ADP A;  2CTR A;  2QWN B;  1Q86 W;  4JI7 O;  2A79 B;  1EZJ A;  4OPH A;  4K8Z A;  4LF6 B;  3CS5 A;  1I94 B;  4GX5 A;  2Y48 A;  1Z5W A;  3HKC B;  1S77 D;  1JOY A;  1MMM A;  1Q6H A;  4Z2W A;  2CDY A;  3QO7 A;  3RYF B;  4GLX A;  4LWS A;  4B3M B;  3JSL A;  5EC2 C;  1DF5 A;  1ZL8 B;  4GZR B;  4LF7 O;  1Y76 B;  3K5L A;  4XDJ A;  4JAS A;  3VBB A;  1M9N A;  4R8C A;  1I08 A;  1MG1 A;  3BY6 A;  3IC7 A;  4AQY B;  5L3C A;  4LF4 O;  1NBM G;  4FZ0 A;  1VMG A;  4O4I B;  5IDJ A;  3CRR A;  4HNA B;  3VQW A;  5IYB O;  4DV2 O;  4FLV A;  1YZB A;  2V4D A;  2XAS A;  1F7Y A;  2OCC B;  2HJD A;  4QIW F;  4D7T A;  4PI2 A;  5KA5 A;  2PTM A;  3RN4 A;  3RWR D;  2RNB A;  5EIB C;  2BTQ B;  4UV9 A;  4NTY A;  2EIM C;  3AG4 B;  5KUK A;  5LMN B;  3OGC C;  1KB9 F;  4I55 B;  1WPX A;  3A2F A;  3RYI B;  1FXH A;  1PNL A;  2ZNI A;  1AR5 A;  3LSS A;  4DV0 B;  3D36 A;  3RYH B;  2WLK A;  4B3S B;  3ZMV A;  3D8C A;  3ABT A;  2UXX A;  4DR3 O;  1RP3 B;  1KMI Z;  1YVW A;  2AHY A;  2VQF O;  3U0Z A;  5J2T A;  3L72 H;  3SPG A;  5JWP A;  1HDJ A;  1E1R G;  2LJ2 A;  4PI0 A;  5LA6 B;  3STZ C;  3OTO B;  1WB7 A;  2DQ3 A;  2LW1 A;  1S5H C;  1JCH A;  2BE3 A;  1S0V A;  4LF8 O;  2DYS C;  1N32 O;  4JI2 B;  1ZTE A;  2QWO B;  1JQ0 A;  4JI6 O;  1NVP B;  3W7T A;  5H6Q A;  1NU1 H;  3NXS A;  3OUF A;  3JD1 A;  5CA1 A;  1SRY A;  3OD4 A;  1P7G A;  1BMF G;  4IIJ A;  1XHX A;  1GO3 F;  3B4S A;  1PL0 A;  3MAQ A;  4UFZ A;  2EBO A;  2XHB A;  1R3I C;  3T4Z A;  5JCO C;  4PD4 F;  4DV5 B;  2ZM6 B;  3OT7 A;  2OCH A;  2HJF C;  1Q43 A;  4FJC C;  1KQS U;  3NR7 A;  2Q5Z A;  4JGS A;  1E79 G;  2GSM B;  5LP6 B;  3T1Y O;  2E5L O;  1VP7 A;  3CME V;  3CYO A;  4J11 A;  4JZ2 A;  4WFE A;  1MZF A;  2K9P A;  2ZCE A;  4DR6 O;  1WA8 A;  3A0R A;  4UCS A;  4YJ3 A;  5KLV H;  3K3W A;  3BAB A;  4DK1 A;  3CJH A;  4RQF A;  2F4V B;  1K5S A;  2ZQM A;  3ZHV A;  4C7U A;  5IJ0 A;  3HKD B;  3FFQ A;  4NB5 A;  2UUC O;  2NNU A;  1VQ8 V;  1QLE B;  4FMT A;  4U7O A;  3MHH C;  1N36 O;  2DQ0 A;  3N2K B;  1B04 A;  2LW7 A;  2VQE O;  5DN6 G;  5KX5 A;  3THO A;  4K35 A;  1DF4 A;  1PP9 H;  2ZKO A;  4TT3 G;  2UUB B;  3QTC A;  2GV9 A;  2JS3 A;  2UXB B;  2ZE6 A;  3CCE V;  1ZWI C;  3ZJZ A;  1VQ6 V;  5EC1 C;  2GBO A;  3OMI B;  4UCR A;  2ZR2 A;  4LWS B;  3ZN1 A;  3UKM A;  1G1X B;  1XNQ B;  3ZN0 A;  5B3S B;  2EUL A;  1HWY A;  4YY3 B;  2UU9 B;  4DV1 O;  3G6E V;  2XAJ A;  4LH7 A;  3BEH A;  1HNZ B;  1M56 B;  1X4T A;  1QBZ A;  2ZDI A;  3QF7 A;  1QVF U;  1I0H A;  3ETE A;  5DED A;  1QLE C;  5BMV B;  4LR3 A;  4B08 A;  2ZIM A;  4AI8 A;  1WNS A;  3CRC A;  3CPW U;  4X66 B;  3M7M X;  1F51 A;  2AHZ A;  2JJ1 G;  1QHT A;  1YIJ V;  1I5X A;  2DWD C;  4O2A B;  2UUA B;  2EIN C;  4KP4 A;  3K79 A;  4TUY A;  3HR0 A;  1V55 C;  2YEV A;  2D3O W;  1BQZ A;  1SQQ H;  1Q5O A;  4LF9 O;  4YIO A;  5B3S C;  3JSN A;  3N2G B;  2XAF A;  3RFR A;  1Y4M A;  2B1G A;  1M93 A;  3I56 V;  3I5D A;  4YIP A;  4TQF A;  3RBZ A;  1YJ9 V;  2ARH A;  2QSA A;  1QCE A;  4KL1 A;  1G6U A;  3JD2 A;  2VWJ A;  3OAA G;  3WU2 Z;  1QU7 A;  2JRI A;  2B5U A;  1AIL A;  4F6R A;  1NTM H;  2K1E A;  4JTC B;  2YIA A;  4WFF A;  3K08 A;  3ETG A;  5J2T B;  3CCM V;  1KKC A;  2QGN A;  2KG7 A;  4LFA B;  2EJ7 A;  4GKK O;  2EIL C;  4LFB O;  1UJW B;  3CCV V;  2PI5 A;  5LXT A;  1R6T A;  1JR9 A;  3C3T A;  1GM8 A;  1Q8I A;  4DR5 B;  3CCR V;  2KSD A;  3JAT B;  4MW8 A;  1M57 C;  2RCV A;  3U11 A;  2FML A;  3LDC A;  1MSW D;  1H2K A;  3AG1 C;  3VOU A;  5CA1 B;  1Z5V A;  3FB8 C;  3D36 C;  1BQ0 A;  4IIJ B;  3B40 A;  1THZ A;  4BW9 A;  4F4L A;  1URF A;  2UXC O;  2BSK A;  4PDM A;  4JI5 O;  3QG5 A;  1ROP A;  3WFV A;  4PDV A;  4HZ3 A;  1UPG A;  2EX3 A;  4GYC B;  3T1H B;  4RWU A;  2OYQ A;  2KKW A;  2RMK B;  2N74 A;  2QE7 G;  4BW5 A;  3JAS A;  4DR2 B;  3E8H A;  2YS8 A;  4AHC A;  4HYO A;  1KP3 A;  3KG2 A;  4JI8 O;  3Q4H A;  1PV0 A;  3FD9 A;  1Q3E A;  3W7U A;  1WA8 B;  3DXR A;  2LP7 A;  4IYI A;  3RYC B;  1S5J A;  2P6J A;  1Y6X A;  2DMX A;  3CJH B;  2F93 B;  1PM9 A;  4R7C A;  3UM7 A;  5IJ0 B;  3K03 A;  3CC2 V;  3CCL V;  5JQG A;  5H9C A;  4CC6 A;  2WAM A;  2E75 B;  1SKV A;  3CCU V;  1N33 O;  5KX5 B;  3OEH G;  3JD4 A;  3OUS A;  1RFY A;  5LBQ A;  1IXM A;  2DWE C;  3BAA A;  5JJJ B;  2BOB C;  2ADQ B;  1BHA A;  4X89 A;  2Q8V A;  3AG3 C;  1VQO V;  3LNN A;  5BR8 O;  2XT9 A;  2WLM A;  4E4E A;  2PGG A;  4I4T A;  2GUZ B;  3SPC A;  4JI3 B;  4FLW A;  4DV7 O;  1XMQ O;  4H33 A;  3AEI A;  5LL6 Y;  1VQP V;  5FNV A;  3MD0 A;  1OCO C;  2YXL A;  4MSW C;  1H2N A;  3T2M A;  1Q6I A;  1HNX O;  2JDI G;  2HVJ C;  1U96 A;  1DGS A;  5GON A;  2NLJ C;  4UB6 Z;  1HR0 B;  3KZI Z;  2PYL A;  1T5E A;  4CH4 A;  4DRX B;  1WP8 A;  1AJQ A;  2FL4 A;  4NXN O;  4DV6 O;  3B8N A;  3G80 A;  1H8E G;  1N0N A;  4TUY B;  4MVO A;  4FVM A;  2YEV B;  1MAB G;  4B7K A;  1AJP A;  4DV3 B;  3ZRX A;  3ABK B;  1LR1 A;  4LF7 B;  1HNW O;  4OX9 O;  2ZXW B;  4UCT A;  4PHZ A;  4DYL A;  5GTH Z;  1OZ0 A;  5JCO A;  4W4L A;  5KHG A;  2ZDI C;  4WFH A;  1LNQ A;  4DUZ O;  3B77 A;  2YDE A;  2Q6A A;  4DO2 A;  1PL4 A;  1XI1 A;  3SYA A;  4QPK A;  4F6R B;  4LF4 B;  3ZRW A;  5K1P A;  2WWW A;  5B1A B;  3CC4 V;  5CB4 A;  4PA7 A;  3G67 A;  2X7R B;  2KG7 B;  4K0K O;  3G71 V;  4JI4 O;  3K57 A;  1YCI A;  2ZIO A;  1NR1 A;  4H44 B;  2YIC A;  5LXT B;  1P84 F;  1IBL B;  1SA0 A;  5EBL C;  3J81 N;  4MW3 A;  3SYQ A;  3OMA B;  4DR4 O;  2IJJ A;  3ABK C;  2OWO A;  1I5Y A;  2A7W A;  1B6Q A;  3H1H H;  3WB1 A;  2WLL B;  2HP8 A;  4FIP C;  4QGP A;  4X62 O;  4XDK A;  1ARO P;  4FM0 A;  4GX1 A;  3JCZ A;  3JAM N;  2BSK B;  1GKF A;  5IYD O;  3SJQ C;  5B1A C;  4DR3 B;  3JAL A;  1J5E O;  1GK9 A;  1BCC H;  2VQF B;  4O2B A;  3JAS B;  2EJR A;  5KHI A;  1YJW V;  3Q4H B;  3TK1 A;  2UXN A;  2HHH O;  1WAZ A;  3ABM B;  1VQM V;  3DXR B;  2FYU H;  4PDR A;  3ZED A;  3W7X A;  1K73 W;  4LF8 B;  5L3E A;  2GHY A;  4OPA A;  3RGB A;  1N32 B;  2YI9 A;  3L70 H;  1CEZ A;  1K8A W;  4LC1 A;  3SJB C;  2RDC A;  4CH6 A;  4X88 A;  4X1Y A;  4NVP A;  2ZR3 A;  2UXD B;  5JQG B;  4P2Z A;  3ZHQ A;  4R6Z A;  2EZP A;  2ODM A;  2IM9 A;  5BXZ A;  3H1I H;  1FXK A;  4DR7 O;  1Q6U A;  1P7B A;  3FYI B;  4B3R O;  4ZHQ A;  3CCS V;  3CRQ A;  3U10 A;  1XMO B;  2EIM B;  2Q9L A;  4ZOL A;  5JH7 A;  1ZLZ A;  3UCS C;  5CA3 A;  1CPY A;  1Q90 D;  3CXH F;  5L3F A;  5LMU O;  4KFM A;  1AI5 A;  2OIG A;  3K06 A;  1S72 V;  4I4T B;  3RW0 A;  1BSM A;  3T1Y B;  2ATK C;  1GN4 A;  2E5L B;  2R72 A;  5D5Q A;  5LHG A;  3K9A A;  3OW2 U;  1KD1 W;  4RQE A;  3ABM C;  1COW G;  4KHP O;  4EB6 A;  1WJZ A;  3IFX A;  2P22 C;  1I7F A;  4I0X B;  4XBF A;  3G4S V;  5FNV B;  3OFN G;  4B3T O;  3DC6 A;  3UT5 A;  4LFC O;  1AR1 B;  2ILM A;  1F4M A;  2DN9 A;  2DYS B;  2VQE B;  3OTF A;  5FL7 G;  2PYJ A;  4Q6G A;  3J80 N;  3ZRV A;  1YF2 A;  3S3W A;  1N34 B;  1AI4 A;  3P32 A;  3JAW A;  4I9W A;  4YJ2 B;  5CN0 A;  4BIZ A;  3QVN A;  4UVB A;  1IXB A;  3ASO B;  3SJA C;  1KEC A;  4CZZ A;  4X64 O;  3L71 H;  1NTZ H;  2X6A A;  5K1X A;  4J7K A;  3ETD A;  3OM3 B;  1S5L Z;  1KKD A;  2ETN A;  4X1I B;  2WLI A;  3WB0 A;  4DV1 B;  4P9O A;  2R70 A;  1V54 C;  1R6K A;  2GTS A;  2Y69 B;  5CBF A;  4LF5 O;  3A0H Z;  3L73 H;  1PKX A;  2A0L A;  5C8Y A;  5CB4 B;  2OTL V;  1V9P A;  3T4D A;  5B1B C;  3CCJ V;  4CS4 A;  4PJ0 Z;  4Z1V A;  1PNM A;  1SA0 B;  2P67 A;  5F2V O;  1SZX A;  1VAR A;  2Q69 A;  3R66 A;  2YC0 A;  3SPJ A;  3SJC C;  2B9Z A;  3ASO C;  4LF9 B;  4GX0 A;  3JAK A;  3OR7 C;  3K5M A;  1GM7 A;  2Q73 A;  2R9R B;  4LCU C;  3TXQ A;  1NR7 A;  1VQ9 V;  4LF6 O;  5KMG A;  2P06 A;  3HPL C;  3F7Y C;  4MVU A;  1K5Q A;  4O4L A;  3APO A;  4BAY A;  1Y67 A;  2HLD G;  2Y69 C;  1SC5 B;  2KB1 A;  3TXS A;  1KC8 W;  1OCZ C;  3JAL B;  1TUE B;  2PF4 E;  4G27 B;  2JGU A;  3TGU H;  3BA9 A;  4O2B B;  1AP5 A;  3G6B A;  4O4H A;  1K33 A;  1WN7 A;  1Z2G A;  1H2G A;  4X8A A;  2CUG A;  2XOK G;  2Q0O C;  4GKK B;  1MZE A;  1S76 D;  1TAE A;  3K59 A;  2P90 A;  3TET A;  4AQY O;  3CXC U;  4JZG A;  1XEQ A;  4UV8 A;  3BCC H;  3CE2 A;  4BR6 A;  1NS1 A;  2IW5 A;  4F6E A;  2QTS A;  3WB2 A;  2F43 G;  1XOU A;  3ML0 A;  4RUF A;  2A9H A;  1TUB A;  2DE0 X;  3K9S A;  2QJ1 A;  4YHH O;  2QA4 V;  3LSU A;  1FXK B;  2EIN B;  2JIZ G;  1YHQ V;  1V55 B;  4ZHQ B;  4HBN A;  2ZIN A;  1SQB H;  4ZOL B;  4JYA B;  2ZE7 A;  3WG7 C;  3VQY A;  2X6B A;  4ABM A;  3ZBH A;  2AXT Z;  2LFS A;  1RPO A;  5BY1 A;  1YSC A;  1G4Y B;  3HB3 B;  4DV0 O;  2QKS A;  4PA3 A;  1F23 A;  4B3S O;  1XHZ A;  4EB6 B;  5KHK A;  2JEX A;  3OR6 C;  4EKW A;  2G38 A;  2OT5 A;  1SES A;  3O9O A;  4FLZ A;  2QM7 A;  2QM8 A;  2EIL B;  1Y66 A;  3JCU Z;  3W7W A;  1Q7Y W;  1FXK C;  3P3P A;  5H5N A;  2XTA A;  1H8H G;  2BCC H;  1RSO A;  2DOS A;  1GM9 A;  1N33 B;  2QR4 A;  5KAF Z;  1VQN V;  2F95 B;  5TIS Z;  4ICG A;  5H2F Z;  4JTD B;  1M57 B;  2W6I G;  1KYO F;  2WLJ A;  4X9Q A;  1AJN A;  4FLX A;  3JAW B;  1FD9 A;  3AG1 B;  2CGO A;  1BL8 A;  3VQV A;  5BR8 B;  4EFB A;  1AVM A;  1JJO A;  1VF7 A;  3F7V C;  4W4K A;  4KUM A;  2E74 B;  2Z5U A;  3OEE G;  1BHB A;  1H2S B;  4DV7 B;  2JEU A;  1XRE A;  1L0L H;  2ZM6 O;  3ZMZ A;  2RN9 A;  2RQ6 A;  1JPX A;  4NKG B;  1HNX B;  3E8G A;  3SDL A;  5HFL A;  1W0J G;  5C8Y B;  4FFK A;  3RT3 C;  1K92 A;  2FB5 A;  4K3A A;  4WFG A;  4X20 A;  2F1M A;  3DTU B;  4WBN A;  4FFB A;  2YI8 A;  3LUT B;  1IBM B;  4NXN B;  4DV6 B;  1M4U A;  2F4V O;  1NH2 B;  2B1I A;  2X0L A;  2EIK B;  3R65 A;  1YXB A;  4DXW A;  4J9Y B;  2V1D A;  3JAK B;  3CRA A;  3ZIA G;  4X65 O;  1NJI W;  2DYR C;  2ZD9 A;  4KXR A;  1HNW B;  4OX9 B;  2DJV A;  1GTO A;  5JJN B;  2X6C A;  1Q82 W;  1VQ7 V;  5KMG B;  3AG3 B;  1HP8 A;  4JTA B;  1EN5 A;  1IVS A;  4DUZ B;  5C93 A;  4L8J A;  1YIT V;  1JA8 A;  4YJ3 B;  4O4H B;  4YY3 O;  2IJK A;  2DW4 A;  1AP6 A;  1GN3 A;  4WF9 V;  4JI4 B;  4JV5 B;  1R6N A;  5IYC O;  4QNH B;  1OCO B;  1DTO A;  3K5N A;  1D5A A;  1FKA O;  3ZHR A;  3PN1 A;  3HKE A;  2Z3Y A;  5IYZ A;  2EIK C;  1PPJ H;  1SQX H;  1TUB B;  4DR4 B;  1LUV A;  1YTF D;  4X66 O;  4ZKI A;  4AIL C;  3GWK C;  1MOF A;  2ZE5 A;  3OGI B;  4UB8 Z;  3CWB H;  2UUA O;  1KU9 A;  1S3J A;  4X62 B;  3F5W C;  4TQD A;  1WLE A;  5L3D A;  2E76 B;  5KAI Z;  1QVG U;  3ABL C;  1XL4 A;  2EIJ B;  1XNR O;  4MVQ A;  1SS3 A;  2HR3 A;  3RYF A;  1VQL V;  2H3O A;  1P4R A;  1Y76 A;  4J41 A;  5J9P C;  4WFA V;  2ZE8 A;  4FK5 C;  3JYC A;  2HHH B;  3BHP A;  3AG2 C;  1JX9 A;  1XIL A;  2CTP A;  3A0B Z;  3ABU A;  4ZBM A;  5LHH A;  2ZNJ A;  1YDX A;  3L75 H;  3LNM B;  4JI7 B;  1SQP H;  5FPO A;  4PDL A;  1Q81 W;  5GW7 A;  4DUY O;  3EFF K;  3KKY A;  3LSQ A;  3M99 B;  1RSO B;  4DR7 B;  3CX5 F;  2ITD C;  4B3R B;  3H1L H;  4MTX A;  1GAX A;  2P5O A;  2ITC C;  2EIJ C;  2IJI A;  3CSX A;  2AZ0 A;  1IDS A;  1JFF A;  3AK3 A;  4J42 A;  4NTX A;  1FPO A;  5LMU B;  3UO3 A;  2L35 A;  2AGA A;  2IU0 A;  1N0J A;  1O9G A;  1G8M A;  5B1N A;  4KHP B;  4LH6 A;  2Q68 A;  1YI2 V;  4K8X A;  2Q0A A;  2XAH A;  2QKC A;  2XAG A;  4FLU A;  2P4V A;  4FPP A;  3B09 A;  4GCZ A;  2P4K A;  3K5O A;  4DV2 B;  3SYC A;  3QNE A;  1EFR G;  3E35 A;  4B3T B;  3OE7 G;  1GH6 A;  4L87 A;  4LFC B;  3H9V A;  4MVR A;  2PZS A;  2QWQ B;  4ZI7 A;  3CD6 V;  4JYB A;  3OMN B;  4ZIB A;  3QO8 A;  3ETQ A;  1K3E A;  4LP8 A;  5CMU A;  2W0X A;  1AR4 A;  4EEQ A;  3IAY A;  1XBL A;  1SET A;  2LO1 A;  3E83 A;  4FFB B;  1KBH A;  2LGW A;  2H94 A;  1JJ2 U;  2M7W A;  1H38 A;  1US6 A;  3H01 A;  1W2B U;  5KHH A;  1R3K C;  1ZX3 A;  4X64 B;  2JK5 C;  5B66 Z;  4GKJ O;  1XDC A;  1IUR A;  1EM1 A;  4U3J A;  1K97 A;  4JI1 O;  3A8T A;  3BFR A;  2XUM A;  1MA1 A;  4PA4 A;  1ZAU A;  3ASN C;  4LF5 B;  1QQC A;  3X2Q C;  2Z0A A;  2WA4 A;  4JI3 O;  4DW1 A;  3SPH A;  1K4D C;  1OCC C;  1YTF B;  4YXW G;  4JI6 B;  2C2A A;  2YSU B;  1OJH A;  5E79 Z;  2OTJ V;  3MDS A;  3S3X A;  3ZMU A;  5L3B A;  3HKE B;  4NXM O;  3CB2 A;  5EZY A;  4JF3 A;  1FS0 G;  2O57 A;  4JYC A;  5KHJ A;  5LOV A;  3IC9 A;  5H6R A;  4JYY A;  4I9Q A;  3BPZ A;  1M5I A;  3AK2 A;  2VRZ A;  4G2K A;  3AK1 A;  5GTI Z;  2N05 A;  1U97 A;  4CH5 A;  1SQV H;  4DV3 O;  4DR6 B;  1R3L C;  1YEW A;  5CA0 A;  5J2U A;  4DK0 A;  4G28 B;  1V54 B;  3ZX6 A;  4J80 A;  2XND G;  4CC5 A;  4O4J A;  1FJG O;  1WPB A;  4I7Z B;  4DR1 O;  2UUC B;  1H2L A;  1N36 B;  5GON B;  3MHS C;  1EZV H;  1QNM A;  5BMV A;  4I5S A;  5B1B B;  4XDL A;  4TV9 A;  4IYH A;  3E22 A;  4H13 B;  4CS3 A;  1D2D A;  1FAF A;  4YHH B;  1PNK A;  1BT8 A;  5IWA O;  1IBL O;  4O2A A;  3CRM A;  5LGT A;  1VF6 A;  4Q20 A;  1GMG A;  2HFE C;  1VEW A;  4A5U B;  1L8D A;  1OV9 A;  1JFF B;  1W0K G;  5KUM A;  1WB8 A;  1BZK A;  3FAV A;  4FZ1 A;  4JI0 O;  1ZUQ A;  2QDO A;  2RJZ A;  3N2G A;  3K0D A;  3IGA C;  1H2M A;  2Q4P A;  4GT1 A;  2IU3 A;  5IE9 A;  3N27 A;  3ZRW B;  3ZHS A;  1OCZ B;  1OCR B;  4DV4 O;  1R3J C;  5LGU A;  2GDS A;  1EN4 A;  4CBC A;  2WPD G;  2CK3 G;  4MTO A;  4D7S A;  2W0F C;  4U3F H;  4ZI7 B;  1IBK O;  2OCC C;  1M90 W;  3EXA A;  3SGI A;  1B06 A;  1AB3 A;  1TVK A;  2VWK A;  3SYO A;  1ENV A;  4MS2 A;  1EN6 A;  3AG4 C;  3ZHT A;  3JAT A;  1R1B A;  3SYP A;  2XAQ A;  3E2E A;  1UFI A;  4UXN A;  2UXD O;  1I94 O;  4PEL A;  1M1K W;  4MTF A;  1NH2 D;  2IJH A;  3W7S A;  4J10 A;  5JJE B;  3CHX A;  3E89 A;  1XMO O;  3WG7 B;  3BRC A;  1OCR C;  4R50 A;  4B3M O;  3D3Q A;  4U3J B;  4FLT A;  4FM1 A;  4JAV A;  1VQK V;  2HEP A;  4IHJ A;  2JGD A;  3FKS G;  3PJS K;  1SQG A;  5IJ9 A;  4LFB B;  1R73 A;  3UQ8 A;  4UCV A;  4Z1M G;  2JJ2 G;  5LYJ A;  2N04 A;  5CBH A;  2PUS A;  3KCX A;  3RYC A;  5JVD A;  4X1Y B;  2E3C A;  1NZ6 A;  5CBG A;  4UCU A;  2IBZ H;  5EZY B;  4TSF G;  2Y4U A;  5DM6 V;  2CTQ A;  2D2C B;  5A2Q N;  4WCE V;  2CGN A;  4DW0 A;  4IT5 A;  5KA6 A;  2R9I A;  4J7Z A;  5IY5 B;  2YUA A;  4X65 B;  5LOV B;  1NKD A;  5JH7 B;  2P7T C;  4MVZ A;  2CTW A;  2UXC B;  3JAR A;  4JI5 B;  5LMN O;  1N8R W;  3HKB A;  1N34 O;  1SZT A;  4QE9 A;  2VS0 A;  4IGG A;  4NTW A;  4B7E A;  5ITZ A;  2WA3 A;  3UO2 A;  1RM1 B;  3F5T A;  2HVK C;  1NT2 B;  5LP6 C;  4JI8 B;  1Y74 A;  2GUZ A;  5CA0 B;  3FB6 C;  3DC5 A;  5J2U B;  2AW9 A;  2QKA A;  1BGY H;  4LNU A;  4O4J B;  1ZSP A;  2PY5 A;  4MVS A;  4JAU A;  3UT5 B;  1NTK H;  1ORQ C;  4UVA A;  3OTO O;  3RVY A;  3JD3 A;  4GUN A;  5IY5 C;  2A06 H;  4JI2 O;  4TV9 B;  3E22 B;  2JS5 A;  3CCQ V;  2YXY A;  4DRX A;  1MSD A;  2FTK A;  4TV8 A;  1RM1 C;  4QE7 A;  5LHI A;  2WLH A;  1XNR B;  2DYR B;  1B3Q A;  3CC7 V;  3FAV B;  2Q7H A;  3EVK A;  1XMQ B;  2WLI B;  2IH3 C;  4UUJ C;  4H0L B;  4RAI A; 
#chains in the Genus database with same CATH homology
 1HNW O;  4OX9 O;  4JI8 O;  4JI1 O;  4JV5 O;  5BXZ A;  4A5U B;  4DR7 O;  4LF4 O;  4X65 O;  4B3R O;  5BY1 A;  4DUY O;  4DV0 O;  5A2Q N;  4JI0 O;  2DJV A;  2Z0A A;  4DUZ O;  4B3S O;  4JI3 O;  4LF9 O;  3T1Y O;  2E5L O;  3R66 A;  5IT9 N;  5LMU O;  4DV2 O;  1YZB A;  1F7Y A;  3J7A U;  4DR6 O;  5LMN O;  1KUQ A;  1N33 O;  3O65 A;  4K0K O;  4NXM O;  1N34 O;  4JI4 O;  4DV4 O;  5H5N A;  4KHP O;  4LF6 O;  2JRI A;  1FYJ A;  4YY3 O;  1AIL A;  2DOS A;  3F5T A;  3J81 N;  4LFA O;  2AGA A;  2UUC O;  2UUB O;  5BR8 O;  1IBK O;  1N36 O;  4DR4 O;  2UXB O;  1FKA O;  2LW7 A;  3M8A A;  2VQE O;  4DR5 O;  4B3T O;  4GKK O;  2ZKO A;  4LFB O;  1AB3 A;  4LFC O;  1X59 A;  4DV7 O;  1R6T A;  1XMQ O;  1DK1 A;  1XNQ O;  4JYA O;  4X62 O;  1R1B A;  4DR3 O;  1IBM O;  4DV3 O;  3OTO O;  4X66 O;  3J80 N;  5LL6 Y;  2UXD O;  2UU9 O;  2VQF O;  4AQY O;  1A32 A;  1I94 O;  1XEQ A;  3JAM N;  1G1X B;  4JI2 O;  1HR0 O;  2UUA O;  1HNX O;  1NS1 A;  1J5E O;  4JI7 O;  2ZM6 O;  4OPH A;  1HNZ O;  1FJG O;  1XMO O;  1XNR O;  4B3M O;  4LF8 O;  4DR1 O;  4DV1 O;  4X64 O;  1N32 O;  4JI6 O;  3SDL A;  5FLX N;  4YHH O;  2HHH O;  3T1H O;  4NXN O;  2UXC O;  4DR2 O;  4DV6 O;  3RT3 C;  4JI5 O;  4OPA A;  4LF7 O;  2FKX A;  4GKJ O;  1D2D A;  2N74 A;  5IWA O;  2F4V O;  1IBL O;  4DV5 O;  4LF5 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...