2FKXA

Ribosomal protein s15 from thermus thermophilus, nmr recalculated structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Conformational Landscape of the Ribosomal Protein S15 and Its Influence on the Protein Interaction with 16S RNA.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural protein
molecule keywords 30S ribosomal protein S15
total genus 26
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2fkxA00
2AGAA 1XEQA 2UU9O 1AB3A 4DUZO 5BR8O 2E5LO 4B3SO 4K0KO 4LF9O 4DR7O 4DV1O 1N32O 4LF5O 2UXDO 1N33O 2JRIA 3O65A 4DV4O 4OX9O 4DV2O 4LF7O 4DV6O 4B3MO 1NS1A 2UUCO 4LF4O 1R6TA 1F7YA 4DUYO 5BXZA 1FJGO 1DK1A 4DV5O 5LMNO 5IWAO 2FKXA 4DR6O 4X66O 1D2DA 1HR0O 1XNQO 3SDLA 3F5TA 4DV7O 4JI5O 4B3RO 1HNZO 4YHHO 4DV3O 2UUBO 3R66A 4OPHA 1N34O 4X62O 3RT3C 4AQYO 1IBMO 1AILA 5LL6Y 1A32A 2UUAO 4DR5O 4X64O 2VQEO 1XMOO 4LF6O 4LFBO 1YZBA 5BY1A 1HNXO 4A5UB 3T1HO 1N36O 4JI6O 4JI2O 4DR3O 4LF8O 1J5EO 1XMQO 4JI7O 3J7AU 4JV5O 4OPAA 2DOSA 5FLXN 1FKAO 5IT9N 4B3TO 2UXBO 2VQFO 3T1YO 4JI8O 2F4VO 3J80N 2HHHO 4JI4O 2ZKOA 1G1XB 4DV0O 4JI3O 1XNRO 2N74A 4YY3O 3J81N 2UXCO 4DR1O 4KHPO 4GKJO 4GKKO 1IBLO 4LFCO 4LFAO 1KUQA 2ZM6O 4DR4O 1IBKO 1FYJA 2Z0AA 1HNWO 3M8AA 4X65O 4DR2O 4NXMO 3OTOO 4NXNO 5H5NA 1R1BA 2LW7A 4JI1O 4JI0O 5A2QN 1I94O 2DJVA 3JAMN 5LMUO 1X59A 4JYAO
chains in the Genus database with same CATH superfamily
4YY3B 4FLZA 1XNRB 3AG7A 4FPPA 3AG1C 3CJHB 4P30A 1WB7A 4I7ZB 4XDKA 1Q8IA 2Q0AA 4MVQA 1V54C 1IBKB 2G38A 3TXSA 5L3BA 2ZDIA 4F4LA 1F7YA 2B1IA 4K3AA 1VF5B 4G28B 5BZBA 2QEXV 3ABMB 3W7UA 5IWAO 1WP7A 2UXXA 2K9PA 4R50A 3DC6A 2F93B 2E75B 4B3RO 3AG1B 2A0LA 4MSWC 3CYOA 4X62O 3K3WA 3JAKB 1Y74A 4GX0A 3X2QB 2N04A 2XAGA 3KCYA 3JYCA 1VQ9V 1NR7A 4WBNB 2QWQB 3SPCA 4TOIA 4PJ0Z 2FYUH 5IYBO 4WFBV 4QGPA 3FKSG 1K33A 2DOSA 2PUSA 3VQVA 4B3TO 3OMNB 1BT8A 2VQFO 1R73A 3BRCA 4HAMA 5D5PA 5FNVB 5LXTA 3E2EA 1YCIA 1GK9A 2HR3A 2JVDA 4GKJO 1VF6C 3ZHTA 4DR4O 1Q81W 3JALA 1HNWO 4JV5B 1VF6A 1K34A 3ZRXA 1K97A 1PPJH 3LNMB 2LW1A 3GVMA 3BCCH 3FB6C 4J11A 4O4IA 4LWSA 4UV8A 5DN6G 5CN0A 3N2GB 2UU9O 3FB8C 3D36C 1ZTEA 4QPKA 2V1DA 5LGTA 3H1LH 4TV8B 2OWOA 1ZUQA 4LF7O 2OIEA 4FLYA 1OCCB 3GWOA 2LGQA 3RVZA 4U3FH 4DW1A 3G67A 2Q68A 4DV5O 2DYSB 1URFA 1S72V 1MZEA 1K3EA 1E1QG 1ZL8B 3K0DA 3OE7G 3R66A 3ZEDA 2KB1A 3VQWA 3HKBB 1BS3A 4G27B 2E74B 4LFBO 5LA6B 1FJGB 4ICGA 1KU9A 1M56B 2H3OA 4LF8O 1J5EO 5EK0A 1VQNV 1Q90D 1FKAO 3P30A 3HKEB 3WB0A 3A0BZ 2CTRA 3BFRA 3H1KH 3T4ZA 1YIJV 3OMAB 1AJNA 3OGIB 2ZNIA 3HKDA 1VEWA 4DR7B 2EILB 1AI7A 4MTFA 1SQVH 3TGUH 2RMKB 3SR2C 2LGWA 3IGAC 3K06A 1EBOA 4TWKA 4MT8A 2YXHA 5J9PC 2LP7A 1KB9F 3E22A 2IW5A 1FXKB 5LOVA 3ZS8C 2FL4A 2QDOA 5J2UB 1AR1B 4GKJB 2XTAA 3K58A 2X0LA 4NTXA 1NKDA 2WA3A 5KX5A 3I56V 2R70A 4DV6O 1P7GA 1J95A 1Z5VA 1TGOA 1N8RW 3RGBA 3JAWA 3OFNG 5GW7A 3OD4A 2IU3A 1H2SB 1EFRG 2X6BA 4IIJA 4YHHO 5EBMC 3D8CA 4P9PA 1N34O 3KKYA 4JTCB 5LP6A 3K5OA 3BEHA 1A32A 2YI8A 3ZRWB 4PA3A 1VP7A 1SQFA 2QTSA 3WU2Z 2V7QG 1S5LZ 2W0FC 1N36O 1R3IC 1VQPV 4JI2O 1U97A 1GM7A 1X4TA 1G8MA 3ICXA 2RNBA 2ZE5A 2Q4PA 2UXNA 1FFXA 1D5AA 1SA0B 1MSWD 4MVUA 2PY5A 3S3WA 3NXSA 5D5QA 2Q0OC 1LNQA 2GV9A 4J7JA 2GBOA 2M6YA 3SYOA 3ZBHA 4OXSA 1SA0A 3QF7A 4DV7B 5BR8B 1OCOC 2Q67A 4D6TH 3DXRA 1AROP 4LF5B 1Q5OA 4ZHQA 1VQ4V 1YEWA 2PTMA 5IYCO 4GX5A 1XQ8A 5CA1A 1FXHA 1GN6A 5H6QA 4FIPC 3CRCA 2IJJA 2P22C 4LWSB 2PGGA 1D5NA 1CEZA 3ZRWA 1HNZB 2F23A 2JK5C 4MTOA 5GTIZ 2EX3A 2PZSA 1OCOB 1AVMA 3FD9A 4JI8B 4FFBA 4I50B 1R6TA 5TISZ 5IJ0A 4I5SA 4TT3G 2PI4A 1JX9A 1NVPD 3QO5A 1XOUA 4D7SA 1ZWIC 5JCOA 1XNQO 1OJHA 1IBLB 3QNEA 2ZE8A 4FJCC 3G6BA 3ZMTA 2M7WA 2CE4A 3OUSA 2HHHB 4P9OA 1Y4MA 1WLEA 1NBMG 1K92A 2IH3C 3G6EV 3AK2A 3FAVA 3BA9A 1NTZH 4N21A 4OGQB 2DWDC 3DSQA 4Z1VA 2AW9A 3KCXA 1NVPB 4DR2B 3CMAV 2RJZA 1UFIA 1AR5A 1S3JA 2B9ZA 3CXHF 4DV5B 4PELA 1XNRO 4H44B 1WA8A 5EC1C 1CPYA 1N36B 5KA6A 3E8BA 4JI6B 4CH4A 1XHZA 4B7KA 4LFAO 1H2LA 1IBKO 2IBZH 3P3NA 2HEPA 1LR1A 2P06A 1MNGA 3E83A 5KHIA 2UUBB 2AHYA 3K08A 3OTOO 4YJ3B 1KD1W 3CCVV 4UCTA 1LUVA 3OGCC 3EXAA 1KKDA 3O9OA 5LMUO 3D3IA 5LMNB 1XEQA 5CA0B 1JCHA 4O4JB 1AP5A 4B3RB 3ETDA 3IC7A 1RM1C 5BR8O 4X1KB 3JD0A 3U11A 1AI6A 5EZYA 4LF5O 1YSCA 4CC6A 4DV4O 2ZNJA 2LO1A 4O4LA 1SQXH 1RPOA 4I4TB 4QNHB 1Y6XA 1YJWV 4QE7A 4JYYA 3CRAA 5HFMA 3ABUA 1HP8A 5EIBD 1V54B 3CCMV 4PI2A 4YIOA 1Q6UA 4OPHA 4IT5A 1XMOB 2GDSA 2YDEA 3P3PA 1OZ0A 4O2BB 3UO2A 2VQEO 4WFEA 5C93A 3MAQA 2XAHA 5IDJA 4RQFA 1XL6A 5CBFA 1OCRC 3K9SA 1S0VA 5EZYB 1K73W 3ZHSA 1Y76A 3OTFA 2PF4E 3JATA 2EINC 1YJ9V 3W7XA 4BWAA 2X6CA 2LFRA 4PA9A 3AEIA 1GM9A 4BIOA 1JMKC 1G1XB 1F23A 2CDYA 4MVSA 1JR9A 4PA7A 1L0NH 5KA5A 3QG5A 1XHXA 4I0XB 1I7FA 5EYPB 2YS8A 4UUJC 4LCUC 3JASB 3PJSK 4OX9B 4J7ZA 1AJQA 4RAIA 2GTAA 5LGUA 1WA8B 4DR2O 4B7EA 2BSKA 4JPRA 2DWEC 3ZCCA 2Q7HA 4R8CA 2EULA 2VQFB 3JAMN 1B06A 1N0NA 4NTWA 4HNAB 4BIUA 4KXRA 3DTUB 4JF3A 1AI4A 3AG3C 2MK3A 2GHYA 2JDIG 3APQA 5K1XA 4G2KA 2VWJA 2ILMA 3ZX6A 4FMTA 1JFFB 5KAIZ 4F6RA 4AI8A 5JJJB 3WG7C 4TV9A 4B3MO 2YICA 4ZI7B 4XBFA 4X66B 1FJGO 4DV6B 1DK1A 1WB8A 1KMIZ 3ASNB 3K03A 2OCCC 1XMQB 4JI7B 3T4DA 2BCCH 4JI5O 2BTOA 3W7SA 1NR1A 4O2AB 4DV4B 3ASOB 3MD0A 5LL6Y 3RYFA 4YHHB 2EZPA 4LF4B 2BE3A 4E4EA 2FB5A 3OEEG 1ENVA 1F4MA 4ZKIA 3B40A 3CB2A 4DUZB 2E5LB 1VARA 4PDRA 1F4NA 3OEHG 5KAFZ 4UCOA 5KLVH 1SZTA 1SQPH 2P4VA 1JFFA 5IT9N 5B1AB 4IHJA 4UCVA 1BQZA 4WCEV 3G4SV 1R3KC 2R72A 3I5DA 2IU0A 5CA1B 5JVDA 2RQ6A 2K1EA 1QLNA 1JOYA 1G4YB 1E79G 1VF7A 1SC5B 1B6QA 1P49A 2ZT9B 3D3QA 4DR4B 3E35A 1IX9A 2IJHA 3STZC 4GX2A 4L8JA 1PL4A 2DYSC 2FMLA 3BHPA 1N4CA 1IBMB 4X65O 2WLKA 3SYPA 1SRYA 4NXNO 5B3SC 1PKXA 1K9MW 2P7TC 4CC5A 1M5IA 4I0XA 4ZOLA 5DEDA 2ETNA 2WLJA 1X59A 4GLXA 5L3DA 1RSOB 2DYRC 1KP2A 2A79B 1KC8W 4UV9A 4F6EA 1S5HC 5EIBC 3BAAA 1N32O 1AI5A 2ZIMA 3B8NA 2A9HA 1TVKB 4NB5A 2JGUA 4U3JA 2EZOA 1RM1B 1U96A 2A3QA 5B3SB 2NNUA 2DE0X 5GONB 3F7VC 2L35A 1HWYA 3FYIB 4JI2B 2AZ2A 3CCJV 2QWRB 4ABMA 2UUBO 2OIGA 5FNVA 3H1JH 4LFBB 1WAZA 2W0XA 4JTDB 1G6UA 2O57A 2DQ0A 4DR1B 1B04A 3RN4A 3SYAA 3T1HO 3IAYA 3MHHC 1S5JA 3RW0A 3ZN0A 3LNNA 2QA4V 4GYCB 3L71H 3ABKC 4H0LB 3LSSA 3UT5B 1OCRB 1BCCH 1BHAA 4KL1A 5KHJA 4YJ3A 3CCUV 1GM8A 4MVZA 4YY3O 2WA4A 3OUFA 3LSQA 1VMGA 3FFQA 2XAFA 1GTOA 2QKAA 1IDSA 1KP3A 4EB6B 3JAWB 5JJEB 4DW0A 3E89A 1R1BA 4JI0O 3E86A 4J10A 4J9ZB 5KX5B 4QIWF 4DV0B 5JVDB 1AB3A 4UCUA 4BW5A 2YC0A 5L3GA 4IHJB 1H2MA 4LBEC 4TSFG 2OYQA 5CA3A 3AG4C 5LA6A 1FS0G 4X62B 2JRIA 2HJDA 4CH5A 4MVOA 4NYKA 4JYBA 3N2KB 4DUYO 4X89A 1I5XA 1YXBA 1YVWA 1QCEA 4U7OA 4B08A 1ZL8A 3ETGA 2XHBA 2FTKA 4ZIBA 3OMIB 5B1NA 5JH7B 1HNZO 5A9GA 3FB5C 2RDCA 1M56C 4FLXA 4FM0A 3JASA 3ASNC 2UUAO 1SQBH 1XMOO 1MOFA 3M99B 4XDLA 1VQ8V 1NH2D 4C7UA 5BMVA 4PDVA 2JGDB 3ZMVA 3E8HA 1FXVA 2Q9LA 4IYHA 3RFRA 4DR3O 1QLEB 3ETEA 2UXDB 4F6RB 2Y48A 5JQGA 3ZRVA 3UQ8A 2P67A 2F4VO 3B8MA 3ZHUA 3K5LA 2Y0IA 3K79A 4JI4O 5LGNA 4MS2A 2Z3YA 4TQDA 4JAVA 3SPIA 4MVMA 1OCCC 1QNMA 3JCZA 2Y69B 4KP4A 3LDDA 4JI5B 1GN3A 2HVJC 1KECA 1KUQA 3CMEV 3VQXA 3T2MA 3CXCU 5A2QN 1XI1A 2DJVA 5CB4B 5IJ9A 2EIKB 1FFXB 4K8XA 1EN4A 3L72H 5ITZB 1JPXA 2JJ1G 2ITDC 3CRMA 3WB1A 3CWBH 1SF9A 4IGGA 1FFTB 4CZZA 1TVKA 2CTQA 1YITV 4LF9O 1K4DC 1MMMA 3ABTA 3O65A 3TJTA 4X64B 3LDEA 3H9VA 1Y76B 4FZ1A 3CX5F 3OTOB 2XUMA 1NTKH 5FPRA 2XASA 5CA0A 2CH7A 2FKXA 4IIJB 4X66O 2GSMB 1D2DA 5KHGA 2HLDG 2KG7B 2YEVB 1IVSA 2B5UA 4DV7O 1PP9H 2YXLA 3SYCA 1EZJA 3D36A 1N33B 3RT3C 2R9AA 4MVRA 4LR3A 1TAEA 4BAYA 1I94B 1S76D 5KMGA 1PNMA 1YTFB 2BTQB 1PNKA 5IY5B 1QU7A 2L6LA 2QM4A 4FK5C 1YJNV 1VQOV 5LYJA 4Q6GA 3J7AU 1NZ6A 4PA4A 4QPJA 4X8AA 3JD3A 4HYOA 4JI8O 2LQTA 2UUAB 2VRZA 1V9PA 1XILA 1K5QA 4FZ0A 1SZXA 1IZ3A 1QR9A 3J81N 4LFCB 3K0GA 2JJ2G 1P4RA 4K0KB 1IBLO 2ZM6O 1ZX3A 5J2TA 2CK3G 1NH2B 2BTQA 2ADPA 2GTSA 4J41A 5LMUB 1LUWA 4WFGA 2LW7A 1MZFA 4JI1O 5CBHA 3BY6A 4EFEA 3SPJA 1YHQV 4JYAO 3CC2V 3THOA 1M4UA 4J7KA 5JH7A 2Y4TA 3AG2C 3UO3A 2XT9A 1PD3A 1SS3A 4DK1A 4B3SO 2ZDIC 2KSDA 4OX9O 2HFEC 4UB6Z 1SERA 1N32B 4RUFA 1US6A 2AXTZ 2CGNA 5B5EZ 1RP3B 3WB2A 1AJPA 1NT2B 4LP8A 1Y67A 3JSLA 2ITCC 4TUYA 4RO2A 1AP6A 3OW2U 5JWPA 3F5TA 2BSKB 3ZHVA 2P6JA 3JD1A 3SGIA 4UXNA 5EYPA 4JI0B 4FLTA 4NVPA 2A7WA 2YSUB 1QQCA 2CTPA 4LF6O 4O4HB 4UVBA 2AHZA 1M1KW 4A5UB 1FD9A 2DQ3A 2WLLB 4Q20A 2DMXA 2W6JG 1SQQH 1XMQO 4JI7O 3T1HB 2ATKC 3QO8A 1OCZC 4BW9A 1MG1A 1KQSU 3RYHA 2XAJA 2UXBO 2W6IG 4LC1A 1FXKC 4GX1A 4K35A 1JVMA 2QWOB 3CC7V 2PYLA 1M93A 2ZR2A 3ML0A 4EEQA 1EN5A 3L74H 2GUZA 4HBNA 4DV1B 4I9WA 3GWKC 1YDXA 1AR4A 4I55B 2ZR3A 1W0JG 3CRQA 5LXTB 1UJWB 1XL4A 1XDCA 4NTYA 2WLLA 3T1YB 3ETQA 4LNUB 1PL0A 4JAUA 2X6AA 4X88A 4LH6A 3OR7C 2PYJA 1Y66A 4DR3B 4FLWA 2ZIOA 4R6ZA 4K0KO 2F66C 3U0ZA 5FPOA 3LDCA 1THZA 4MTGA 3CCRV 1EN6A 3DGEA 3OR6C 2XAQA 1JA8A 1HNWB 4DV2O 3QTCA 1NS1A 2WAMA 2GUZB 4U3JB 3EVKA 1GH6A 4WBNA 1COWG 1T5EA 2JS5A 4R7CA 1K8AW 1FXKA 4JI3B 4CH6A 4MTXA 4RQEA 1DF5A 1HR0O 1OHHG 1H8HG 4GKKB 4CBCA 4WFHA 2ZE7A 3RYHB 5LHGA 4J80A 4DV3O 2EIMC 1GAXA 2WSSG 4W4LA 1WPXA 3JSNA 3ZHRA 2CUGA 1Q6HA 3AG2B 3FX7A 1P84F 3RYFB 4UB8Z 4YJ2A 4WF9V 1KYOF 1H2NA 1HNXO 3G80A 3JD2A 3CE2A 3TK1A 4JI6O 3K5NA 3KG2A 2ODMA 3W7WA 2H94A 5JJNB 3H01A 5KHHA 1MABG 5LHIA 2D2CB 4B3MB 4ZBMA 3AK3A 2ZKOA 4DV0O 2OT5A 3APOA 1RFYA 4UCSA 4DR1O 1GO3F 2BOCC 4KHPO 3UKMA 3JCUZ 1IURA 4CS4A 1R6NA 2P4KA 2Y0PA 4NXNB 5HFLA 3HR0A 4X9QA 1M90W 4X20B 3A8TA 1L1FA 3CCLV 4O2AA 1DGSA 4RUEA 4EB6A 3ZMUA 5KMGB 4DUZO 4PDLA 2E5LO 4QE9A 1M9NA 2MW2B 3IC9A 2N05A 3QVNA 2OCCB 5CMUA 5IYZB 3RYCA 4DYLA 2UUCO 1BHBA 2WLIB 4TV9B 1DF4A 3IJ4A 5C8YB 3LSUA 3NR7A 3UT5A 3F7YC 4FLUA 2DW4A 1BQ0A 1NQTA 2BOBC 3AK1A 2QM7A 1PM9A 1YF2A 1Z2GA 2OTLV 1R3LC 4AQYB 5IWAB 3AG3B 1IBMO 4JI1B 4CH3A 4ZOLB 4MW3A 2P5OA 1S77D 1V55C 4AILC 1YZBA 4GUNA 1CXZB 2EBOA 2ARHA 2ZE6A 3FB7C 2EILC 4DUYB 2ZD9A 3U10A 4X1YA 5IJ9B 1SETA 5E1AC 3K04A 1QR8A 3RWRD 4TV8A 3G71V 4NXMB 4K8ZA 5FLXN 5B1BC 1WP8A 4D7TA 5F2VO 1IXMA 3FYEB 5DECA 1R3JC 2HP8A 2YIAA 2VWKA 3AG4B 1H38A 2WWWA 5IE9A 4P2ZA 5KUKA 3RYIB 4LF9B 4Z2WA 4FVMA 1H2GA 4LFCO 1H2KA 3X2QC 3GB7C 4YIPA 1KBHA 1P7BA 3SJCC 4GT1A 4GZRB 4ASUG 2A06H 1EM1A 1NI8A 5JCOC 2AZ0A 1VQ5V 1VQMV 4PI0A 4PA6A 2C2AA 5L3EA 2QM8A 4JI4B 5CB4A 4AHCA 5KHKA 3CC4V 3CSXA 3E8FA 1VQLV 2UU9B 1RPRA 5B66Z 1ROPA 5DM6V 2QKSA 1VQ7V 3MDSA 2IJIA 1BE3H 4UVCA 4I4TA 4FM2A 3L70H 3SPHA 4JASA 4ZI7A 4LF4O 1GKFA 4DR5B 3CJHA 4O4LB 3IFXA 3N27A 5BXZA 4CS3A 3UCSC 5B1AC 1B3QA 1VIBA 4DR6O 4X1KA 3WFVA 3HKCA 4JZGA 3SDLA 4JGSA 4DRXB 2QGNA 3HKCB 3JAKA 1TUEB 1Q82W 1IXBA 1WJZA 2HG5C 3Q4HA 4E2LA 5IY5C 2NLJC 2F1MA 3P32A 2UUCB 3RVYA 3K59A 4X64O 2NR5A 1UPGA 1V55B 3HKEA 4LH7A 1PV0A 2RCVA 2Q73A 1XUQA 3VOUA 2QWNB 5K1PA 1CP9A 3J80N 1TUBB 2HHHO 4FFBB 4I50A 5IJ0B 2IH1C 2UXCB 4JI3O 2QR4A 3JATB 2CH7B 1H8EG 4U7NA 3CEIA 4B3SB 1FAFA 2ZXWC 5H6RA 4JAAA 2KKWA 3RYIA 2Y4UA 3HB3B 4KFMA 4NXMO 2EIJC 4CS2A 3ZRSA 5EC2C 1SESA 3CS5A 4O2BA 4B3TB 1XBLA 4PD4F 3ZIAG 2B1GA 5ITZA 3SYQA 3JARA 1FPOA 1EZVH 2UXDO 2WPDG 2E3CA 2WLHA 2WLNA 3CHXA 2KG7A 1GRJA 1SQGA 2HKOA 2F4VB 3BABA 4DV2B 4L87A 1ZLZA 4EKWA 3C90A 4YXWG 5LMNO 2Z5UA 3KZIZ 5GONA 3CRRA 1L8DA 5IYDO 1Q43A 2CTWA 4I9QA 3PN1A 4BR6A 4DR5O 4LF7B 4Z1MG 3B77A 3WG7B 3MHSC 1ZSPA 4ZHQB 1RSOA 2KQXA 3JARB 2PI5A 3S3XA 1W59A 5H2FZ 3H1HH 2JEXA 4NKGB 3A2FA 2IJKA 4XDJA 3F5WC 1BSMA 2EJ7A 3QO7A 1GMGA 3ZMSA 3T1YO 1K5SA 1Q86W 5L3CA 1YI2V 3ZN1A 3CD6V 1K7DA 5B1OA 2ZM6B 1XREA 3TXQA 3OT7A 1I5YA 2QKCA 4O4JA 1Y74B 5L3FA 3L73H 3K5MA 1HW7A 1I0HA 2P90A 4TUYB 3E22B 3OM3B 1J5EB 2OTJV 5LHHA 5H5NA 2Q8VA 4DO2A 3ZMZA 3OAAG 5IYZA 3RYCB 2UXBB 1I94O 2AGAA 2R9RB 1DLBA 4PDMA 2JS3A 1L0LH 1QHTA 1WN7A 4BIZA 4DR7O 4N23A 4DV1O 3HKDB 1BMFG 4HZ3A 2Q6AA 3DC5A 2VS0A 3H1IH 2LFSA 1W0KG 5H9CA 4X20A 5EBWC 3L75H 2QSAA 2JEUA 2EIMB 1Q6IA 3BVOA 1QVFU 1N0JA 2QE7G 5CBGA 2E76B 1NJIW 3N2KA 5J2TB 3C3SA 3I55V 3ZHQA 2EIJB 1BZKA 4NR1A 1YTFD 5LOVB 1QVGU 1HDJA 1NU1H 3Q4HB 1ZAUA 3BA8A 1JJOA 4AQYO 1AILA 4LF6B 1DTOA 3W7TA 3ABLC 3HPLC 5LBQA 3CP1A 2QWPB 3HKBA 4UFZA 2D3OW 3A0RA 2IM9A 3R65A 4H37A 5BY1A 3SJBC 4JYAB 3SPGA 4LF8B 3DXRB 3JD4A 1O9GA 5LYJB 2EIKC 1QBZA 4UVAA 4YJ2B 4OPAA 1JJ2U 3B4SA 1GN4A 1QLEC 4PHZA 2QTOA 2Q7EA 4MW8A 1O9HA 1TA8A 2RN9A 2ZCEA 2Y69C 2N74A 1NTMH 5EBLC 1BGYH 2EINB 2QJ1A 4I55A 1VQ6V 3SJAC 2OCHA 2YEVA 2R9IA 4FM1A 1WPBA 2Z0AA 4FLVA 1M57B 4PV1B 2ZQMA 4LFAB 2F95B 4X1IB 4WFAV 1ORQC 1JQ0A 3B2EE 2HJFC 2DYRB 4JZ2A 2ZXWB 5LP6B 1SKVA 2YIBA 3JALB 1MA1A 2XNDG 3BPZA 3K9AA 1Q7YW 3E8GA 2V4DA 1WNSA 2YI9A 3UM7A 4KHPB 2LJ2A 2JIZG 2H8PC 4LNUA 2EJRA 1N33O 1KKCA 4X65B 5GTHZ 3ABMC 4JYCA 5FL7G 4FFKA 2CAZC 4X1YB 4J42A 1HR0B 1GN2A 4UCRA 4QJFB 4EFBA 2HVKC 3VQYA 4JTAB 4X1IA 1F51A 3N2GA 1OV9A 1R6KA 2ZINA 5E79Z 1VQKV 3TCUA 1E1RG 2CGOA 2XOKG 4O4IB 3EHBB 2WLIA 2Q7GA 3M7MX 5KUMA 3LUTB 1W2BU 2WLMA 1HNXB 2Q5ZA 5B1BB 5JQGB 2YUAA 4IYIA 2VQEB 2Q69A 4RWUA 2YIBD 5C8YA 3ASOC 2YXYA 1TUBA 3SJQC 1BL8A 2JGDA 1XNQB 5BMVB 2ADQB 3CCQV 3CCSV 4O4HA 4JV5O 3T1CA 3B09A 3K57A 2NN4A 1I08A 3ZJZA 2F43G 3CCEV 4IL6Z 3C3TA 4H33A 4W4KA 4DK0A 3RBZA 2UXCO 3VBBA 3L9DA 5J2UA 4GKKO 4H13B 3ABLB 3EFFK 3TETA 4DXWA 2X7RB 2YIDA 1FYJA 4DV3B 3M8AA 1N34B 4GCZA 3CPWU 1Z5WA 1OCZB 1PNLA 3A0HZ 5LP6C 4DRXA 1M57C 1K4CC 4KUMA 4TQFA 3FAVB 4WFFA 1MSDA 5AG2A 4J9YB 1Q3EA 4DR6B 4HNAA 2DN9A 3STLC 3ABKB
chains in the Genus database with same CATH topology
2AGAA 1XEQA 2UU9O 1AB3A 4DUZO 5BR8O 2E5LO 4B3SO 4K0KO 4LF9O 4DR7O 4DV1O 1N32O 4LF5O 2UXDO 1N33O 2JRIA 3O65A 4DV4O 4OX9O 4DV2O 4LF7O 4DV6O 4B3MO 1NS1A 2UUCO 4LF4O 1R6TA 1F7YA 4DUYO 5BXZA 1FJGO 1DK1A 4DV5O 5LMNO 5IWAO 2FKXA 4DR6O 4X66O 1D2DA 1HR0O 1XNQO 3SDLA 3F5TA 4DV7O 4JI5O 4B3RO 1HNZO 4YHHO 4DV3O 2UUBO 3R66A 4OPHA 1N34O 4X62O 3RT3C 4AQYO 1IBMO 1AILA 5LL6Y 1A32A 2UUAO 4DR5O 4X64O 2VQEO 1XMOO 4LF6O 4LFBO 1YZBA 5BY1A 1HNXO 4A5UB 3T1HO 1N36O 4JI6O 4JI2O 4DR3O 4LF8O 1J5EO 1XMQO 4JI7O 3J7AU 4JV5O 4OPAA 2DOSA 5FLXN 1FKAO 5IT9N 4B3TO 2UXBO 2VQFO 3T1YO 4JI8O 2F4VO 3J80N 2HHHO 4JI4O 2ZKOA 1G1XB 4DV0O 4JI3O 1XNRO 2N74A 4YY3O 3J81N 2UXCO 4DR1O 4KHPO 4GKJO 4GKKO 1IBLO 4LFCO 4LFAO 1KUQA 2ZM6O 4DR4O 1IBKO 1FYJA 2Z0AA 1HNWO 3M8AA 4X65O 4DR2O 4NXMO 3OTOO 4NXNO 5H5NA 1R1BA 2LW7A 4JI1O 4JI0O 5A2QN 1I94O 2DJVA 3JAMN 5LMUO 1X59A 4JYAO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGA A;  1XEQ A;  2UU9 O;  1AB3 A;  4DUZ O;  5BR8 O;  2E5L O;  4B3S O;  4K0K O;  4LF9 O;  4DR7 O;  4DV1 O;  1N32 O;  4LF5 O;  2UXD O;  1N33 O;  2JRI A;  3O65 A;  4DV4 O;  4OX9 O;  4DV2 O;  4LF7 O;  4DV6 O;  4B3M O;  1NS1 A;  2UUC O;  4LF4 O;  1R6T A;  1F7Y A;  4DUY O;  5BXZ A;  1FJG O;  1DK1 A;  4DV5 O;  5LMN O;  5IWA O;  2FKX A;  4DR6 O;  4X66 O;  1D2D A;  1HR0 O;  1XNQ O;  3SDL A;  3F5T A;  4DV7 O;  4JI5 O;  4B3R O;  1HNZ O;  4YHH O;  4DV3 O;  2UUB O;  3R66 A;  4OPH A;  1N34 O;  4X62 O;  3RT3 C;  4AQY O;  1IBM O;  1AIL A;  5LL6 Y;  1A32 A;  2UUA O;  4DR5 O;  4X64 O;  2VQE O;  1XMO O;  4LF6 O;  4LFB O;  1YZB A;  5BY1 A;  1HNX O;  4A5U B;  3T1H O;  1N36 O;  4JI6 O;  4JI2 O;  4DR3 O;  4LF8 O;  1J5E O;  1XMQ O;  4JI7 O;  3J7A U;  4JV5 O;  4OPA A;  2DOS A;  5FLX N;  1FKA O;  5IT9 N;  4B3T O;  2UXB O;  2VQF O;  3T1Y O;  4JI8 O;  2F4V O;  3J80 N;  2HHH O;  4JI4 O;  2ZKO A;  1G1X B;  4DV0 O;  4JI3 O;  1XNR O;  2N74 A;  4YY3 O;  3J81 N;  2UXC O;  4DR1 O;  4KHP O;  4GKJ O;  4GKK O;  1IBL O;  4LFC O;  4LFA O;  1KUQ A;  2ZM6 O;  4DR4 O;  1IBK O;  1FYJ A;  2Z0A A;  1HNW O;  3M8A A;  4X65 O;  4DR2 O;  4NXM O;  3OTO O;  4NXN O;  5H5N A;  1R1B A;  2LW7 A;  4JI1 O;  4JI0 O;  5A2Q N;  1I94 O;  2DJV A;  3JAM N;  5LMU O;  1X59 A;  4JYA O; 
#chains in the Genus database with same CATH topology
 4YY3 B;  4FLZ A;  1XNR B;  3AG7 A;  4FPP A;  3AG1 C;  3CJH B;  4P30 A;  1WB7 A;  4I7Z B;  4XDK A;  1Q8I A;  2Q0A A;  4MVQ A;  1V54 C;  1IBK B;  2G38 A;  3TXS A;  5L3B A;  2ZDI A;  4F4L A;  1F7Y A;  2B1I A;  4K3A A;  1VF5 B;  4G28 B;  5BZB A;  2QEX V;  3ABM B;  3W7U A;  5IWA O;  1WP7 A;  2UXX A;  2K9P A;  4R50 A;  3DC6 A;  2F93 B;  2E75 B;  4B3R O;  3AG1 B;  2A0L A;  4MSW C;  3CYO A;  4X62 O;  3K3W A;  3JAK B;  1Y74 A;  4GX0 A;  3X2Q B;  2N04 A;  2XAG A;  3KCY A;  3JYC A;  1VQ9 V;  1NR7 A;  4WBN B;  2QWQ B;  3SPC A;  4TOI A;  4PJ0 Z;  2FYU H;  5IYB O;  4WFB V;  4QGP A;  3FKS G;  1K33 A;  2DOS A;  2PUS A;  3VQV A;  4B3T O;  3OMN B;  1BT8 A;  2VQF O;  1R73 A;  3BRC A;  4HAM A;  5D5P A;  5FNV B;  5LXT A;  3E2E A;  1YCI A;  1GK9 A;  2HR3 A;  2JVD A;  4GKJ O;  1VF6 C;  3ZHT A;  4DR4 O;  1Q81 W;  3JAL A;  1HNW O;  4JV5 B;  1VF6 A;  1K34 A;  3ZRX A;  1K97 A;  1PPJ H;  3LNM B;  2LW1 A;  3GVM A;  3BCC H;  3FB6 C;  4J11 A;  4O4I A;  4LWS A;  4UV8 A;  5DN6 G;  5CN0 A;  3N2G B;  2UU9 O;  3FB8 C;  3D36 C;  1ZTE A;  4QPK A;  2V1D A;  5LGT A;  3H1L H;  4TV8 B;  2OWO A;  1ZUQ A;  4LF7 O;  2OIE A;  4FLY A;  1OCC B;  3GWO A;  2LGQ A;  3RVZ A;  4U3F H;  4DW1 A;  3G67 A;  2Q68 A;  4DV5 O;  2DYS B;  1URF A;  1S72 V;  1MZE A;  1K3E A;  1E1Q G;  1ZL8 B;  3K0D A;  3OE7 G;  3R66 A;  3ZED A;  2KB1 A;  3VQW A;  3HKB B;  1BS3 A;  4G27 B;  2E74 B;  4LFB O;  5LA6 B;  1FJG B;  4ICG A;  1KU9 A;  1M56 B;  2H3O A;  4LF8 O;  1J5E O;  5EK0 A;  1VQN V;  1Q90 D;  1FKA O;  3P30 A;  3HKE B;  3WB0 A;  3A0B Z;  2CTR A;  3BFR A;  3H1K H;  3T4Z A;  1YIJ V;  3OMA B;  1AJN A;  3OGI B;  2ZNI A;  3HKD A;  1VEW A;  4DR7 B;  2EIL B;  1AI7 A;  4MTF A;  1SQV H;  3TGU H;  2RMK B;  3SR2 C;  2LGW A;  3IGA C;  3K06 A;  1EBO A;  4TWK A;  4MT8 A;  2YXH A;  5J9P C;  2LP7 A;  1KB9 F;  3E22 A;  2IW5 A;  1FXK B;  5LOV A;  3ZS8 C;  2FL4 A;  2QDO A;  5J2U B;  1AR1 B;  4GKJ B;  2XTA A;  3K58 A;  2X0L A;  4NTX A;  1NKD A;  2WA3 A;  5KX5 A;  3I56 V;  2R70 A;  4DV6 O;  1P7G A;  1J95 A;  1Z5V A;  1TGO A;  1N8R W;  3RGB A;  3JAW A;  3OFN G;  5GW7 A;  3OD4 A;  2IU3 A;  1H2S B;  1EFR G;  2X6B A;  4IIJ A;  4YHH O;  5EBM C;  3D8C A;  4P9P A;  1N34 O;  3KKY A;  4JTC B;  5LP6 A;  3K5O A;  3BEH A;  1A32 A;  2YI8 A;  3ZRW B;  4PA3 A;  1VP7 A;  1SQF A;  2QTS A;  3WU2 Z;  2V7Q G;  1S5L Z;  2W0F C;  1N36 O;  1R3I C;  1VQP V;  4JI2 O;  1U97 A;  1GM7 A;  1X4T A;  1G8M A;  3ICX A;  2RNB A;  2ZE5 A;  2Q4P A;  2UXN A;  1FFX A;  1D5A A;  1SA0 B;  1MSW D;  4MVU A;  2PY5 A;  3S3W A;  3NXS A;  5D5Q A;  2Q0O C;  1LNQ A;  2GV9 A;  4J7J A;  2GBO A;  2M6Y A;  3SYO A;  3ZBH A;  4OXS A;  1SA0 A;  3QF7 A;  4DV7 B;  5BR8 B;  1OCO C;  2Q67 A;  4D6T H;  3DXR A;  1ARO P;  4LF5 B;  1Q5O A;  4ZHQ A;  1VQ4 V;  1YEW A;  2PTM A;  5IYC O;  4GX5 A;  1XQ8 A;  5CA1 A;  1FXH A;  1GN6 A;  5H6Q A;  4FIP C;  3CRC A;  2IJJ A;  2P22 C;  4LWS B;  2PGG A;  1D5N A;  1CEZ A;  3ZRW A;  1HNZ B;  2F23 A;  2JK5 C;  4MTO A;  5GTI Z;  2EX3 A;  2PZS A;  1OCO B;  1AVM A;  3FD9 A;  4JI8 B;  4FFB A;  4I50 B;  1R6T A;  5TIS Z;  5IJ0 A;  4I5S A;  4TT3 G;  2PI4 A;  1JX9 A;  1NVP D;  3QO5 A;  1XOU A;  4D7S A;  1ZWI C;  5JCO A;  1XNQ O;  1OJH A;  1IBL B;  3QNE A;  2ZE8 A;  4FJC C;  3G6B A;  3ZMT A;  2M7W A;  2CE4 A;  3OUS A;  2HHH B;  4P9O A;  1Y4M A;  1WLE A;  1NBM G;  1K92 A;  2IH3 C;  3G6E V;  3AK2 A;  3FAV A;  3BA9 A;  1NTZ H;  4N21 A;  4OGQ B;  2DWD C;  3DSQ A;  4Z1V A;  2AW9 A;  3KCX A;  1NVP B;  4DR2 B;  3CMA V;  2RJZ A;  1UFI A;  1AR5 A;  1S3J A;  2B9Z A;  3CXH F;  4DV5 B;  4PEL A;  1XNR O;  4H44 B;  1WA8 A;  5EC1 C;  1CPY A;  1N36 B;  5KA6 A;  3E8B A;  4JI6 B;  4CH4 A;  1XHZ A;  4B7K A;  4LFA O;  1H2L A;  1IBK O;  2IBZ H;  3P3N A;  2HEP A;  1LR1 A;  2P06 A;  1MNG A;  3E83 A;  5KHI A;  2UUB B;  2AHY A;  3K08 A;  3OTO O;  4YJ3 B;  1KD1 W;  3CCV V;  4UCT A;  1LUV A;  3OGC C;  3EXA A;  1KKD A;  3O9O A;  5LMU O;  3D3I A;  5LMN B;  1XEQ A;  5CA0 B;  1JCH A;  4O4J B;  1AP5 A;  4B3R B;  3ETD A;  3IC7 A;  1RM1 C;  5BR8 O;  4X1K B;  3JD0 A;  3U11 A;  1AI6 A;  5EZY A;  4LF5 O;  1YSC A;  4CC6 A;  4DV4 O;  2ZNJ A;  2LO1 A;  4O4L A;  1SQX H;  1RPO A;  4I4T B;  4QNH B;  1Y6X A;  1YJW V;  4QE7 A;  4JYY A;  3CRA A;  5HFM A;  3ABU A;  1HP8 A;  5EIB D;  1V54 B;  3CCM V;  4PI2 A;  4YIO A;  1Q6U A;  4OPH A;  4IT5 A;  1XMO B;  2GDS A;  2YDE A;  3P3P A;  1OZ0 A;  4O2B B;  3UO2 A;  2VQE O;  4WFE A;  5C93 A;  3MAQ A;  2XAH A;  5IDJ A;  4RQF A;  1XL6 A;  5CBF A;  1OCR C;  3K9S A;  1S0V A;  5EZY B;  1K73 W;  3ZHS A;  1Y76 A;  3OTF A;  2PF4 E;  3JAT A;  2EIN C;  1YJ9 V;  3W7X A;  4BWA A;  2X6C A;  2LFR A;  4PA9 A;  3AEI A;  1GM9 A;  4BIO A;  1JMK C;  1G1X B;  1F23 A;  2CDY A;  4MVS A;  1JR9 A;  4PA7 A;  1L0N H;  5KA5 A;  3QG5 A;  1XHX A;  4I0X B;  1I7F A;  5EYP B;  2YS8 A;  4UUJ C;  4LCU C;  3JAS B;  3PJS K;  4OX9 B;  4J7Z A;  1AJQ A;  4RAI A;  2GTA A;  5LGU A;  1WA8 B;  4DR2 O;  4B7E A;  2BSK A;  4JPR A;  2DWE C;  3ZCC A;  2Q7H A;  4R8C A;  2EUL A;  2VQF B;  3JAM N;  1B06 A;  1N0N A;  4NTW A;  4HNA B;  4BIU A;  4KXR A;  3DTU B;  4JF3 A;  1AI4 A;  3AG3 C;  2MK3 A;  2GHY A;  2JDI G;  3APQ A;  5K1X A;  4G2K A;  2VWJ A;  2ILM A;  3ZX6 A;  4FMT A;  1JFF B;  5KAI Z;  4F6R A;  4AI8 A;  5JJJ B;  3WG7 C;  4TV9 A;  4B3M O;  2YIC A;  4ZI7 B;  4XBF A;  4X66 B;  1FJG O;  4DV6 B;  1DK1 A;  1WB8 A;  1KMI Z;  3ASN B;  3K03 A;  2OCC C;  1XMQ B;  4JI7 B;  3T4D A;  2BCC H;  4JI5 O;  2BTO A;  3W7S A;  1NR1 A;  4O2A B;  4DV4 B;  3ASO B;  3MD0 A;  5LL6 Y;  3RYF A;  4YHH B;  2EZP A;  4LF4 B;  2BE3 A;  4E4E A;  2FB5 A;  3OEE G;  1ENV A;  1F4M A;  4ZKI A;  3B40 A;  3CB2 A;  4DUZ B;  2E5L B;  1VAR A;  4PDR A;  1F4N A;  3OEH G;  5KAF Z;  4UCO A;  5KLV H;  1SZT A;  1SQP H;  2P4V A;  1JFF A;  5IT9 N;  5B1A B;  4IHJ A;  4UCV A;  1BQZ A;  4WCE V;  3G4S V;  1R3K C;  2R72 A;  3I5D A;  2IU0 A;  5CA1 B;  5JVD A;  2RQ6 A;  2K1E A;  1QLN A;  1JOY A;  1G4Y B;  1E79 G;  1VF7 A;  1SC5 B;  1B6Q A;  1P49 A;  2ZT9 B;  3D3Q A;  4DR4 B;  3E35 A;  1IX9 A;  2IJH A;  3STZ C;  4GX2 A;  4L8J A;  1PL4 A;  2DYS C;  2FML A;  3BHP A;  1N4C A;  1IBM B;  4X65 O;  2WLK A;  3SYP A;  1SRY A;  4NXN O;  5B3S C;  1PKX A;  1K9M W;  2P7T C;  4CC5 A;  1M5I A;  4I0X A;  4ZOL A;  5DED A;  2ETN A;  2WLJ A;  1X59 A;  4GLX A;  5L3D A;  1RSO B;  2DYR C;  1KP2 A;  2A79 B;  1KC8 W;  4UV9 A;  4F6E A;  1S5H C;  5EIB C;  3BAA A;  1N32 O;  1AI5 A;  2ZIM A;  3B8N A;  2A9H A;  1TVK B;  4NB5 A;  2JGU A;  4U3J A;  2EZO A;  1RM1 B;  1U96 A;  2A3Q A;  5B3S B;  2NNU A;  2DE0 X;  5GON B;  3F7V C;  2L35 A;  1HWY A;  3FYI B;  4JI2 B;  2AZ2 A;  3CCJ V;  2QWR B;  4ABM A;  2UUB O;  2OIG A;  5FNV A;  3H1J H;  4LFB B;  1WAZ A;  2W0X A;  4JTD B;  1G6U A;  2O57 A;  2DQ0 A;  4DR1 B;  1B04 A;  3RN4 A;  3SYA A;  3T1H O;  3IAY A;  3MHH C;  1S5J A;  3RW0 A;  3ZN0 A;  3LNN A;  2QA4 V;  4GYC B;  3L71 H;  3ABK C;  4H0L B;  3LSS A;  3UT5 B;  1OCR B;  1BCC H;  1BHA A;  4KL1 A;  5KHJ A;  4YJ3 A;  3CCU V;  1GM8 A;  4MVZ A;  4YY3 O;  2WA4 A;  3OUF A;  3LSQ A;  1VMG A;  3FFQ A;  2XAF A;  1GTO A;  2QKA A;  1IDS A;  1KP3 A;  4EB6 B;  3JAW B;  5JJE B;  4DW0 A;  3E89 A;  1R1B A;  4JI0 O;  3E86 A;  4J10 A;  4J9Z B;  5KX5 B;  4QIW F;  4DV0 B;  5JVD B;  1AB3 A;  4UCU A;  4BW5 A;  2YC0 A;  5L3G A;  4IHJ B;  1H2M A;  4LBE C;  4TSF G;  2OYQ A;  5CA3 A;  3AG4 C;  5LA6 A;  1FS0 G;  4X62 B;  2JRI A;  2HJD A;  4CH5 A;  4MVO A;  4NYK A;  4JYB A;  3N2K B;  4DUY O;  4X89 A;  1I5X A;  1YXB A;  1YVW A;  1QCE A;  4U7O A;  4B08 A;  1ZL8 A;  3ETG A;  2XHB A;  2FTK A;  4ZIB A;  3OMI B;  5B1N A;  5JH7 B;  1HNZ O;  5A9G A;  3FB5 C;  2RDC A;  1M56 C;  4FLX A;  4FM0 A;  3JAS A;  3ASN C;  2UUA O;  1SQB H;  1XMO O;  1MOF A;  3M99 B;  4XDL A;  1VQ8 V;  1NH2 D;  4C7U A;  5BMV A;  4PDV A;  2JGD B;  3ZMV A;  3E8H A;  1FXV A;  2Q9L A;  4IYH A;  3RFR A;  4DR3 O;  1QLE B;  3ETE A;  2UXD B;  4F6R B;  2Y48 A;  5JQG A;  3ZRV A;  3UQ8 A;  2P67 A;  2F4V O;  3B8M A;  3ZHU A;  3K5L A;  2Y0I A;  3K79 A;  4JI4 O;  5LGN A;  4MS2 A;  2Z3Y A;  4TQD A;  4JAV A;  3SPI A;  4MVM A;  1OCC C;  1QNM A;  3JCZ A;  2Y69 B;  4KP4 A;  3LDD A;  4JI5 B;  1GN3 A;  2HVJ C;  1KEC A;  1KUQ A;  3CME V;  3VQX A;  3T2M A;  3CXC U;  5A2Q N;  1XI1 A;  2DJV A;  5CB4 B;  5IJ9 A;  2EIK B;  1FFX B;  4K8X A;  1EN4 A;  3L72 H;  5ITZ B;  1JPX A;  2JJ1 G;  2ITD C;  3CRM A;  3WB1 A;  3CWB H;  1SF9 A;  4IGG A;  1FFT B;  4CZZ A;  1TVK A;  2CTQ A;  1YIT V;  4LF9 O;  1K4D C;  1MMM A;  3ABT A;  3O65 A;  3TJT A;  4X64 B;  3LDE A;  3H9V A;  1Y76 B;  4FZ1 A;  3CX5 F;  3OTO B;  2XUM A;  1NTK H;  5FPR A;  2XAS A;  5CA0 A;  2CH7 A;  2FKX A;  4IIJ B;  4X66 O;  2GSM B;  1D2D A;  5KHG A;  2HLD G;  2KG7 B;  2YEV B;  1IVS A;  2B5U A;  4DV7 O;  1PP9 H;  2YXL A;  3SYC A;  1EZJ A;  3D36 A;  1N33 B;  3RT3 C;  2R9A A;  4MVR A;  4LR3 A;  1TAE A;  4BAY A;  1I94 B;  1S76 D;  5KMG A;  1PNM A;  1YTF B;  2BTQ B;  1PNK A;  5IY5 B;  1QU7 A;  2L6L A;  2QM4 A;  4FK5 C;  1YJN V;  1VQO V;  5LYJ A;  4Q6G A;  3J7A U;  1NZ6 A;  4PA4 A;  4QPJ A;  4X8A A;  3JD3 A;  4HYO A;  4JI8 O;  2LQT A;  2UUA B;  2VRZ A;  1V9P A;  1XIL A;  1K5Q A;  4FZ0 A;  1SZX A;  1IZ3 A;  1QR9 A;  3J81 N;  4LFC B;  3K0G A;  2JJ2 G;  1P4R A;  4K0K B;  1IBL O;  2ZM6 O;  1ZX3 A;  5J2T A;  2CK3 G;  1NH2 B;  2BTQ A;  2ADP A;  2GTS A;  4J41 A;  5LMU B;  1LUW A;  4WFG A;  2LW7 A;  1MZF A;  4JI1 O;  5CBH A;  3BY6 A;  4EFE A;  3SPJ A;  1YHQ V;  4JYA O;  3CC2 V;  3THO A;  1M4U A;  4J7K A;  5JH7 A;  2Y4T A;  3AG2 C;  3UO3 A;  2XT9 A;  1PD3 A;  1SS3 A;  4DK1 A;  4B3S O;  2ZDI C;  2KSD A;  4OX9 O;  2HFE C;  4UB6 Z;  1SER A;  1N32 B;  4RUF A;  1US6 A;  2AXT Z;  2CGN A;  5B5E Z;  1RP3 B;  3WB2 A;  1AJP A;  1NT2 B;  4LP8 A;  1Y67 A;  3JSL A;  2ITC C;  4TUY A;  4RO2 A;  1AP6 A;  3OW2 U;  5JWP A;  3F5T A;  2BSK B;  3ZHV A;  2P6J A;  3JD1 A;  3SGI A;  4UXN A;  5EYP A;  4JI0 B;  4FLT A;  4NVP A;  2A7W A;  2YSU B;  1QQC A;  2CTP A;  4LF6 O;  4O4H B;  4UVB A;  2AHZ A;  1M1K W;  4A5U B;  1FD9 A;  2DQ3 A;  2WLL B;  4Q20 A;  2DMX A;  2W6J G;  1SQQ H;  1XMQ O;  4JI7 O;  3T1H B;  2ATK C;  3QO8 A;  1OCZ C;  4BW9 A;  1MG1 A;  1KQS U;  3RYH A;  2XAJ A;  2UXB O;  2W6I G;  4LC1 A;  1FXK C;  4GX1 A;  4K35 A;  1JVM A;  2QWO B;  3CC7 V;  2PYL A;  1M93 A;  2ZR2 A;  3ML0 A;  4EEQ A;  1EN5 A;  3L74 H;  2GUZ A;  4HBN A;  4DV1 B;  4I9W A;  3GWK C;  1YDX A;  1AR4 A;  4I55 B;  2ZR3 A;  1W0J G;  3CRQ A;  5LXT B;  1UJW B;  1XL4 A;  1XDC A;  4NTY A;  2WLL A;  3T1Y B;  3ETQ A;  4LNU B;  1PL0 A;  4JAU A;  2X6A A;  4X88 A;  4LH6 A;  3OR7 C;  2PYJ A;  1Y66 A;  4DR3 B;  4FLW A;  2ZIO A;  4R6Z A;  4K0K O;  2F66 C;  3U0Z A;  5FPO A;  3LDC A;  1THZ A;  4MTG A;  3CCR V;  1EN6 A;  3DGE A;  3OR6 C;  2XAQ A;  1JA8 A;  1HNW B;  4DV2 O;  3QTC A;  1NS1 A;  2WAM A;  2GUZ B;  4U3J B;  3EVK A;  1GH6 A;  4WBN A;  1COW G;  1T5E A;  2JS5 A;  4R7C A;  1K8A W;  1FXK A;  4JI3 B;  4CH6 A;  4MTX A;  4RQE A;  1DF5 A;  1HR0 O;  1OHH G;  1H8H G;  4GKK B;  4CBC A;  4WFH A;  2ZE7 A;  3RYH B;  5LHG A;  4J80 A;  4DV3 O;  2EIM C;  1GAX A;  2WSS G;  4W4L A;  1WPX A;  3JSN A;  3ZHR A;  2CUG A;  1Q6H A;  3AG2 B;  3FX7 A;  1P84 F;  3RYF B;  4UB8 Z;  4YJ2 A;  4WF9 V;  1KYO F;  1H2N A;  1HNX O;  3G80 A;  3JD2 A;  3CE2 A;  3TK1 A;  4JI6 O;  3K5N A;  3KG2 A;  2ODM A;  3W7W A;  2H94 A;  5JJN B;  3H01 A;  5KHH A;  1MAB G;  5LHI A;  2D2C B;  4B3M B;  4ZBM A;  3AK3 A;  2ZKO A;  4DV0 O;  2OT5 A;  3APO A;  1RFY A;  4UCS A;  4DR1 O;  1GO3 F;  2BOC C;  4KHP O;  3UKM A;  3JCU Z;  1IUR A;  4CS4 A;  1R6N A;  2P4K A;  2Y0P A;  4NXN B;  5HFL A;  3HR0 A;  4X9Q A;  1M90 W;  4X20 B;  3A8T A;  1L1F A;  3CCL V;  4O2A A;  1DGS A;  4RUE A;  4EB6 A;  3ZMU A;  5KMG B;  4DUZ O;  4PDL A;  2E5L O;  4QE9 A;  1M9N A;  2MW2 B;  3IC9 A;  2N05 A;  3QVN A;  2OCC B;  5CMU A;  5IYZ B;  3RYC A;  4DYL A;  2UUC O;  1BHB A;  2WLI B;  4TV9 B;  1DF4 A;  3IJ4 A;  5C8Y B;  3LSU A;  3NR7 A;  3UT5 A;  3F7Y C;  4FLU A;  2DW4 A;  1BQ0 A;  1NQT A;  2BOB C;  3AK1 A;  2QM7 A;  1PM9 A;  1YF2 A;  1Z2G A;  2OTL V;  1R3L C;  4AQY B;  5IWA B;  3AG3 B;  1IBM O;  4JI1 B;  4CH3 A;  4ZOL B;  4MW3 A;  2P5O A;  1S77 D;  1V55 C;  4AIL C;  1YZB A;  4GUN A;  1CXZ B;  2EBO A;  2ARH A;  2ZE6 A;  3FB7 C;  2EIL C;  4DUY B;  2ZD9 A;  3U10 A;  4X1Y A;  5IJ9 B;  1SET A;  5E1A C;  3K04 A;  1QR8 A;  3RWR D;  4TV8 A;  3G71 V;  4NXM B;  4K8Z A;  5FLX N;  5B1B C;  1WP8 A;  4D7T A;  5F2V O;  1IXM A;  3FYE B;  5DEC A;  1R3J C;  2HP8 A;  2YIA A;  2VWK A;  3AG4 B;  1H38 A;  2WWW A;  5IE9 A;  4P2Z A;  5KUK A;  3RYI B;  4LF9 B;  4Z2W A;  4FVM A;  1H2G A;  4LFC O;  1H2K A;  3X2Q C;  3GB7 C;  4YIP A;  1KBH A;  1P7B A;  3SJC C;  4GT1 A;  4GZR B;  4ASU G;  2A06 H;  1EM1 A;  1NI8 A;  5JCO C;  2AZ0 A;  1VQ5 V;  1VQM V;  4PI0 A;  4PA6 A;  2C2A A;  5L3E A;  2QM8 A;  4JI4 B;  5CB4 A;  4AHC A;  5KHK A;  3CC4 V;  3CSX A;  3E8F A;  1VQL V;  2UU9 B;  1RPR A;  5B66 Z;  1ROP A;  5DM6 V;  2QKS A;  1VQ7 V;  3MDS A;  2IJI A;  1BE3 H;  4UVC A;  4I4T A;  4FM2 A;  3L70 H;  3SPH A;  4JAS A;  4ZI7 A;  4LF4 O;  1GKF A;  4DR5 B;  3CJH A;  4O4L B;  3IFX A;  3N27 A;  5BXZ A;  4CS3 A;  3UCS C;  5B1A C;  1B3Q A;  1VIB A;  4DR6 O;  4X1K A;  3WFV A;  3HKC A;  4JZG A;  3SDL A;  4JGS A;  4DRX B;  2QGN A;  3HKC B;  3JAK A;  1TUE B;  1Q82 W;  1IXB A;  1WJZ A;  2HG5 C;  3Q4H A;  4E2L A;  5IY5 C;  2NLJ C;  2F1M A;  3P32 A;  2UUC B;  3RVY A;  3K59 A;  4X64 O;  2NR5 A;  1UPG A;  1V55 B;  3HKE A;  4LH7 A;  1PV0 A;  2RCV A;  2Q73 A;  1XUQ A;  3VOU A;  2QWN B;  5K1P A;  1CP9 A;  3J80 N;  1TUB B;  2HHH O;  4FFB B;  4I50 A;  5IJ0 B;  2IH1 C;  2UXC B;  4JI3 O;  2QR4 A;  3JAT B;  2CH7 B;  1H8E G;  4U7N A;  3CEI A;  4B3S B;  1FAF A;  2ZXW C;  5H6R A;  4JAA A;  2KKW A;  3RYI A;  2Y4U A;  3HB3 B;  4KFM A;  4NXM O;  2EIJ C;  4CS2 A;  3ZRS A;  5EC2 C;  1SES A;  3CS5 A;  4O2B A;  4B3T B;  1XBL A;  4PD4 F;  3ZIA G;  2B1G A;  5ITZ A;  3SYQ A;  3JAR A;  1FPO A;  1EZV H;  2UXD O;  2WPD G;  2E3C A;  2WLH A;  2WLN A;  3CHX A;  2KG7 A;  1GRJ A;  1SQG A;  2HKO A;  2F4V B;  3BAB A;  4DV2 B;  4L87 A;  1ZLZ A;  4EKW A;  3C90 A;  4YXW G;  5LMN O;  2Z5U A;  3KZI Z;  5GON A;  3CRR A;  1L8D A;  5IYD O;  1Q43 A;  2CTW A;  4I9Q A;  3PN1 A;  4BR6 A;  4DR5 O;  4LF7 B;  4Z1M G;  3B77 A;  3WG7 B;  3MHS C;  1ZSP A;  4ZHQ B;  1RSO A;  2KQX A;  3JAR B;  2PI5 A;  3S3X A;  1W59 A;  5H2F Z;  3H1H H;  2JEX A;  4NKG B;  3A2F A;  2IJK A;  4XDJ A;  3F5W C;  1BSM A;  2EJ7 A;  3QO7 A;  1GMG A;  3ZMS A;  3T1Y O;  1K5S A;  1Q86 W;  5L3C A;  1YI2 V;  3ZN1 A;  3CD6 V;  1K7D A;  5B1O A;  2ZM6 B;  1XRE A;  3TXQ A;  3OT7 A;  1I5Y A;  2QKC A;  4O4J A;  1Y74 B;  5L3F A;  3L73 H;  3K5M A;  1HW7 A;  1I0H A;  2P90 A;  4TUY B;  3E22 B;  3OM3 B;  1J5E B;  2OTJ V;  5LHH A;  5H5N A;  2Q8V A;  4DO2 A;  3ZMZ A;  3OAA G;  5IYZ A;  3RYC B;  2UXB B;  1I94 O;  2AGA A;  2R9R B;  1DLB A;  4PDM A;  2JS3 A;  1L0L H;  1QHT A;  1WN7 A;  4BIZ A;  4DR7 O;  4N23 A;  4DV1 O;  3HKD B;  1BMF G;  4HZ3 A;  2Q6A A;  3DC5 A;  2VS0 A;  3H1I H;  2LFS A;  1W0K G;  5H9C A;  4X20 A;  5EBW C;  3L75 H;  2QSA A;  2JEU A;  2EIM B;  1Q6I A;  3BVO A;  1QVF U;  1N0J A;  2QE7 G;  5CBG A;  2E76 B;  1NJI W;  3N2K A;  5J2T B;  3C3S A;  3I55 V;  3ZHQ A;  2EIJ B;  1BZK A;  4NR1 A;  1YTF D;  5LOV B;  1QVG U;  1HDJ A;  1NU1 H;  3Q4H B;  1ZAU A;  3BA8 A;  1JJO A;  4AQY O;  1AIL A;  4LF6 B;  1DTO A;  3W7T A;  3ABL C;  3HPL C;  5LBQ A;  3CP1 A;  2QWP B;  3HKB A;  4UFZ A;  2D3O W;  3A0R A;  2IM9 A;  3R65 A;  4H37 A;  5BY1 A;  3SJB C;  4JYA B;  3SPG A;  4LF8 B;  3DXR B;  3JD4 A;  1O9G A;  5LYJ B;  2EIK C;  1QBZ A;  4UVA A;  4YJ2 B;  4OPA A;  1JJ2 U;  3B4S A;  1GN4 A;  1QLE C;  4PHZ A;  2QTO A;  2Q7E A;  4MW8 A;  1O9H A;  1TA8 A;  2RN9 A;  2ZCE A;  2Y69 C;  2N74 A;  1NTM H;  5EBL C;  1BGY H;  2EIN B;  2QJ1 A;  4I55 A;  1VQ6 V;  3SJA C;  2OCH A;  2YEV A;  2R9I A;  4FM1 A;  1WPB A;  2Z0A A;  4FLV A;  1M57 B;  4PV1 B;  2ZQM A;  4LFA B;  2F95 B;  4X1I B;  4WFA V;  1ORQ C;  1JQ0 A;  3B2E E;  2HJF C;  2DYR B;  4JZ2 A;  2ZXW B;  5LP6 B;  1SKV A;  2YIB A;  3JAL B;  1MA1 A;  2XND G;  3BPZ A;  3K9A A;  1Q7Y W;  3E8G A;  2V4D A;  1WNS A;  2YI9 A;  3UM7 A;  4KHP B;  2LJ2 A;  2JIZ G;  2H8P C;  4LNU A;  2EJR A;  1N33 O;  1KKC A;  4X65 B;  5GTH Z;  3ABM C;  4JYC A;  5FL7 G;  4FFK A;  2CAZ C;  4X1Y B;  4J42 A;  1HR0 B;  1GN2 A;  4UCR A;  4QJF B;  4EFB A;  2HVK C;  3VQY A;  4JTA B;  4X1I A;  1F51 A;  3N2G A;  1OV9 A;  1R6K A;  2ZIN A;  5E79 Z;  1VQK V;  3TCU A;  1E1R G;  2CGO A;  2XOK G;  4O4I B;  3EHB B;  2WLI A;  2Q7G A;  3M7M X;  5KUM A;  3LUT B;  1W2B U;  2WLM A;  1HNX B;  2Q5Z A;  5B1B B;  5JQG B;  2YUA A;  4IYI A;  2VQE B;  2Q69 A;  4RWU A;  2YIB D;  5C8Y A;  3ASO C;  2YXY A;  1TUB A;  3SJQ C;  1BL8 A;  2JGD A;  1XNQ B;  5BMV B;  2ADQ B;  3CCQ V;  3CCS V;  4O4H A;  4JV5 O;  3T1C A;  3B09 A;  3K57 A;  2NN4 A;  1I08 A;  3ZJZ A;  2F43 G;  3CCE V;  4IL6 Z;  3C3T A;  4H33 A;  4W4K A;  4DK0 A;  3RBZ A;  2UXC O;  3VBB A;  3L9D A;  5J2U A;  4GKK O;  4H13 B;  3ABL B;  3EFF K;  3TET A;  4DXW A;  2X7R B;  2YID A;  1FYJ A;  4DV3 B;  3M8A A;  1N34 B;  4GCZ A;  3CPW U;  1Z5W A;  1OCZ B;  1PNL A;  3A0H Z;  5LP6 C;  4DRX A;  1M57 C;  1K4C C;  4KUM A;  4TQF A;  3FAV B;  4WFF A;  1MSD A;  5AG2 A;  4J9Y B;  1Q3E A;  4DR6 B;  4HNA A;  2DN9 A;  3STL C;  3ABK B; 
#chains in the Genus database with same CATH homology
 2AGA A;  1XEQ A;  2UU9 O;  1AB3 A;  4DUZ O;  5BR8 O;  2E5L O;  4B3S O;  4K0K O;  4LF9 O;  4DR7 O;  4DV1 O;  1N32 O;  4LF5 O;  2UXD O;  1N33 O;  2JRI A;  3O65 A;  4DV4 O;  4OX9 O;  4DV2 O;  4LF7 O;  4DV6 O;  4B3M O;  1NS1 A;  2UUC O;  4LF4 O;  1R6T A;  1F7Y A;  4DUY O;  5BXZ A;  1FJG O;  1DK1 A;  4DV5 O;  5LMN O;  5IWA O;  2FKX A;  4DR6 O;  4X66 O;  1D2D A;  1HR0 O;  1XNQ O;  3SDL A;  3F5T A;  4DV7 O;  4JI5 O;  4B3R O;  1HNZ O;  4YHH O;  4DV3 O;  2UUB O;  3R66 A;  4OPH A;  1N34 O;  4X62 O;  3RT3 C;  4AQY O;  1IBM O;  1AIL A;  5LL6 Y;  1A32 A;  2UUA O;  4DR5 O;  4X64 O;  2VQE O;  1XMO O;  4LF6 O;  4LFB O;  1YZB A;  5BY1 A;  1HNX O;  4A5U B;  3T1H O;  1N36 O;  4JI6 O;  4JI2 O;  4DR3 O;  4LF8 O;  1J5E O;  1XMQ O;  4JI7 O;  3J7A U;  4JV5 O;  4OPA A;  2DOS A;  5FLX N;  1FKA O;  5IT9 N;  4B3T O;  2UXB O;  2VQF O;  3T1Y O;  4JI8 O;  2F4V O;  3J80 N;  2HHH O;  4JI4 O;  2ZKO A;  1G1X B;  4DV0 O;  4JI3 O;  1XNR O;  2N74 A;  4YY3 O;  3J81 N;  2UXC O;  4DR1 O;  4KHP O;  4GKJ O;  4GKK O;  1IBL O;  4LFC O;  4LFA O;  1KUQ A;  2ZM6 O;  4DR4 O;  1IBK O;  1FYJ A;  2Z0A A;  1HNW O;  3M8A A;  4X65 O;  4DR2 O;  4NXM O;  3OTO O;  4NXN O;  5H5N A;  1R1B A;  2LW7 A;  4JI1 O;  4JI0 O;  5A2Q N;  1I94 O;  2DJV A;  3JAM N;  5LMU O;  1X59 A;  4JYA O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...