2FKXA

Ribosomal protein s15 from thermus thermophilus, nmr recalculated structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S15
publication title The Conformational Landscape of the Ribosomal Protein S15 and Its Influence on the Protein Interaction with 16S RNA.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural protein
total genus 26
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2fkxA00
1A32A 4DR2O 2VQFO 4B3MO 1R6TA 1N36O 5LL6Y 4DR7O 4JI3O 1KUQA 4DUZO 4JI2O 3T1HO 1N34O 1IBKO 2UU9O 3M8AA 4JI5O 1XNRO 3R66A 2UXCO 3F5TA 4JI4O 5BXZA 4LFAO 1N33O 4LF8O 4X62O 1N32O 1IBLO 2DJVA 4DV2O 1J5EO 2UUCO 4B3SO 1G1XB 5H5NA 3OTOO 4DV1O 3J80N 1F7YA 4AQYO 3J7AU 4X64O 2N74A 1XMOO 1FYJA 2JRIA 3JAMN 1XMQO 1I94O 4LFCO 1XEQA 1HNZO 4YHHO 5LMUO 2UXBO 4A5UB 2UUAO 4DV6O 4OPAA 5LMNO 4DR6O 4JV5O 4LF7O 4DV4O 4DR5O 1HNXO 4DR1O 1IBMO 2ZM6O 2AGAA 4DUYO 4X66O 2UUBO 1FKAO 4NXNO 1X59A 2FKXA 1XNQO 2VQEO 1HR0O 5IT9N 4LF9O 4B3RO 2LW7A 1DK1A 4DV5O 4DV3O 2UXDO 3O65A 5FLXN 4JYAO 1NS1A 4DV7O 3RT3C 2F4VO 4OPHA 1AILA 4NXMO 4JI1O 4LF4O 4LF6O 1HNWO 3T1YO 4KHPO 2HHHO 2DOSA 3J81N 4JI7O 4DR3O 3SDLA 4B3TO 5BY1A 5BR8O 4DR4O 4DV0O 1AB3A 5IWAO 4LF5O 1D2DA 4K0KO 2ZKOA 4LFBO 4X65O 4JI0O 4YY3O 2E5LO 4OX9O 1R1BA 5A2QN 4GKKO 1FJGO 4JI6O 4GKJO 4JI8O 2Z0AA 1YZBA
chains in the Genus database with same CATH superfamily
2YIAA 2FL4A 3OFNG 3M7MX 3CC2V 1I5YA 1FS0G 5B1AB 2VWKA 4GCZA 4P30A 1KUQA 1MSWD 2ZIOA 4FLYA 2YDEA 5LOVA 3H01A 2FMLA 3D3QA 4PA6A 1NH2B 4X65B 2XNDG 2DJVA 3ASNC 4QE9A 2CUGA 3B40A 3GB7C 1VQ9V 1AR5A 2DWDC 1Y67A 5IJ0B 5JQGA 1B06A 3CC7V 3JARA 1PL0A 3ASNB 1XREA 2PZSA 5IY5C 2UUAO 2KQXA 2DYRC 2DE0X 5EC1C 2P6JA 4LF7O 3A8TA 1M5IA 2X6AA 4IGGA 2F95B 1RSOA 2ZM6O 1YI2V 1FPOA 4CC6A 2AXTZ 4R50A 5JJNB 3CCMV 2ZXWB 3B2EE 4I4TB 1IDSA 4XBFA 1OCOC 5LXTA 4P9OA 1KMIZ 1I08A 1D5AA 2AW9A 1O9GA 2WLMA 4OPHA 1QR8A 2CAZC 2Y0IA 5LHHA 2ARHA 2EBOA 3UCSC 1MSDA 1VQLV 1LNQA 5J9PC 4JI1B 3G4SV 4J42A 3ZMZA 1KB9F 2ITCC 3E22A 2P7TC 2GUZB 2W0FC 3CCVV 1E79G 1P7GA 3DXRA 3K03A 2X6CA 3H1IH 4FLUA 2Q7EA 1SC5B 3O9OA 2BTQA 1FFXA 3HKCB 3OM3B 4X1IB 1N0JA 4L8JA 4NXMB 1JFFA 2D2CB 1HNWB 4GX5A 2YEVA 1N36O 3HR0A 3LUTB 3OMNB 2WSSG 2W0XA 3K3WA 3ABMC 4JI2O 3M8AA 4DV0B 4FLVA 1JOYA 1SETA 1VQNV 4CH3A 1GO3F 2B9ZA 5H2FZ 5IYBO 4RQEA 4ICGA 4LH7A 3ABMB 1COWG 5JVDA 1J95A 1PL4A 2ZNIA 1FYJA 3L9DA 4LFCO 2UXBO 1BGYH 1SA0A 1CPYA 3UM7A 3UO3A 3Q4HA 1JCHA 3OE7G 3WB0A 2UUAB 3QO7A 3APOA 4LP8A 4D7TA 1HW7A 4LF7B 4L87A 3LSSA 3CD6V 2ZE7A 2ZM6B 1P4RA 3LDCA 3N2KB 4IL6Z 4B3RO 4UUJC 3VBBA 1DK1A 2KB1A 3K06A 4YJ2A 4X64B 1NS1A 3ZMVA 3ZHSA 3R65A 3P3NA 3E83A 5LA6A 2WWWA 5GTIZ 4J11A 1EN5A 3E89A 4WCEV 2DOSA 1NH2D 1IBMB 2PI5A 1WA8B 4CH4A 4X88A 3I56V 2NNUA 1L0LH 1NJIW 2XHBA 2EILB 2ZR2A 2VQEB 4IIJB 1OV9A 1SZXA 4X1KB 4X20A 1K73W 5EBMC 1M56C 5A2QN 2CGNA 3CRCA 3H1HH 5EBWC 1K4CC 3W7TA 1PNLA 4Q6GA 4ZOLB 1VQ4V 4JI6O 4X8AA 2OT5A 4PI2A 2JEXA 3E86A 2HHHB 5CA0B 3TCUA 2UXCO 2E74B 5CA1A 3R66A 3TETA 4LNUB 2YXYA 4I7ZB 2DMXA 4GT1A 1N36B 4X9QA 4JI2B 3WU2Z 3BVOA 2QGNA 5JCOC 1LUWA 3L71H 3QVNA 4U7NA 3IGAC 2VWJA 1FJGB 1IURA 2N74A 2F93B 1VQ6V 4WBNA 2KSDA 3HKEA 3JAKB 1Q86W 5IDJA 4A5UB 4J7JA 5LMNO 1PNMA 2PYJA 4FFBB 3EHBB 3CHXA 1BMFG 5FNVB 4XDLA 2EINB 3RN4A 2UXBB 3APQA 3C3SA 3E8GA 3ZRWB 2F1MA 2HR3A 4TV8B 1CXZB 1MABG 3K5MA 1NI8A 1N32B 2YI8A 4KFMA 4NB5A 2OIEA 4EB6A 3OTOB 2WA4A 1VP7A 2Z3YA 5EZYB 4JASA 5CA3A 5EBLC 2RJZA 4FIPC 4UVAA 5J2UA 3KCYA 2KG7B 4LF6O 5JWPA 3T1YO 1F4MA 1SQBH 2QKSA 4KHPO 3J81N 1ZSPA 3L75H 2QJ1A 3LNNA 2EIKC 3SYOA 3JD1A 1OCCB 2OCHA 2Q4PA 4ZI7A 3BFRA 1E1QG 2QTOA 3EXAA 4UV8A 2GDSA 2E5LO 4NYKA 3JCZA 1H8EG 4R8CA 2ZNJA 2DW4A 1WLEA 4E4EA 3G67A 4JI8O 3JAWB 2Z0AA 2F4VB 1WB7A 1RP3B 1RM1C 4I0XA 5DM6V 3JATA 4JI6B 4FM2A 3F7YC 1Z5VA 4PA9A 4FLZA 1HWYA 3C3TA 1Y74A 4DR3B 3ETDA 4GLXA 1XNRO 4W4LA 2PYLA 5IYZA 3F5TA 3FAVA 1U96A 4LWSA 2HKOA 1RM1B 2UXCB 4KXRA 4GUNA 5EYPA 3JALA 3W7XA 5KUKA 1H8HG 1Y4MA 3QTCA 3L72H 2GBOA 2YUAA 2HJFC 4GKJB 1XEQA 4P2ZA 1Y66A 5LMUO 4U7OA 4NKGB 4OPAA 1ZAUA 3STLC 4DRXB 1BHBA 3SPIA 5LMNB 2IU0A 1R3LC 3IC7A 4G28B 2H3OA 4NVPA 3RYFB 5KHHA 1D5NA 3RW0A 4TQDA 1JJOA 3AG4C 3P30A 1ORQC 4G2KA 3FD9A 2M6YA 2YC0A 3K57A 1CP9A 3A2FA 1AI5A 1ZL8B 3MAQA 2YS8A 2QR4A 4PD4F 1XDCA 3SYCA 2CDYA 4JTDB 5BR8O 4LF6B 4OXSA 3AG2B 2UXXA 5GONB 3RVZA 3H9VA 4JGSA 4B7KA 4TT3G 2QWRB 3OUFA 3SPGA 3OMAB 2B1IA 2GHYA 2HVKC 4DV3B 1XI1A 1S0VA 2LO1A 2ILMA 3CRRA 1BSMA 1KQSU 3HPLC 1RFYA 2D3OW 5B1BB 2BSKA 4NTYA 4TWKA 3AG3C 1I0HA 3N27A 2W6IG 3FB5C 2WLLA 4JI8B 2ITDC 4FLWA 1N34O 3OAAG 2FTKA 2JS3A 1VQ8V 5B1NA 4CH6A 1G1XB 3AG3B 5BMVA 1GMGA 4OX9B 3SPJA 3FB8C 2EIJB 2ODMA 3CRAA 3RYCA 2CTQA 3SJAC 1I94O 3LDEA 5AG2A 2EIMC 1F4NA 3LSQA 4MTFA 5KAFZ 4JZ2A 4P9PA 4DR1O 4LR3A 4B3MB 4YIPA 1Z5WA 2YSUB 5LMUB 4I55B 4X66O 3DSQA 5K1PA 5LP6B 2EIMB 2YXLA 1HR0O 3B4SA 2UUCB 4LF9O 1KKCA 1Q3EA 1Q81W 1VQMV 1GN6A 5IJ0A 1ZUQA 5B3SC 4JYAO 3CCLV 3E2EA 5HFMA 3N2GB 1OCZC 4N21A 2JGUA 4RUEA 5E79Z 3MHHC 1NTZH 2QKAA 2JIZG 4PDMA 5CB4A 4HZ3A 5IWAO 4HYOA 3VQWA 1OCZB 4I4TA 2XOKG 2JDIG 4J9ZB 4FZ0A 4UCVA 3ASOC 4MTOA 2XAFA 1ROPA 4J80A 1B3QA 1QLEC 1WNSA 2IU3A 2W6JG 1SKVA 1XL4A 2L35A 4XDKA 2K1EA 2DQ0A 2XAHA 3ETEA 3G6BA 3OR6C 1V55C 3M99B 1R6TA 4DUZO 4JI5O 3CRQA 2G38A 3GVMA 3PN1A 1VF6A 3JSNA 1TVKB 2QWNB 1YVWA 1W2BU 5H5NA 4RO2A 2EULA 4CS2A 4AQYO 2ZT9B 1YDXA 3ZMUA 3HKCA 5L3BA 1XMOO 3DGEA 4J10A 4HNAA 4PA4A 3K79A 5KMGB 2YIBD 3TGUH 1HNXO 4QNHB 4FFKA 2QM7A 4O4IA 1K5SA 5EIBC 1IBKB 1YJWV 4NXNO 2IJHA 3SYQA 4O4LB 4WF9V 4X66B 4FVMA 2LW7A 1BQ0A 1O9HA 4LBEC 1HR0B 5FLXN 4PV1B 4LF9B 3FFQA 5CMUA 4JYAB 1QU7A 3BA8A 3CSXA 4QPJA 5IY5B 2DYRB 4LFBO 1ZLZA 2JEUA 2QA4V 5IWAB 2YICA 2QE7G 2GTAA 2ZE8A 3AEIA 1QQCA 3E8FA 1K97A 1OCOB 1K92A 2P4KA 2GSMB 4FM1A 5D5PA 1A32A 5F2VO 5LL6Y 4MT8A 3ZS8C 2NN4A 1AJQA 2P67A 4QJFB 3CCJV 3WG7C 1GRJA 3D36A 4DUZB 3JASB 2CH7A 4X1KA 1J5EO 4JI5B 3K0GA 5TISZ 5H9CA 2CE4A 1K8AW 3CWBH 1P7BA 3A0RA 3CMAV 5KA6A 4RWUA 1SZTA 1ZX3A 4YHHO 3ABLC 2GTSA 3E35A 1Q43A 3ETGA 1QLNA 1AJNA 1JPXA 4HAMA 4HBNA 3OGCC 1ZWIC 5D5QA 3E8HA 3K04A 1JQ0A 4PA3A 4LNUA 5IJ9A 2Q73A 1HNXB 3W7SA 2LJ2A 3H1KH 2LGQA 4PDVA 5IT9N 3HKDB 1R3KC 4FK5C 4NXNB 3X2QC 4WFAV 3NXSA 2HLDG 3JD2A 1HP8A 3T4ZA 3ZHVA 4FFBA 1MMMA 5FNVA 3K9AA 3SDLA 3JARB 4TV8A 4GX1A 2E3CA 4EFBA 3JCUZ 5LYJB 1YF2A 2Q69A 4GYCB 1QVFU 1YXBA 3SPCA 3F5WC 3RYIA 1R1BA 4LFBB 3CXCU 5C93A 2X0LA 1SQXH 4I50B 1UPGA 2A79B 2KG7A 4H44B 3CJHB 1VQKV 4MS2A 1JVMA 4I9QA 2QDOA 1JJ2U 1GM9A 4PJ0Z 5ITZB 2IJJA 4TV9B 1M57C 3CCSV 3BHPA 2IJKA 3OD4A 3KKYA 2QM8A 1Q82W 4X62O 4DYLA 5DEDA 3S3XA 4JAAA 4B3SO 1YJNV 4PELA 2C2AA 1S76D 5KHGA 4UCSA 1M57B 5HFLA 4X89A 2ATKC 4FLXA 3JAWA 1ENVA 3VQVA 1M56B 3L73H 2Y48A 1GTOA 1YCIA 3K5OA 1HDJA 4DV6O 4CH5A 3JD4A 1WAZA 2IW5A 1G8MA 4FLTA 4LCUC 1YTFB 3ZHTA 3H1JH 1JFFB 3CXHF 2QWQB 4GX2A 4RAIA 4AI8A 1GM8A 3QF7A 2YEVB 2ZCEA 2FKXA 2Z5UA 2ZIMA 1PD3A 1TUBB 4ABMA 4ZKIA 1WP7A 3I5DA 4JTAB 4BR6A 4DV5O 2OCCC 3B77A 4K8XA 1QHTA 3O65A 5CBHA 2V1DA 4LFCB 1W59A 5KX5B 5GTHZ 1U97A 2EJRA 4U3JB 4J41A 1AR1B 2OCCB 4UCTA 3SJBC 1AR4A 1P49A 4J7KA 1F51A 3L70H 1SA0B 1FXVA 2PF4E 4CZZA 1SQGA 3OMIB 5H6RA 3RYFA 1KKDA 3Q4HB 4Q20A 3LDDA 1GN2A 3ZIAG 1XHXA 4IYHA 4OGQB 3RYHB 1PPJH 4MVZA 5B66Z 4PI0A 3CCRV 4B3RB 4GKKO 4E2LA 1GM7A 2HVJC 2PGGA 1JA8A 4TUYB 1ZL8A 1OCRC 1IVSA 4H37A 1EN4A 1TA8A 2MK3A 4YJ2B 3ZN0A 4DR2O 1TGOA 2IBZH 2VQFO 2YIBA 3AG1C 1Q8IA 4DR7O 3F7VC 5GONA 3T1CA 1Q7YW 3UT5B 4JI4O 2P22C 3LSUA 4LFAO 1RPOA 1F23A 4X1YB 1YITV 4UVBA 2EIKB 3OW2U 3DC6A 1R6KA 3K58A 3ZEDA 2JGDA 4B3SB 2JRIA 1BT8A 1PM9A 1Z2GA 1HNZO 3HB3B 4X20B 1H2LA 1W0KG 3U10A 5L3CA 1K33A 1BL8A 1NQTA 5IYDO 1H2MA 1Q6IA 1FKAO 1X4TA 3KCXA 3ZX6A 1SS3A 2X6BA 2EX3A 5CA1B 4O2BA 2QKCA 4DV7O 1GH6A 4DO2A 4O4HB 4UB8Z 3DC5A 4LF4O 4JTCB 2P06A 3S3WA 2ZINA 4WBNB 3UKMA 3HKEB 4WFHA 4B3TO 3T2MA 4K8ZA 3VOUA 4DR4O 5LP6A 3E8BA 4LF5O 5FL7G 3AK1A 1OJHA 2QTSA 1BCCH 2Q67A 1K7DA 1L0NH 1FXKA 1VMGA 4YY3O 1S5JA 3I55V 2LGWA 1K9MW 2JS5A 1MZFA 1TAEA 3AG4B 4GKKB 1YTFD 5J2TB 5DN6G 4Z1MG 3BABA 3T1YB 4W4KA 4KHPB 3P32A 1FD9A 1Q90D 1L8DA 2UU9O 4U3FH 5A9GA 3C90A 5J2UB 4DR2B 2IH3C 2VQFB 2ZE6A 4FMTA 3ZHUA 3CPWU 1XILA 1M1KW 1N33O 4KL1A 1IBLO 1DTOA 2WLIB 4DV2O 2ZR3A 2H8PC 3STZC 4JI4B 4LFAB 2E5LB 1PKXA 1KP3A 3ZBHA 1S72V 1DF4A 1XMQO 1DF5A 1NTMH 2HG5C 5KAIZ 2WLKA 1G4YB 1VEWA 3CP1A 1HNZB 4G27B 2BOBC 2EZOA 4TSFG 4MTXA 1XNRB 4I0XB 5E1AC 2Q8VA 1I7FA 3HKBA 3ABKC 2ZE5A 1MNGA 3K5NA 1Y74B 3L74H 3CB2A 4MVMA 2DQ3A 1BHAA 1S77D 5C8YB 5KMGA 2LQTA 4JYYA 4DW0A 3MDSA 4AILC 3SYPA 4DV7B 1JMKC 5CN0A 3B8MA 2JJ2G 5EC2C 4JPRA 2E75B 4NTWA 4CS3A 4K0KO 4I5SA 4X65O 1VQ7V 4DR4B 4LF5B 1VF5B 1N8RW 3P3PA 2LP7A 3K5LA 4ASUG 1R3JC 5GW7A 3BAAA 4UCOA 4YY3B 3SR2C 1AJPA 5B3SB 1GN3A 1NT2B 2DYSC 1LR1A 3T1HO 5BR8B 3B8NA 2L6LA 4YJ3B 4UCUA 4O4JB 2QM4A 1NVPB 2QEXV 3QO5A 3OUSA 3SYAA 2A06H 1N33B 2DYSB 3OTFA 2XT9A 2YI9A 1IBLB 4DV2B 3IC9A 3ASOB 2WPDG 1XHZA 1XUQA 2BTOA 2Q7HA 5EK0A 3UO2A 4DK0A 4BWAA 4MVSA 1QLEB 2GUZA 1EBOA 1GN4A 3ZHRA 1K5QA 1XMQB 4K3AA 3FYEB 2AGAA 2Y4UA 2P90A 3CCUV 1N34B 1V55B 2BSKB 3RBZA 1UFIA 3ZRXA 3OGIB 3TJTA 2AZ2A 1X59A 2LFSA 2WLLB 2WLJA 3QNEA 3RGBA 4X1IA 1VQPV 5JH7B 2HJDA 2LW1A 4F6RB 3JD0A 1SQQH 4PDRA 4ZHQB 1H2NA 2Y4TA 1I94B 4NXMO 5BZBA 1HNWO 3OT7A 3RYCB 1IXBA 3MD0A 4PHZA 2Q0OC 3CCQV 4DR1B 2XAJA 4MSWC 2PUSA 5BY1A 1MA1A 4DV0O 1VQOV 1VF7A 3PJSK 2XASA 3HKDA 4IHJB 1H2SB 2RNBA 3EVKA 1FAFA 3CS5A 3W7WA 1OZ0A 4JF3A 1US6A 2PY5A 4K0KB 1FXHA 1BE3H 2VS0A 1IXMA 2WAMA 4GX0A 5B1OA 4O2AB 4WFFA 1IX9A 3KZIZ 4J9YB 5KLVH 1AP5A 1W0JG 1AI4A 2QWPB 3KG2A 4TQFA 4MVOA 3G6EV 3ZCCA 4FZ1A 1AI6A 1PP9H 2O57A 2ZXWC 3N2KA 4IT5A 1SESA 3ETQA 5L3FA 3ZRSA 5BXZA 1Q5OA 5LYJA 3BPZA 3SGIA 4IYIA 2HP8A 1P84F 1Q6HA 1V54C 3T1HB 1MG1A 5CB4B 2V4DA 3THOA 1K3EA 4I50A 3J7AU 1KYOF 4X64O 2Q0AA 1QBZA 1Y76B 3CJHA 1WA8A 4MW8A 4R6ZA 5KUMA 1V54B 3BY6A 5ITZA 1IBMO 4TV9A 2Q5ZA 3JSLA 3SJCC 4XDJA 4IIJA 1VF6C 4H33A 4CS4A 1SF9A 4ZOLA 2HEPA 3FB6C 2VQEO 4UV9A 1DLBA 2R9RB 3GWKC 3ABTA 1AROP 3WG7B 3A0HZ 4AQYB 1G6UA 1XMOB 3G71V 2Q7GA 2F43G 3FB7C 5CA0A 2FB5A 2B5UA 4YIOA 2QSAA 4EFEA 2OYQA 3JD3A 2HHHO 4HNAB 4JI7O 3CCEV 3ABLB 3U0ZA 1NVPD 1BS3A 2QWOB 1SERA 4FJCC 1D2DA 1TUBA 1GKFA 5LOVB 1KC8W 2R72A 4O4IB 1NKDA 2WLNA 2UXNA 4NTXA 3JAKA 1FJGO 2Y0PA 1Q6UA 5JCOA 4KUMA 3ZHQA 1DGSA 4UXNA 3OEHG 3X2QB 5KX5A 5JQGB 4U3JA 3ZRWA 2V7QG 3H1LH 4JI3O 5CBGA 2M7WA 3UQ8A 1RSOB 1K4DC 3ZN1A 4QE7A 1N32O 3RYHA 5LGTA 5LGUA 4MVUA 3B09A 5EZYA 3OTOO 2XUMA 4TUYA 4BW9A 3J80N 1WP8A 5K1XA 3T4DA 2MW2B 5LXTB 1QR9A 1KD1W 1XQ8A 2P5OA 1Y6XA 1YSCA 1N4CA 2A7WA 4UCRA 5LHGA 4JV5O 1H2GA 2XAQA 5L3GA 1URFA 2JJ1G 3K08A 3ABUA 3UT5A 4MVQA 2EILC 4DUYO 4AHCA 5EIBD 3D36C 3TXQA 1CEZA 4X1YA 1PNKA 3GWOA 1NU1H 3E22B 4QIWF 1J5EB 2AHYA 3DXRB 1THZA 1H38A 3EFFK 1XL6A 3ML0A 3ZJZA 2UXDO 1MOFA 2CH7B 2F4VO 2BTQB 1FFXB 5LBQA 2WA3A 4YHHB 2CTWA 2E76B 4KP4A 2CTRA 2IH1C 2YXHA 4DR3O 1WPXA 4N23A 1AP6A 2A3QA 1UJWB 2R9IA 4BW5A 4TOIA 1EN6A 1AI7A 2RMKB 2OWOA 3CYOA 4R7CA 4JI7B 4LC1A 4QGPA 4B7EA 5IJ9B 3SPHA 3BA9A 2PTMA 4O4HA 4DRXA 1S3JA 4GKJO 1GAXA 4UB6Z 5JVDB 4JAVA 4ZIBA 1SQVH 2EINC 3IFXA 3CC4V 3QG5A 5FPOA 3AG7A 3RWRD 3W7UA 4PA7A 2EZPA 3OR7C 4JI3B 2CGOA 5L3EA 4BIUA 4WFEA 3RFRA 1M90W 4D7SA 2H94A 1NZ6A 4EKWA 1R3IC 1QCEA 4JAUA 3WFVA 2EJ7A 4Z2WA 2IJIA 5J2TA 2CTPA 3RYIB 4NR1A 5LA6B 3ICXA 4DR6O 1I5XA 1OCRB 2YIDA 4DR5O 1OCCC 1KBHA 3CX5F 2JVDA 3K9SA 3CE2A 4JV5B 3AG1B 2R9AA 3K59A 2WLIA 2XAGA 4J7ZA 1EM1A 4X62B 3D8CA 5FPRA 4DUYB 5LGNA 2BE3A 4ZBMA 5KA5A 2Y69C 5DECA 2AZ0A 4DV3O 3FYIB 4CC5A 2ADQB 4H0LB 1KP2A 4FPPA 4LH6A 2ZDIA 4UFZA 3RT3C 5H6QA 1AILA 1H2KA 2DWEC 2UXDB 2Y69B 4JYBA 4DV6B 3G80A 3NR7A 4UVCA 3ZMTA 4I9WA 2HFEC 4C7UA 4JI0O 1YIJV 4OX9O 2RN9A 4DV5B 3ZMSA 5C8YA 4K35A 2ZD9A 1T5EA 4I55A 1SQPH 4WFBV 1B04A 4H13B 3AK2A 1M93A 5B5EZ 4D6TH 1S5HC 2KKWA 5JJJB 4B3MO 1M9NA 4LF8O 3CEIA 1KU9A 2UUCO 2X7RB 3CMEV 3VQXA 4DV1O 3LNMB 3N2GA 1FFTB 3K0DA 2VRZA 4EB6B 1N0NA 1PV0A 5IYCO 4B08A 4MVRA 1WPBA 2ADPA 3JAMN 3TXSA 1B6QA 1EZVH 1AVMA 2DN9A 3AK3A 3AG2C 4DV4O 3BCCH 1WN7A 3QO8A 3MHSC 2OTJV 5IE9A 4DR7B 3BEHA 2FYUH 2UUBO 4YJ3A 4DR6B 4DR5B 4O4JA 1YHQV 2PI4A 1KECA 1XNQO 2P4VA 5KHIA 2F23A 4ZI7B 1NTKH 1TUEB 1S5LZ 2F66C 4MW3A 4GZRB 3OEEG 5B1BC 3WB2A 4MTGA 1QVGU 2NR5A 2ZDIC 2LFRA 4QPKA 1XBLA 4DW1A 1WJZA 3IAYA 1GK9A 2JGDB 4EEQA 2CK3G 3JATB 1TVKA 4CBCA 5KHKA 5LHIA 4BAYA 1EZJA 2Q68A 3U11A 5IYZB 3DTUB 5JJEB 3FAVB 2EIJC 2IM9A 4LWSB 2A0LA 5JH7A 2Q9LA 5L3DA 2JK5C 3JYCA 1BZKA 1E1RG 4F6RA 4ZHQA 3ABKB 1VIBA 1IZ3A 1EFRG 5EYPB 3JALB 4JI0B 1YEWA 1K34A 1NR7A 4O2BB 1YZBA 2K9PA 1VARA 1WB8A 4LF4B 4YXWG 5CBFA 4O4LA 5LP6C 3D3IA 2RQ6A 4FM0A 2AHZA 4B3TB 1IBKO 4IHJA 3WB1A 1FXKC 1L1FA 2WLHA 2OIGA 1JR9A 1NR1A 2BOCC 3VQYA 2GV9A 1YJ9V 2RDCA 1OHHG 1F7YA 4LF8B 4BIZA 1QNMA 3IJ4A 4DV1B 1SRYA 4O2AA 1FXKB 3A0BZ 3RVYA 2Q6AA 2N04A 1R6NA 1RPRA 4DK1A 4JZGA 1JX9A 4JYCA 3SJQC 4BIOA 5KHJA 2UU9B 3BRCA 4DV4B 1BQZA 1ZTEA 1SQFA 1LUVA 2B1GA 2UUBB 4WFGA 3ZRVA 1V9PA 3TK1A 1XNQB 4F4LA 1Y76A 2ETNA 3FX7A 4JI1O 4Z1VA 1M4UA 2BCCH 2A9HA 3JASA 4PDLA 2R70A 2OTLV 4RUFA 2N05A 1AB3A 1MZEA 2RCVA 2ZQMA 2ZKOA 1XOUA 3FKSG 4RQFA 4F6EA 1VQ5V 5B1AC 2NLJC 5BMVB 3HKBB 4DXWA 1R73A 2XTAA 1NBMG 3CRMA
chains in the Genus database with same CATH topology
1A32A 4DR2O 2VQFO 4B3MO 1R6TA 1N36O 5LL6Y 4DR7O 4JI3O 1KUQA 4DUZO 4JI2O 3T1HO 1N34O 1IBKO 2UU9O 3M8AA 4JI5O 1XNRO 3R66A 2UXCO 3F5TA 4JI4O 5BXZA 4LFAO 1N33O 4LF8O 4X62O 1N32O 1IBLO 2DJVA 4DV2O 1J5EO 2UUCO 4B3SO 1G1XB 5H5NA 3OTOO 4DV1O 3J80N 1F7YA 4AQYO 3J7AU 4X64O 2N74A 1XMOO 1FYJA 2JRIA 3JAMN 1XMQO 1I94O 4LFCO 1XEQA 1HNZO 4YHHO 5LMUO 2UXBO 4A5UB 2UUAO 4DV6O 4OPAA 5LMNO 4DR6O 4JV5O 4LF7O 4DV4O 4DR5O 1HNXO 4DR1O 1IBMO 2ZM6O 2AGAA 4DUYO 4X66O 2UUBO 1FKAO 4NXNO 1X59A 2FKXA 1XNQO 2VQEO 1HR0O 5IT9N 4LF9O 4B3RO 2LW7A 1DK1A 4DV5O 4DV3O 2UXDO 3O65A 5FLXN 4JYAO 1NS1A 4DV7O 3RT3C 2F4VO 4OPHA 1AILA 4NXMO 4JI1O 4LF4O 4LF6O 1HNWO 3T1YO 4KHPO 2HHHO 2DOSA 3J81N 4JI7O 4DR3O 3SDLA 4B3TO 5BY1A 5BR8O 4DR4O 4DV0O 1AB3A 5IWAO 4LF5O 1D2DA 4K0KO 2ZKOA 4LFBO 4X65O 4JI0O 4YY3O 2E5LO 4OX9O 1R1BA 5A2QN 4GKKO 1FJGO 4JI6O 4GKJO 4JI8O 2Z0AA 1YZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A32 A;  4DR2 O;  2VQF O;  4B3M O;  1R6T A;  1N36 O;  5LL6 Y;  4DR7 O;  4JI3 O;  1KUQ A;  4DUZ O;  4JI2 O;  3T1H O;  1N34 O;  1IBK O;  2UU9 O;  3M8A A;  4JI5 O;  1XNR O;  3R66 A;  2UXC O;  3F5T A;  4JI4 O;  5BXZ A;  4LFA O;  1N33 O;  4LF8 O;  4X62 O;  1N32 O;  1IBL O;  2DJV A;  4DV2 O;  1J5E O;  2UUC O;  4B3S O;  1G1X B;  5H5N A;  3OTO O;  4DV1 O;  3J80 N;  1F7Y A;  4AQY O;  3J7A U;  4X64 O;  2N74 A;  1XMO O;  1FYJ A;  2JRI A;  3JAM N;  1XMQ O;  1I94 O;  4LFC O;  1XEQ A;  1HNZ O;  4YHH O;  5LMU O;  2UXB O;  4A5U B;  2UUA O;  4DV6 O;  4OPA A;  5LMN O;  4DR6 O;  4JV5 O;  4LF7 O;  4DV4 O;  4DR5 O;  1HNX O;  4DR1 O;  1IBM O;  2ZM6 O;  2AGA A;  4DUY O;  4X66 O;  2UUB O;  1FKA O;  4NXN O;  1X59 A;  2FKX A;  1XNQ O;  2VQE O;  1HR0 O;  5IT9 N;  4LF9 O;  4B3R O;  2LW7 A;  1DK1 A;  4DV5 O;  4DV3 O;  2UXD O;  3O65 A;  5FLX N;  4JYA O;  1NS1 A;  4DV7 O;  3RT3 C;  2F4V O;  4OPH A;  1AIL A;  4NXM O;  4JI1 O;  4LF4 O;  4LF6 O;  1HNW O;  3T1Y O;  4KHP O;  2HHH O;  2DOS A;  3J81 N;  4JI7 O;  4DR3 O;  3SDL A;  4B3T O;  5BY1 A;  5BR8 O;  4DR4 O;  4DV0 O;  1AB3 A;  5IWA O;  4LF5 O;  1D2D A;  4K0K O;  2ZKO A;  4LFB O;  4X65 O;  4JI0 O;  4YY3 O;  2E5L O;  4OX9 O;  1R1B A;  5A2Q N;  4GKK O;  1FJG O;  4JI6 O;  4GKJ O;  4JI8 O;  2Z0A A;  1YZB A; 
#chains in the Genus database with same CATH topology
 2YIA A;  2FL4 A;  3OFN G;  3M7M X;  3CC2 V;  1I5Y A;  1FS0 G;  5B1A B;  2VWK A;  4GCZ A;  4P30 A;  1KUQ A;  1MSW D;  2ZIO A;  4FLY A;  2YDE A;  5LOV A;  3H01 A;  2FML A;  3D3Q A;  4PA6 A;  1NH2 B;  4X65 B;  2XND G;  2DJV A;  3ASN C;  4QE9 A;  2CUG A;  3B40 A;  3GB7 C;  1VQ9 V;  1AR5 A;  2DWD C;  1Y67 A;  5IJ0 B;  5JQG A;  1B06 A;  3CC7 V;  3JAR A;  1PL0 A;  3ASN B;  1XRE A;  2PZS A;  5IY5 C;  2UUA O;  2KQX A;  2DYR C;  2DE0 X;  5EC1 C;  2P6J A;  4LF7 O;  3A8T A;  1M5I A;  2X6A A;  4IGG A;  2F95 B;  1RSO A;  2ZM6 O;  1YI2 V;  1FPO A;  4CC6 A;  2AXT Z;  4R50 A;  5JJN B;  3CCM V;  2ZXW B;  3B2E E;  4I4T B;  1IDS A;  4XBF A;  1OCO C;  5LXT A;  4P9O A;  1KMI Z;  1I08 A;  1D5A A;  2AW9 A;  1O9G A;  2WLM A;  4OPH A;  1QR8 A;  2CAZ C;  2Y0I A;  5LHH A;  2ARH A;  2EBO A;  3UCS C;  1MSD A;  1VQL V;  1LNQ A;  5J9P C;  4JI1 B;  3G4S V;  4J42 A;  3ZMZ A;  1KB9 F;  2ITC C;  3E22 A;  2P7T C;  2GUZ B;  2W0F C;  3CCV V;  1E79 G;  1P7G A;  3DXR A;  3K03 A;  2X6C A;  3H1I H;  4FLU A;  2Q7E A;  1SC5 B;  3O9O A;  2BTQ A;  1FFX A;  3HKC B;  3OM3 B;  4X1I B;  1N0J A;  4L8J A;  4NXM B;  1JFF A;  2D2C B;  1HNW B;  4GX5 A;  2YEV A;  1N36 O;  3HR0 A;  3LUT B;  3OMN B;  2WSS G;  2W0X A;  3K3W A;  3ABM C;  4JI2 O;  3M8A A;  4DV0 B;  4FLV A;  1JOY A;  1SET A;  1VQN V;  4CH3 A;  1GO3 F;  2B9Z A;  5H2F Z;  5IYB O;  4RQE A;  4ICG A;  4LH7 A;  3ABM B;  1COW G;  5JVD A;  1J95 A;  1PL4 A;  2ZNI A;  1FYJ A;  3L9D A;  4LFC O;  2UXB O;  1BGY H;  1SA0 A;  1CPY A;  3UM7 A;  3UO3 A;  3Q4H A;  1JCH A;  3OE7 G;  3WB0 A;  2UUA B;  3QO7 A;  3APO A;  4LP8 A;  4D7T A;  1HW7 A;  4LF7 B;  4L87 A;  3LSS A;  3CD6 V;  2ZE7 A;  2ZM6 B;  1P4R A;  3LDC A;  3N2K B;  4IL6 Z;  4B3R O;  4UUJ C;  3VBB A;  1DK1 A;  2KB1 A;  3K06 A;  4YJ2 A;  4X64 B;  1NS1 A;  3ZMV A;  3ZHS A;  3R65 A;  3P3N A;  3E83 A;  5LA6 A;  2WWW A;  5GTI Z;  4J11 A;  1EN5 A;  3E89 A;  4WCE V;  2DOS A;  1NH2 D;  1IBM B;  2PI5 A;  1WA8 B;  4CH4 A;  4X88 A;  3I56 V;  2NNU A;  1L0L H;  1NJI W;  2XHB A;  2EIL B;  2ZR2 A;  2VQE B;  4IIJ B;  1OV9 A;  1SZX A;  4X1K B;  4X20 A;  1K73 W;  5EBM C;  1M56 C;  5A2Q N;  2CGN A;  3CRC A;  3H1H H;  5EBW C;  1K4C C;  3W7T A;  1PNL A;  4Q6G A;  4ZOL B;  1VQ4 V;  4JI6 O;  4X8A A;  2OT5 A;  4PI2 A;  2JEX A;  3E86 A;  2HHH B;  5CA0 B;  3TCU A;  2UXC O;  2E74 B;  5CA1 A;  3R66 A;  3TET A;  4LNU B;  2YXY A;  4I7Z B;  2DMX A;  4GT1 A;  1N36 B;  4X9Q A;  4JI2 B;  3WU2 Z;  3BVO A;  2QGN A;  5JCO C;  1LUW A;  3L71 H;  3QVN A;  4U7N A;  3IGA C;  2VWJ A;  1FJG B;  1IUR A;  2N74 A;  2F93 B;  1VQ6 V;  4WBN A;  2KSD A;  3HKE A;  3JAK B;  1Q86 W;  5IDJ A;  4A5U B;  4J7J A;  5LMN O;  1PNM A;  2PYJ A;  4FFB B;  3EHB B;  3CHX A;  1BMF G;  5FNV B;  4XDL A;  2EIN B;  3RN4 A;  2UXB B;  3APQ A;  3C3S A;  3E8G A;  3ZRW B;  2F1M A;  2HR3 A;  4TV8 B;  1CXZ B;  1MAB G;  3K5M A;  1NI8 A;  1N32 B;  2YI8 A;  4KFM A;  4NB5 A;  2OIE A;  4EB6 A;  3OTO B;  2WA4 A;  1VP7 A;  2Z3Y A;  5EZY B;  4JAS A;  5CA3 A;  5EBL C;  2RJZ A;  4FIP C;  4UVA A;  5J2U A;  3KCY A;  2KG7 B;  4LF6 O;  5JWP A;  3T1Y O;  1F4M A;  1SQB H;  2QKS A;  4KHP O;  3J81 N;  1ZSP A;  3L75 H;  2QJ1 A;  3LNN A;  2EIK C;  3SYO A;  3JD1 A;  1OCC B;  2OCH A;  2Q4P A;  4ZI7 A;  3BFR A;  1E1Q G;  2QTO A;  3EXA A;  4UV8 A;  2GDS A;  2E5L O;  4NYK A;  3JCZ A;  1H8E G;  4R8C A;  2ZNJ A;  2DW4 A;  1WLE A;  4E4E A;  3G67 A;  4JI8 O;  3JAW B;  2Z0A A;  2F4V B;  1WB7 A;  1RP3 B;  1RM1 C;  4I0X A;  5DM6 V;  3JAT A;  4JI6 B;  4FM2 A;  3F7Y C;  1Z5V A;  4PA9 A;  4FLZ A;  1HWY A;  3C3T A;  1Y74 A;  4DR3 B;  3ETD A;  4GLX A;  1XNR O;  4W4L A;  2PYL A;  5IYZ A;  3F5T A;  3FAV A;  1U96 A;  4LWS A;  2HKO A;  1RM1 B;  2UXC B;  4KXR A;  4GUN A;  5EYP A;  3JAL A;  3W7X A;  5KUK A;  1H8H G;  1Y4M A;  3QTC A;  3L72 H;  2GBO A;  2YUA A;  2HJF C;  4GKJ B;  1XEQ A;  4P2Z A;  1Y66 A;  5LMU O;  4U7O A;  4NKG B;  4OPA A;  1ZAU A;  3STL C;  4DRX B;  1BHB A;  3SPI A;  5LMN B;  2IU0 A;  1R3L C;  3IC7 A;  4G28 B;  2H3O A;  4NVP A;  3RYF B;  5KHH A;  1D5N A;  3RW0 A;  4TQD A;  1JJO A;  3AG4 C;  3P30 A;  1ORQ C;  4G2K A;  3FD9 A;  2M6Y A;  2YC0 A;  3K57 A;  1CP9 A;  3A2F A;  1AI5 A;  1ZL8 B;  3MAQ A;  2YS8 A;  2QR4 A;  4PD4 F;  1XDC A;  3SYC A;  2CDY A;  4JTD B;  5BR8 O;  4LF6 B;  4OXS A;  3AG2 B;  2UXX A;  5GON B;  3RVZ A;  3H9V A;  4JGS A;  4B7K A;  4TT3 G;  2QWR B;  3OUF A;  3SPG A;  3OMA B;  2B1I A;  2GHY A;  2HVK C;  4DV3 B;  1XI1 A;  1S0V A;  2LO1 A;  2ILM A;  3CRR A;  1BSM A;  1KQS U;  3HPL C;  1RFY A;  2D3O W;  5B1B B;  2BSK A;  4NTY A;  4TWK A;  3AG3 C;  1I0H A;  3N27 A;  2W6I G;  3FB5 C;  2WLL A;  4JI8 B;  2ITD C;  4FLW A;  1N34 O;  3OAA G;  2FTK A;  2JS3 A;  1VQ8 V;  5B1N A;  4CH6 A;  1G1X B;  3AG3 B;  5BMV A;  1GMG A;  4OX9 B;  3SPJ A;  3FB8 C;  2EIJ B;  2ODM A;  3CRA A;  3RYC A;  2CTQ A;  3SJA C;  1I94 O;  3LDE A;  5AG2 A;  2EIM C;  1F4N A;  3LSQ A;  4MTF A;  5KAF Z;  4JZ2 A;  4P9P A;  4DR1 O;  4LR3 A;  4B3M B;  4YIP A;  1Z5W A;  2YSU B;  5LMU B;  4I55 B;  4X66 O;  3DSQ A;  5K1P A;  5LP6 B;  2EIM B;  2YXL A;  1HR0 O;  3B4S A;  2UUC B;  4LF9 O;  1KKC A;  1Q3E A;  1Q81 W;  1VQM V;  1GN6 A;  5IJ0 A;  1ZUQ A;  5B3S C;  4JYA O;  3CCL V;  3E2E A;  5HFM A;  3N2G B;  1OCZ C;  4N21 A;  2JGU A;  4RUE A;  5E79 Z;  3MHH C;  1NTZ H;  2QKA A;  2JIZ G;  4PDM A;  5CB4 A;  4HZ3 A;  5IWA O;  4HYO A;  3VQW A;  1OCZ B;  4I4T A;  2XOK G;  2JDI G;  4J9Z B;  4FZ0 A;  4UCV A;  3ASO C;  4MTO A;  2XAF A;  1ROP A;  4J80 A;  1B3Q A;  1QLE C;  1WNS A;  2IU3 A;  2W6J G;  1SKV A;  1XL4 A;  2L35 A;  4XDK A;  2K1E A;  2DQ0 A;  2XAH A;  3ETE A;  3G6B A;  3OR6 C;  1V55 C;  3M99 B;  1R6T A;  4DUZ O;  4JI5 O;  3CRQ A;  2G38 A;  3GVM A;  3PN1 A;  1VF6 A;  3JSN A;  1TVK B;  2QWN B;  1YVW A;  1W2B U;  5H5N A;  4RO2 A;  2EUL A;  4CS2 A;  4AQY O;  2ZT9 B;  1YDX A;  3ZMU A;  3HKC A;  5L3B A;  1XMO O;  3DGE A;  4J10 A;  4HNA A;  4PA4 A;  3K79 A;  5KMG B;  2YIB D;  3TGU H;  1HNX O;  4QNH B;  4FFK A;  2QM7 A;  4O4I A;  1K5S A;  5EIB C;  1IBK B;  1YJW V;  4NXN O;  2IJH A;  3SYQ A;  4O4L B;  4WF9 V;  4X66 B;  4FVM A;  2LW7 A;  1BQ0 A;  1O9H A;  4LBE C;  1HR0 B;  5FLX N;  4PV1 B;  4LF9 B;  3FFQ A;  5CMU A;  4JYA B;  1QU7 A;  3BA8 A;  3CSX A;  4QPJ A;  5IY5 B;  2DYR B;  4LFB O;  1ZLZ A;  2JEU A;  2QA4 V;  5IWA B;  2YIC A;  2QE7 G;  2GTA A;  2ZE8 A;  3AEI A;  1QQC A;  3E8F A;  1K97 A;  1OCO B;  1K92 A;  2P4K A;  2GSM B;  4FM1 A;  5D5P A;  1A32 A;  5F2V O;  5LL6 Y;  4MT8 A;  3ZS8 C;  2NN4 A;  1AJQ A;  2P67 A;  4QJF B;  3CCJ V;  3WG7 C;  1GRJ A;  3D36 A;  4DUZ B;  3JAS B;  2CH7 A;  4X1K A;  1J5E O;  4JI5 B;  3K0G A;  5TIS Z;  5H9C A;  2CE4 A;  1K8A W;  3CWB H;  1P7B A;  3A0R A;  3CMA V;  5KA6 A;  4RWU A;  1SZT A;  1ZX3 A;  4YHH O;  3ABL C;  2GTS A;  3E35 A;  1Q43 A;  3ETG A;  1QLN A;  1AJN A;  1JPX A;  4HAM A;  4HBN A;  3OGC C;  1ZWI C;  5D5Q A;  3E8H A;  3K04 A;  1JQ0 A;  4PA3 A;  4LNU A;  5IJ9 A;  2Q73 A;  1HNX B;  3W7S A;  2LJ2 A;  3H1K H;  2LGQ A;  4PDV A;  5IT9 N;  3HKD B;  1R3K C;  4FK5 C;  4NXN B;  3X2Q C;  4WFA V;  3NXS A;  2HLD G;  3JD2 A;  1HP8 A;  3T4Z A;  3ZHV A;  4FFB A;  1MMM A;  5FNV A;  3K9A A;  3SDL A;  3JAR B;  4TV8 A;  4GX1 A;  2E3C A;  4EFB A;  3JCU Z;  5LYJ B;  1YF2 A;  2Q69 A;  4GYC B;  1QVF U;  1YXB A;  3SPC A;  3F5W C;  3RYI A;  1R1B A;  4LFB B;  3CXC U;  5C93 A;  2X0L A;  1SQX H;  4I50 B;  1UPG A;  2A79 B;  2KG7 A;  4H44 B;  3CJH B;  1VQK V;  4MS2 A;  1JVM A;  4I9Q A;  2QDO A;  1JJ2 U;  1GM9 A;  4PJ0 Z;  5ITZ B;  2IJJ A;  4TV9 B;  1M57 C;  3CCS V;  3BHP A;  2IJK A;  3OD4 A;  3KKY A;  2QM8 A;  1Q82 W;  4X62 O;  4DYL A;  5DED A;  3S3X A;  4JAA A;  4B3S O;  1YJN V;  4PEL A;  2C2A A;  1S76 D;  5KHG A;  4UCS A;  1M57 B;  5HFL A;  4X89 A;  2ATK C;  4FLX A;  3JAW A;  1ENV A;  3VQV A;  1M56 B;  3L73 H;  2Y48 A;  1GTO A;  1YCI A;  3K5O A;  1HDJ A;  4DV6 O;  4CH5 A;  3JD4 A;  1WAZ A;  2IW5 A;  1G8M A;  4FLT A;  4LCU C;  1YTF B;  3ZHT A;  3H1J H;  1JFF B;  3CXH F;  2QWQ B;  4GX2 A;  4RAI A;  4AI8 A;  1GM8 A;  3QF7 A;  2YEV B;  2ZCE A;  2FKX A;  2Z5U A;  2ZIM A;  1PD3 A;  1TUB B;  4ABM A;  4ZKI A;  1WP7 A;  3I5D A;  4JTA B;  4BR6 A;  4DV5 O;  2OCC C;  3B77 A;  4K8X A;  1QHT A;  3O65 A;  5CBH A;  2V1D A;  4LFC B;  1W59 A;  5KX5 B;  5GTH Z;  1U97 A;  2EJR A;  4U3J B;  4J41 A;  1AR1 B;  2OCC B;  4UCT A;  3SJB C;  1AR4 A;  1P49 A;  4J7K A;  1F51 A;  3L70 H;  1SA0 B;  1FXV A;  2PF4 E;  4CZZ A;  1SQG A;  3OMI B;  5H6R A;  3RYF A;  1KKD A;  3Q4H B;  4Q20 A;  3LDD A;  1GN2 A;  3ZIA G;  1XHX A;  4IYH A;  4OGQ B;  3RYH B;  1PPJ H;  4MVZ A;  5B66 Z;  4PI0 A;  3CCR V;  4B3R B;  4GKK O;  4E2L A;  1GM7 A;  2HVJ C;  2PGG A;  1JA8 A;  4TUY B;  1ZL8 A;  1OCR C;  1IVS A;  4H37 A;  1EN4 A;  1TA8 A;  2MK3 A;  4YJ2 B;  3ZN0 A;  4DR2 O;  1TGO A;  2IBZ H;  2VQF O;  2YIB A;  3AG1 C;  1Q8I A;  4DR7 O;  3F7V C;  5GON A;  3T1C A;  1Q7Y W;  3UT5 B;  4JI4 O;  2P22 C;  3LSU A;  4LFA O;  1RPO A;  1F23 A;  4X1Y B;  1YIT V;  4UVB A;  2EIK B;  3OW2 U;  3DC6 A;  1R6K A;  3K58 A;  3ZED A;  2JGD A;  4B3S B;  2JRI A;  1BT8 A;  1PM9 A;  1Z2G A;  1HNZ O;  3HB3 B;  4X20 B;  1H2L A;  1W0K G;  3U10 A;  5L3C A;  1K33 A;  1BL8 A;  1NQT A;  5IYD O;  1H2M A;  1Q6I A;  1FKA O;  1X4T A;  3KCX A;  3ZX6 A;  1SS3 A;  2X6B A;  2EX3 A;  5CA1 B;  4O2B A;  2QKC A;  4DV7 O;  1GH6 A;  4DO2 A;  4O4H B;  4UB8 Z;  3DC5 A;  4LF4 O;  4JTC B;  2P06 A;  3S3W A;  2ZIN A;  4WBN B;  3UKM A;  3HKE B;  4WFH A;  4B3T O;  3T2M A;  4K8Z A;  3VOU A;  4DR4 O;  5LP6 A;  3E8B A;  4LF5 O;  5FL7 G;  3AK1 A;  1OJH A;  2QTS A;  1BCC H;  2Q67 A;  1K7D A;  1L0N H;  1FXK A;  1VMG A;  4YY3 O;  1S5J A;  3I55 V;  2LGW A;  1K9M W;  2JS5 A;  1MZF A;  1TAE A;  3AG4 B;  4GKK B;  1YTF D;  5J2T B;  5DN6 G;  4Z1M G;  3BAB A;  3T1Y B;  4W4K A;  4KHP B;  3P32 A;  1FD9 A;  1Q90 D;  1L8D A;  2UU9 O;  4U3F H;  5A9G A;  3C90 A;  5J2U B;  4DR2 B;  2IH3 C;  2VQF B;  2ZE6 A;  4FMT A;  3ZHU A;  3CPW U;  1XIL A;  1M1K W;  1N33 O;  4KL1 A;  1IBL O;  1DTO A;  2WLI B;  4DV2 O;  2ZR3 A;  2H8P C;  3STZ C;  4JI4 B;  4LFA B;  2E5L B;  1PKX A;  1KP3 A;  3ZBH A;  1S72 V;  1DF4 A;  1XMQ O;  1DF5 A;  1NTM H;  2HG5 C;  5KAI Z;  2WLK A;  1G4Y B;  1VEW A;  3CP1 A;  1HNZ B;  4G27 B;  2BOB C;  2EZO A;  4TSF G;  4MTX A;  1XNR B;  4I0X B;  5E1A C;  2Q8V A;  1I7F A;  3HKB A;  3ABK C;  2ZE5 A;  1MNG A;  3K5N A;  1Y74 B;  3L74 H;  3CB2 A;  4MVM A;  2DQ3 A;  1BHA A;  1S77 D;  5C8Y B;  5KMG A;  2LQT A;  4JYY A;  4DW0 A;  3MDS A;  4AIL C;  3SYP A;  4DV7 B;  1JMK C;  5CN0 A;  3B8M A;  2JJ2 G;  5EC2 C;  4JPR A;  2E75 B;  4NTW A;  4CS3 A;  4K0K O;  4I5S A;  4X65 O;  1VQ7 V;  4DR4 B;  4LF5 B;  1VF5 B;  1N8R W;  3P3P A;  2LP7 A;  3K5L A;  4ASU G;  1R3J C;  5GW7 A;  3BAA A;  4UCO A;  4YY3 B;  3SR2 C;  1AJP A;  5B3S B;  1GN3 A;  1NT2 B;  2DYS C;  1LR1 A;  3T1H O;  5BR8 B;  3B8N A;  2L6L A;  4YJ3 B;  4UCU A;  4O4J B;  2QM4 A;  1NVP B;  2QEX V;  3QO5 A;  3OUS A;  3SYA A;  2A06 H;  1N33 B;  2DYS B;  3OTF A;  2XT9 A;  2YI9 A;  1IBL B;  4DV2 B;  3IC9 A;  3ASO B;  2WPD G;  1XHZ A;  1XUQ A;  2BTO A;  2Q7H A;  5EK0 A;  3UO2 A;  4DK0 A;  4BWA A;  4MVS A;  1QLE B;  2GUZ A;  1EBO A;  1GN4 A;  3ZHR A;  1K5Q A;  1XMQ B;  4K3A A;  3FYE B;  2AGA A;  2Y4U A;  2P90 A;  3CCU V;  1N34 B;  1V55 B;  2BSK B;  3RBZ A;  1UFI A;  3ZRX A;  3OGI B;  3TJT A;  2AZ2 A;  1X59 A;  2LFS A;  2WLL B;  2WLJ A;  3QNE A;  3RGB A;  4X1I A;  1VQP V;  5JH7 B;  2HJD A;  2LW1 A;  4F6R B;  3JD0 A;  1SQQ H;  4PDR A;  4ZHQ B;  1H2N A;  2Y4T A;  1I94 B;  4NXM O;  5BZB A;  1HNW O;  3OT7 A;  3RYC B;  1IXB A;  3MD0 A;  4PHZ A;  2Q0O C;  3CCQ V;  4DR1 B;  2XAJ A;  4MSW C;  2PUS A;  5BY1 A;  1MA1 A;  4DV0 O;  1VQO V;  1VF7 A;  3PJS K;  2XAS A;  3HKD A;  4IHJ B;  1H2S B;  2RNB A;  3EVK A;  1FAF A;  3CS5 A;  3W7W A;  1OZ0 A;  4JF3 A;  1US6 A;  2PY5 A;  4K0K B;  1FXH A;  1BE3 H;  2VS0 A;  1IXM A;  2WAM A;  4GX0 A;  5B1O A;  4O2A B;  4WFF A;  1IX9 A;  3KZI Z;  4J9Y B;  5KLV H;  1AP5 A;  1W0J G;  1AI4 A;  2QWP B;  3KG2 A;  4TQF A;  4MVO A;  3G6E V;  3ZCC A;  4FZ1 A;  1AI6 A;  1PP9 H;  2O57 A;  2ZXW C;  3N2K A;  4IT5 A;  1SES A;  3ETQ A;  5L3F A;  3ZRS A;  5BXZ A;  1Q5O A;  5LYJ A;  3BPZ A;  3SGI A;  4IYI A;  2HP8 A;  1P84 F;  1Q6H A;  1V54 C;  3T1H B;  1MG1 A;  5CB4 B;  2V4D A;  3THO A;  1K3E A;  4I50 A;  3J7A U;  1KYO F;  4X64 O;  2Q0A A;  1QBZ A;  1Y76 B;  3CJH A;  1WA8 A;  4MW8 A;  4R6Z A;  5KUM A;  1V54 B;  3BY6 A;  5ITZ A;  1IBM O;  4TV9 A;  2Q5Z A;  3JSL A;  3SJC C;  4XDJ A;  4IIJ A;  1VF6 C;  4H33 A;  4CS4 A;  1SF9 A;  4ZOL A;  2HEP A;  3FB6 C;  2VQE O;  4UV9 A;  1DLB A;  2R9R B;  3GWK C;  3ABT A;  1ARO P;  3WG7 B;  3A0H Z;  4AQY B;  1G6U A;  1XMO B;  3G71 V;  2Q7G A;  2F43 G;  3FB7 C;  5CA0 A;  2FB5 A;  2B5U A;  4YIO A;  2QSA A;  4EFE A;  2OYQ A;  3JD3 A;  2HHH O;  4HNA B;  4JI7 O;  3CCE V;  3ABL B;  3U0Z A;  1NVP D;  1BS3 A;  2QWO B;  1SER A;  4FJC C;  1D2D A;  1TUB A;  1GKF A;  5LOV B;  1KC8 W;  2R72 A;  4O4I B;  1NKD A;  2WLN A;  2UXN A;  4NTX A;  3JAK A;  1FJG O;  2Y0P A;  1Q6U A;  5JCO A;  4KUM A;  3ZHQ A;  1DGS A;  4UXN A;  3OEH G;  3X2Q B;  5KX5 A;  5JQG B;  4U3J A;  3ZRW A;  2V7Q G;  3H1L H;  4JI3 O;  5CBG A;  2M7W A;  3UQ8 A;  1RSO B;  1K4D C;  3ZN1 A;  4QE7 A;  1N32 O;  3RYH A;  5LGT A;  5LGU A;  4MVU A;  3B09 A;  5EZY A;  3OTO O;  2XUM A;  4TUY A;  4BW9 A;  3J80 N;  1WP8 A;  5K1X A;  3T4D A;  2MW2 B;  5LXT B;  1QR9 A;  1KD1 W;  1XQ8 A;  2P5O A;  1Y6X A;  1YSC A;  1N4C A;  2A7W A;  4UCR A;  5LHG A;  4JV5 O;  1H2G A;  2XAQ A;  5L3G A;  1URF A;  2JJ1 G;  3K08 A;  3ABU A;  3UT5 A;  4MVQ A;  2EIL C;  4DUY O;  4AHC A;  5EIB D;  3D36 C;  3TXQ A;  1CEZ A;  4X1Y A;  1PNK A;  3GWO A;  1NU1 H;  3E22 B;  4QIW F;  1J5E B;  2AHY A;  3DXR B;  1THZ A;  1H38 A;  3EFF K;  1XL6 A;  3ML0 A;  3ZJZ A;  2UXD O;  1MOF A;  2CH7 B;  2F4V O;  2BTQ B;  1FFX B;  5LBQ A;  2WA3 A;  4YHH B;  2CTW A;  2E76 B;  4KP4 A;  2CTR A;  2IH1 C;  2YXH A;  4DR3 O;  1WPX A;  4N23 A;  1AP6 A;  2A3Q A;  1UJW B;  2R9I A;  4BW5 A;  4TOI A;  1EN6 A;  1AI7 A;  2RMK B;  2OWO A;  3CYO A;  4R7C A;  4JI7 B;  4LC1 A;  4QGP A;  4B7E A;  5IJ9 B;  3SPH A;  3BA9 A;  2PTM A;  4O4H A;  4DRX A;  1S3J A;  4GKJ O;  1GAX A;  4UB6 Z;  5JVD B;  4JAV A;  4ZIB A;  1SQV H;  2EIN C;  3IFX A;  3CC4 V;  3QG5 A;  5FPO A;  3AG7 A;  3RWR D;  3W7U A;  4PA7 A;  2EZP A;  3OR7 C;  4JI3 B;  2CGO A;  5L3E A;  4BIU A;  4WFE A;  3RFR A;  1M90 W;  4D7S A;  2H94 A;  1NZ6 A;  4EKW A;  1R3I C;  1QCE A;  4JAU A;  3WFV A;  2EJ7 A;  4Z2W A;  2IJI A;  5J2T A;  2CTP A;  3RYI B;  4NR1 A;  5LA6 B;  3ICX A;  4DR6 O;  1I5X A;  1OCR B;  2YID A;  4DR5 O;  1OCC C;  1KBH A;  3CX5 F;  2JVD A;  3K9S A;  3CE2 A;  4JV5 B;  3AG1 B;  2R9A A;  3K59 A;  2WLI A;  2XAG A;  4J7Z A;  1EM1 A;  4X62 B;  3D8C A;  5FPR A;  4DUY B;  5LGN A;  2BE3 A;  4ZBM A;  5KA5 A;  2Y69 C;  5DEC A;  2AZ0 A;  4DV3 O;  3FYI B;  4CC5 A;  2ADQ B;  4H0L B;  1KP2 A;  4FPP A;  4LH6 A;  2ZDI A;  4UFZ A;  3RT3 C;  5H6Q A;  1AIL A;  1H2K A;  2DWE C;  2UXD B;  2Y69 B;  4JYB A;  4DV6 B;  3G80 A;  3NR7 A;  4UVC A;  3ZMT A;  4I9W A;  2HFE C;  4C7U A;  4JI0 O;  1YIJ V;  4OX9 O;  2RN9 A;  4DV5 B;  3ZMS A;  5C8Y A;  4K35 A;  2ZD9 A;  1T5E A;  4I55 A;  1SQP H;  4WFB V;  1B04 A;  4H13 B;  3AK2 A;  1M93 A;  5B5E Z;  4D6T H;  1S5H C;  2KKW A;  5JJJ B;  4B3M O;  1M9N A;  4LF8 O;  3CEI A;  1KU9 A;  2UUC O;  2X7R B;  3CME V;  3VQX A;  4DV1 O;  3LNM B;  3N2G A;  1FFT B;  3K0D A;  2VRZ A;  4EB6 B;  1N0N A;  1PV0 A;  5IYC O;  4B08 A;  4MVR A;  1WPB A;  2ADP A;  3JAM N;  3TXS A;  1B6Q A;  1EZV H;  1AVM A;  2DN9 A;  3AK3 A;  3AG2 C;  4DV4 O;  3BCC H;  1WN7 A;  3QO8 A;  3MHS C;  2OTJ V;  5IE9 A;  4DR7 B;  3BEH A;  2FYU H;  2UUB O;  4YJ3 A;  4DR6 B;  4DR5 B;  4O4J A;  1YHQ V;  2PI4 A;  1KEC A;  1XNQ O;  2P4V A;  5KHI A;  2F23 A;  4ZI7 B;  1NTK H;  1TUE B;  1S5L Z;  2F66 C;  4MW3 A;  4GZR B;  3OEE G;  5B1B C;  3WB2 A;  4MTG A;  1QVG U;  2NR5 A;  2ZDI C;  2LFR A;  4QPK A;  1XBL A;  4DW1 A;  1WJZ A;  3IAY A;  1GK9 A;  2JGD B;  4EEQ A;  2CK3 G;  3JAT B;  1TVK A;  4CBC A;  5KHK A;  5LHI A;  4BAY A;  1EZJ A;  2Q68 A;  3U11 A;  5IYZ B;  3DTU B;  5JJE B;  3FAV B;  2EIJ C;  2IM9 A;  4LWS B;  2A0L A;  5JH7 A;  2Q9L A;  5L3D A;  2JK5 C;  3JYC A;  1BZK A;  1E1R G;  4F6R A;  4ZHQ A;  3ABK B;  1VIB A;  1IZ3 A;  1EFR G;  5EYP B;  3JAL B;  4JI0 B;  1YEW A;  1K34 A;  1NR7 A;  4O2B B;  1YZB A;  2K9P A;  1VAR A;  1WB8 A;  4LF4 B;  4YXW G;  5CBF A;  4O4L A;  5LP6 C;  3D3I A;  2RQ6 A;  4FM0 A;  2AHZ A;  4B3T B;  1IBK O;  4IHJ A;  3WB1 A;  1FXK C;  1L1F A;  2WLH A;  2OIG A;  1JR9 A;  1NR1 A;  2BOC C;  3VQY A;  2GV9 A;  1YJ9 V;  2RDC A;  1OHH G;  1F7Y A;  4LF8 B;  4BIZ A;  1QNM A;  3IJ4 A;  4DV1 B;  1SRY A;  4O2A A;  1FXK B;  3A0B Z;  3RVY A;  2Q6A A;  2N04 A;  1R6N A;  1RPR A;  4DK1 A;  4JZG A;  1JX9 A;  4JYC A;  3SJQ C;  4BIO A;  5KHJ A;  2UU9 B;  3BRC A;  4DV4 B;  1BQZ A;  1ZTE A;  1SQF A;  1LUV A;  2B1G A;  2UUB B;  4WFG A;  3ZRV A;  1V9P A;  3TK1 A;  1XNQ B;  4F4L A;  1Y76 A;  2ETN A;  3FX7 A;  4JI1 O;  4Z1V A;  1M4U A;  2BCC H;  2A9H A;  3JAS A;  4PDL A;  2R70 A;  2OTL V;  4RUF A;  2N05 A;  1AB3 A;  1MZE A;  2RCV A;  2ZQM A;  2ZKO A;  1XOU A;  3FKS G;  4RQF A;  4F6E A;  1VQ5 V;  5B1A C;  2NLJ C;  5BMV B;  3HKB B;  4DXW A;  1R73 A;  2XTA A;  1NBM G;  3CRM A; 
#chains in the Genus database with same CATH homology
 1A32 A;  4DR2 O;  2VQF O;  4B3M O;  1R6T A;  1N36 O;  5LL6 Y;  4DR7 O;  4JI3 O;  1KUQ A;  4DUZ O;  4JI2 O;  3T1H O;  1N34 O;  1IBK O;  2UU9 O;  3M8A A;  4JI5 O;  1XNR O;  3R66 A;  2UXC O;  3F5T A;  4JI4 O;  5BXZ A;  4LFA O;  1N33 O;  4LF8 O;  4X62 O;  1N32 O;  1IBL O;  2DJV A;  4DV2 O;  1J5E O;  2UUC O;  4B3S O;  1G1X B;  5H5N A;  3OTO O;  4DV1 O;  3J80 N;  1F7Y A;  4AQY O;  3J7A U;  4X64 O;  2N74 A;  1XMO O;  1FYJ A;  2JRI A;  3JAM N;  1XMQ O;  1I94 O;  4LFC O;  1XEQ A;  1HNZ O;  4YHH O;  5LMU O;  2UXB O;  4A5U B;  2UUA O;  4DV6 O;  4OPA A;  5LMN O;  4DR6 O;  4JV5 O;  4LF7 O;  4DV4 O;  4DR5 O;  1HNX O;  4DR1 O;  1IBM O;  2ZM6 O;  2AGA A;  4DUY O;  4X66 O;  2UUB O;  1FKA O;  4NXN O;  1X59 A;  2FKX A;  1XNQ O;  2VQE O;  1HR0 O;  5IT9 N;  4LF9 O;  4B3R O;  2LW7 A;  1DK1 A;  4DV5 O;  4DV3 O;  2UXD O;  3O65 A;  5FLX N;  4JYA O;  1NS1 A;  4DV7 O;  3RT3 C;  2F4V O;  4OPH A;  1AIL A;  4NXM O;  4JI1 O;  4LF4 O;  4LF6 O;  1HNW O;  3T1Y O;  4KHP O;  2HHH O;  2DOS A;  3J81 N;  4JI7 O;  4DR3 O;  3SDL A;  4B3T O;  5BY1 A;  5BR8 O;  4DR4 O;  4DV0 O;  1AB3 A;  5IWA O;  4LF5 O;  1D2D A;  4K0K O;  2ZKO A;  4LFB O;  4X65 O;  4JI0 O;  4YY3 O;  2E5L O;  4OX9 O;  1R1B A;  5A2Q N;  4GKK O;  1FJG O;  4JI6 O;  4GKJ O;  4JI8 O;  2Z0A A;  1YZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...