2FL7A

S. cerevisiae sir3 bah domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
208
structure length
183
Chain Sequence
b'LDGWQVIITDDQGRVIENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein SIR3
publication title Structure of the Sir3 protein bromo adjacent homology (BAH) domain from S. cerevisiae at 1.95 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 47
structure length 183
sequence length 208
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fl7A00
1W4SA 4LD9K 3PT9A 4FT2A 3TU4K 2FVUA 3PTAA 4FT4A 4DA4A 4FSXA 1M4ZA 4KUDK 4DOWA 1ZHIA 4JJNK 4DOVA 4BB7A 4KUIA 4KULA 1ZBXA 2FL7A
chains in the Genus database with same CATH superfamily
3QUIA 3HSBA 2RK2A 1OZ2A 2KSSA 5L8RE 2DEUA 2ENMA 1SSFA 3MHXA 4F16A 2AZVA 3I55Q 2E41A 1IGUA 2V1RA 3F70A 3PMIA 4PFPA 1YJWT 1VQNQ 2OTLQ 1CKAA 2F1LA 1YWPA 3GF5A 3JCMd 3M4YA 2XDDA 5GAOr 1UG1A 5A0GA 1K73U 1U1SA 4DA4A 1WZOA 1YITQ 4DEXA 2HNIA 2L89A 2LQKA 2FPFA 3GNGA 2OTJT 1M3BA 4OMPA 4M78G 4WCIA 1Q86R 2HEQA 4QVCA 3J81E 4M7AG 2KXCA 4AFZC 4RTXA 3L2RA 2EJGA 3KBGA 3G71T 3JAME 2Y4YA 2LT1A 3EH2A 3FEOA 2DVEA 4J7IA 2VXEA 4J9GA 3JB9D 1D1BA 4R0KA 2KY9A 3ZFJA 3GNFB 3HHTB 2ZPIB 3GOXA 2KQWA 4N4IA 4Z8AA 3OYEA 3CC4T 4XTUA 1ZHIA 3M53A 1J3TA 2RMOA 3CCJQ 2CUDA 3V8LA 5A0DA 5HK3A 1OEBA 2EQMA 4CC4B 2H8HA 4JLIA 1EIFA 2OAUA 1NLOC 2RQUA 3EHRA 2JMCA 3S6WA 3BFMA 2DXCA 4D6WA 4CC3A 2K6DA 5GANf 3INZA 4HCCA 2KAFA 2K2MA 4M78D 1TWBA 1GFDA 5GAOq 4JRIA 1LPLA 4J7FA 1Q82U 1NM7A 4M78C 2AK5A 3GP8A 4OB3B 5KYXB 4C5GA 4M7AD 3VRYA 2RJCA 1WFWA 2E70A 3I9QA 4M7AC 2JZ2A 2GBQA 3EG3A 2KRSA 2BTTA 1NJIR 3REBB 2LQWA 1M1KU 1QCNA 1AZGB 3M9QA 4LE9A 1FMKA 1HSQA 4ME7A 2K4YA 1JJ2A 5LJ3d 4R56A 3CCRQ 3QPHA 4J9HA 2Y90A 2DM1A 2LP5A 2QEXQ 4PNOA 3TCJA 1GBRA 1Q95G 3QDRB 1VQ4T 1BCOA 4MDXA 1FWZA 2YWWA 3JCMh 4EDUA 2KR3A 3QO3A 3OS2A 1YJ9Q 1YIJQ 1YCSB 2CT3A 2VV5A 2PUOB 5GAMj 1A0NB 1RACB 1HK9A 4QQDA 3BW1A 3H9NA 3CCMQ 4N4GA 4X34A 1K9MC 2EGEA 3UWNA 2RJEA 2OAWA 1PKTA 5GAMg 4PJLA 3CPFA 4J6WA 4NOYA 1WJRA 4FYYB 1K73C 2HL3A 4HCBA 1KD1R 4HT8A 2HZYA 5I22A 1W2BA 4M7DD 2DFUA 2NUTA 4LUDA 1VQ8A 1JXOA 4F7UB 2E3IA 3UATA 4JDSA 4C0DC 1IHVA 3M5AA 2RHXA 3JB9J 1B7TA 3CMEA 1OV3A 4PJOF 3VS6A 4C5EA 3LWIA 1NPRA 1TUDA 4K11A 4IURA 3JB9I 2EFIA 3JRZA 3M54A 2O2OA 2DF6A 4LNPA 2I2LA 1KJWA 1QWFA 3S3MA 5FU6C 3EGUA 2CREA 3JCMQ 1I81A 3JCMX 2EYXA 2H3JA 1Y71A 2RI2A 1QQJA 3CQTA 1SF9A 3OS5A 4E7KA 2VWFA 4MZTA 2WACA 3JCMV 4EMHA 1VQ7Q 1VQ6A 2DL4A 4ZTFA 4C8QG 3FRNA 2EQJA 5GANe 3CCRT 2M16A 4PFZA 3CCVT 2QEXT 4KH1B 1W1FA 3CC2A 1WHGA 2W0ZA 3NTIA 3OSVA 3QWYA 1YJ9T 1IO6A 1PD0A 3A5ZB 1Q81R 4QT7A 3G6EQ 1UUEA 4X9CA 4M7DF 3BDLA 3CCMT 4O6JA 1FYNA 1F1BB 2CZ1B 4BY6B 1M90R 2MWOA 1QKXA 5KYYA 2JOYA 2LCLA 3CMAA 1E6GA 3QG1A 1M1KC 4AFQC 4DOWA 1KQSS 4AFSC 2NYSA 1WLPB 2RJDA 4CI0C 4FYXB 4R55A 5KCOA 1WQWA 3M55A 1ZBJA 1WDXA 3C12A 3A8OB 2XKOC 5GANj 4M77D 2L3RA 1KIKA 4HA8A 1VIEA 2EKOA 4A4EA 4M77C 2D6FA 5KYWB 1O75A 2EWNA 4LN2A 1PCXA 4ZGEB 2JVVA 1QVFA 3L2ZA 5GANg 1PC0A 2ZPHB 4C8QC 5AYFA 3V8KA 3RKYA 2KRNA 4RTVA 2MPXC 2HBWA 2IVWA 2L3QA 3G4SQ 1M9SA 5CKHA 1M27C 4OMMA 2HQXA 2JS2A 3V7SA 3VYGA 2CDTA 4WTOB 4KT0E 1QVGS 1IXDA 2XK0A 1ZSZB 4MZMA 1VQ7T 1RAEB 1N9SA 5LJ5f 4KGXB 2QTVA 1I4K1 4FYWB 2EJ9A 5IHKA 2E6ZA 2WSEE 2QQAA 1I07A 3L2UA 2FRYA 3CCUQ 2FZCB 3X25B 1NPPA 3SWNB 3GIBA 4RMOA 2JS0A 2J7IA 1KHIA 5GAN4 2CZ7B 2DD5A 2DYBA 1NEBA 1BI2A 4JUVA 4EMKC 1ZSGA 3QZ9B 3G6ET 3CCQQ 3TVTA 4WF2A 2JJ9A 2PU9B 2RQVA 5J39A 4P5NA 3EFRA 3LH0A 1UHCA 1GCQC 3QKJA 4BDZA 1BIAA 4IUVA 2AT1B 3EG9A 1N6AA 4M77F 4C92D 4KUDK 4Q5WA 2V8JA 2RHZA 2X3XD 2RK1A 2R57A 3RMSA 1OPKA 2J6FA 1FX7A 2COWA 3JCMc 3MEUA 2IIMA 2HDAA 2JW4A 2DVJA 2EJFA 2JM9A 1YI2A 1CSKA 2E1HA 3BE3A 3MPUB 3NTHA 2D1XA 4EIKA 2L3SA 2X4XA 3EG1A 3GLXA 5GMKh 3M56A 3CC2Q 1R0CB 1ZBXA 2D8HA 1BB9A 1P92A 3CD6Q 1D1AA 1GL5A 2QG9B 3MO8A 2DYIA 3MJXA 3WVEB 3G4ST 1N5ZA 4XTVA 1VYVA 2DBMA 2EYYA 2CKKA 1WXTA 2BZXA 2NUTB 4JRPA 2DZ9A 2YRCA 4AFUC 1VQ9A 2L8DA 1YBYA 3PVLA 1S72Q 1IB8A 4HT9A 2QQ9A 2KI7A 1WGSA 2KE9A 1PKSA 1LVKA 1MMGA 2DTOA 4AG2C 1I5LA 4FT4A 2EQIA 3MEVA 2YUNA 4JZ3A 2ED1A 1IHWA 4V2SA 2LJ3A 4OF1A 2K2VA 4C8QA 2COZA 2LVMA 1I5OB 4C92F 5IXFA 1JEGA 4LXCA 2LX7A 3CCQT 1VQMA 1V29B 2GCXA 2RHIA 3CMET 1KFZA 4FM4B 4D8DA 2MMPA 4QVZA 1VQOQ 3G71Q 1IZ6A 1K9AA 4B6MA 2K5LA 4KGZB 2QAZA 4NS5A 2E10A 3M58A 3CXCA 2ZPFB 1VQLQ 3OSSC 4QQ6A 1QKWA 2BUDA 1AT1B 2EQUA 1PNJA 2DBKA 2LZ6B 3NMZC 3OYGA 2VYTA 2ED0A 2CP5A 2GQIA 2DL3A 3FJ5A 1JQQA 4RCCA 4N0AC 3Q1JA 4ZN3A 2VB6A 4ORZA 1Y07A 1I8FA 1W4SA 3RMQA 9ATCB 1NEGA 4Z88A 1SKUB 5I11A 2QDLA 3FIFA 4JRKA 5CQXA 1G3WA 1PWTA 1ZUYA 1VQ6T 1PSEA 2RO0A 3UDCA 5CQYA 2X9HA 1ZA1B 2XG8D 2LCCA 8AT1B 3FC3A 3V7CA 5IXBA 2EQKA 1H3ZA 4M78B 5CKFA 2K5IA 3CC2T 3CD6T 1YHQQ 3HPWA 1OX8A 4C8QE 4FT2A 5KYYB 2GFUA 4RTTA 1X69A 4M7AB 5LJ5j 2QI2A 4F17A 4IUQA 1WI7A 3HKSA 2SRCA 3BY7A 2MOXA 1D1CA 2KXDA 5GMKl 2LMJA 1KC8R 2CP2A 1TUCA 5LJ5g 4JS4A 1BBZA 1N27A 5LJ3f 5IAYA 1S72T 3CCEA 1IREB 3A8GB 3OBWA 3CMAT 4ZNXA 3LH5A 1WJQA 4HVUA 2V8IA 1JJ2S 3EFOB 3U23A 3O5ZA 1M8VA 2LC4A 1Q7YR 2Y4XA 1JXMA 2QA4Q 4HVWA 3OBYA 3JCMe 1Q86U 3HTRA 1H92A 4PJOG 3H41A 3JV3A 2FYKA 1K9MR 2QK0A 3JCMJ 2RI3A 1VQ4Q 1YCYA 2PZ1A 1VYTA 3FB9A 4A53A 1VQOT 2HKQB 1BI3A 1X01A 1SRMA 4PKCC 3L2VA 5KYWA 4JRQA 3HFNA 2R5MA 1JJ2P 2DAQA 1VQLT 3WXMB 1SSHA 2JUFA 4IKFA 1QP3A 4C0DB 2KYBA 3MEWA 2O9VA 2AHJB 3H0FA 1VQKQ 1TG0A 2MK5A 2FHDA 4M75D 2FRWA 4CC7A 3NGPA 1K1ZA 1U8RA 2DEQA 5DM7R 1X6OA 1YJNA 1ZSZA 4C0ZA 2JN0A 2CZ6B 4L6V5 1UECA 2RF0A 2YUQA 3CPWA 3CBMA 3VKIA 4KRTA 4IUPA 5FU6B 1U06A 1YHQT 3QWXX 3MEAA 3OYDA 2P4TA 4E7HA 1M8MA 2O31A 3EG9B 3G7ZA 3LGLA 1MGQA 3LLRA 3SWNA 4M7DG 1GBQA 4M4ZA 3G1JA 3UA6A 3DB3A 2HQHA 4B9XA 2X4YA 2IG0A 4BE2A 4PJOD 5GAMd 4F04B 1OOTA 4PJOC 1M1FA 1X6BA 4XTWA 5I2SA 2VGMA 4MMKA 1WYXA 3PT9A 2R58A 1NJIU 1SHGA 2R5AA 2LJ1A 2PTKA 2ECZA 2V8KA 2ZZDA 1OPLA 1N9RA 4XQ3A 2LJ0A 2QA4T 4DBQA 3VS3A 2KMTA 2PQWA 3CCVQ 2EBPA 1ZUUA 2GQVA 1SRLA 1B34B 5LJ3e 2PVGB 3X24B 1VQPA 2CP3A 4XTZA 1YI2T 2L2PA 2DL8A 3OS0A 1FXXA 3QJ6A 4M75F 4NL3A 1T3LA 5FWBA 5ECAA 2EAYA 4OGCA 2DETA 3I56A 2DTHA 4A63B 1AVZC 4C0GA 2SEMA 4Y28E 3UF4A 1LJOA 3CEYA 2BE9B 3DKMA 3NHNA 4LUEA 5J26A 3LWHA 3X28B 1FMWA 1VQKT 4UC4A 2EPDA 1KD1U 3MP1A 2O88A 3H6ZA 2A36A 2KRMA 3CBPA 4M77B 2O9SA 3EGDA 1I1JA 2E3HA 3A8HB 3CCSA 1RABB 2ROTA 4A4KA 4DOVA 4BE1A 4M7DC 1VQ9T 2K3YA 1MMDA 4C8QB 1WPYA 1AEYA 1ACMB 2L3PA 4FU6A 3E19A 1OU9A 2FVUA 1YWOA 4DBRA 5LJ3j 2LTOA 2NWMA 1NG2A 3VJPA 4QKUA 3PE0A 4RUGA 5GAOl 4HVVA 3M0QA 3RR6A 4FW1A 1VQMT 2LDMA 1UFFA 5LJ3g 4KULA 2VXFA 2EGCA 4PLIA 1OI1A 4J5YA 4XU0A 4M77G 3SFMA 2MIOA 5GAOn 3RDVA 3VS2A 1QVFP 1M4ZA 1Y96B 4GBQA 4MZPA 3QSUA 3WVDB 3OW2S 2D0QB 4EMKB 5GAMh 2C06A 2E12A 4N4HA 1JU5C 1XNIA 3TREA 2LNVA 5GANd 5CKDA 2LT4A 4L5GA 2EYWA 1Q81U 2P0KA 1UDLA 1X27A 1RI0A 1UGRB 2YRVA 4KBMB 3E9GA 2CSIA 4LDXA 1NLPC 3OW2P 1Q82C 1PSFA 2YRDA 1M90U 4M78A 3OYMA 2RN8A 4X1VA 5FRNA 1K0XA 2X4WA 2JTFA 4F14A 3C4SA 1AHJB 4M7AA 1K76A 1YP5A 4LDVA 1OULA 2AKLA 1E6HA 1C6VX 2K3BA 1Y0MA 2BZYA 1RADB 2RQTA 3OMGA 4PLLA 3VV0A 1YJWA 2B8AA 2XIDA 2FZGB 2QXFA 5IN1A 2D9TA 4LD6A 4E6RA 4DEYA 4BE0A 1H641 3EFOA 2GF7A 2MYSA 4OMLA 4XK8E 5CK9A 4C92G 1WHJA 2Z0WA 2OTJA 4J83A 4II1A 2KBTA 5HKCA 4OGEA 3UT1A 3HRTA 2CH4A 5FU7C 1WX6A 1XQHA 3SEMA 3RBBB 1TS9A 4XU2A 3M0SA 5IT9E 1ARKA 1VIFA 5D6XA 4M78E 2HSEB 4ELYC 3VUZA 2DLPA 3E9FA 3QHSA 3QIIA 2NLUA 2QGFB 4M7AE 4M7DA 3OYJA 4J9IA 4Y92A 2CS7A 2H3EB 1K8AR 4HXJA 2MCNA 3H0IA 3EFSA 1NYGA 1OYXA 1N8RR 3M4GA 1FMVA 4FL6A 2C0OA 3TEEA 3L1AA 1YFNA 4J6XA 1OU8A 4QW2A 3CC4A 3AHUA 1VQ8Q 2BE7D 4A4GA 4BDYA 3CCLA 5GJVB 1D0ZA 1DJ7B 2V1QA 4JPBW 2LRQA 2RJFA 5HY6A 2C0IA 3CMEQ 1M2OA 3ZBDA 2CSQA 2DXUA 1MNDA 2O01E 1WXUA 3I5SA 3OYCA 4FYVB 5GANh 3OYBA 3M0RA 3OYHA 4RG2A 2FPEA 3QXEB 4OB1B 4JJNK 1MUZA 2X51A 4C92C 1WHLA 2G3RA 3FDRA 1BI1A 2M51A 3I5RA 1X43A 3I55A 2EIFA 2LX9A 3PVQA 3J7AF 5HCKA 5GAOp 1JRIA 5GAOm 4DBHA 1VQNA 4OVAA 2OTLA 4M7DE 2DD4A 3DB4A 3L2QA 3NPFA 4KGVB 3S3OA 2XI9A 1AWWA 1X75C 1Q81C 1YN8A 1VQ6Q 2RQWA 2FZKB 1KG1A 1JO8A 1YITA 2KROA 2DJZA 4F7UF 1D3BB 1KQSA 1BU1A 2DX1A 1R8OB 4ELZC 1C0MA 1UGVA 2JMAA 2LNHB 2E5QA 2HD0A 1B34A 4XAXB 2BKDN 2IPOB 1UHFA 3TSZA 1TOVA 1ZX6A 3L42A 3EGDB 3JCMf 3ULRB 3M0TA 3BDUA 4PL6A 3N5BB 3M0PA 3I56T 1VA7A 1UGPB 3NTKA 4FCYA 2DNUA 3M57A 2P4RA 3CMAQ 2K5FA 1XOVA 4OMNA 3VS5A 6AT1B 4M77A 1MV0B 2A08A 1VQ8T 5CAIA 2HSPA 1QVGA 2D8JA 4IUUA 2YSQA 3CCJA 3FJPA 1M2VA 2DIQA 3CC7A 2CP0A 1KK7A 1H8KA 4BI4A 1G2BA 2XDPA 3THKA 1ABOA 2ZPBB 2DE0X 4JZ4A 5LJ5d 1RL2A 2J05A 3EG0A 3RUXA 3OYYA 1UJYA 3IQLA 1PRLC 2E64A 3PNWC 1O9SA 4FW2A 1HJDA 1GXIE 4RKUE 2X3WD 3SDZA 2JT4A 1VQ5A 1Y96A 1Y7XA 3QJYA 4TVRA 2QTXA 5EG2A 2J6KA 4RTUA 3CCRA 1WNLA 1K0SA 4M77E 2A37A 4EMKA 4E7ZA 2QEXA 4QVDA 2DIGA 4PJOB 3DLLA 4XTYA 4LDWA 3SHWA 1C1AA 1GCQA 2GGRA 4M75G 3KUFA 1YJ9A 1KHCA 5KH6A 1KC8U 1UGQB 1YIJA 3CPWP 1HD3A 2ZGWA 3PFSA 2VKNA 4C92A 3OMCA 2VGNA 1VYUA 2QQRA 3CCMA 2DILA 2WSFE 2M9UA 3UPUA 1BI0A 3OS1A 3P8DA 4L59A 1HXDA 5L23A 4VUBA 2QQSA 4J9FA 2DK3A 2DRKA 2QYZA 1Q7YU 3H8ZA 1EX4A 1QVPA 3A8MB 5M9OA 3C0CA 3HP9A 3SD4A 4YTLA 3OYKA 2RNAA 2YXYA 8ATCB 1G5VA 4J9DA 1K9MU 5GAN6 1RI9A 2FEIA 2E6NA 2EYZA 1SHFA 3TU4K 1Y57A 1YI2Q 2COYA 2O4XB 3O8VA 1R77A 4JS5A 2M0OA 1K73R 2ATCB 2HAXA 4RCBA 2YUPA 2G6FX 2JTMA 4IUTA 4M7DB 2XD0A 4B9WA 1LOJA 2FL7A 2BIVA 5CCAA 3QBYA 4J8OA 2K7AA 4C92E 3V8JA 2PVDB 2RI5A 1W2BS 1M3CA 3FLGA 4M75C 1WHMA 5LJ5h 4E7LA 1G3YA 1VQ7A 3JCMb 2DTIA 1QP2A 1VQ9Q 2J06A 1MV3A 2KDSA 3OYAA 5GAN8 3A8LB 3UA7A 1CKBA 1WJSA 2GTOA 2F2WA 4A4FA 4OMFB 1TTHB 2ZCFB 1B07A 2ZAEA 3AT1B 2F69A 1IRXA 3QYGB 5IHIA 2LQ8A 2FG0A 2B86A 2YT6A 1XTDA 4IIOA 3PTAA 1W2BP 4FSXA 3CCLT 3JCMg 1RLQC 2FB7A 2KK4A 2YHTA 3G6EA 1VQMQ 3LX7A 3CC7Q 2F2XA 1X2KA 2WSCE 3URGA 4ANJA 4DQ2A 1AZEA 3HFOA 3VUBA 4ZTJA 4N0AA 4BUGA 2EW3A 5A2QE 1NE8A 2ZPGB 4E2FB 1W70A 2RPNA 5GAMe 4A54A 2KVQG 5C0MA 3R6NA 2K79A 3OYFA 2NUPB 2EVRA 4BACA 1LNXA 3I55T 2XDBA 1M1GA 1JBMA 1D0XA 1Q82R 2E4HA 4DBFA 1VQNT 2OTLT 3NFCA 5DY9A 4CRIA 1OZ3A 3X26B 1U3OA 1BKBA 1AWXA 1VQ5Q 1UJ0A 1KC8C 2HQEA 2HKNA 5D6YA 2QASA 1YITT 1M1KR 4HCZA 4QQGA 1GRIA 1D3BA 4JLGA 3P8HA 3RNJA 3QYHB 1ABQA 3LYIA 1U1TA 2M02A 5IH2A 3EHQA 5D7UA 3JB9F 1TU0B 4XU1A 3G4SA 2CH4W 1OX9A 3T9NA 4C5HA 1VOMA 1Q7YC 4MDWA 1SEMA 2RH2A 2VVKA 4HKEA 4X9DA 1U5SA 5KYUB 4OP0A 5FWCA 1PD1A 1V1CA 1Q86C 4ESRA 5J3BA 1M2VB 4RG8A 3CCEQ 2LQNA 2AIRB 5GMKm 2J6OA 3DLMA 1KSWA 4Y91A 2PNIA 2AKKA 5FU7B 4KH0B 3MP6A 1WIEA 2F2VA 1AWOA 2DRMA 1WA7A 2YLBA 1QVFS 2A28A 3CCUA 2AZSA 2VASA 2CP7A 3TQ7P 2DL5A 4A4HA 3LW5E 2OI3A 3CCJT 3H0HA 3QZ5B 3PIPA 4LDYA 1M5Q1 2GTJA 3CCQA 1JB0E 3A98A 3HRUA 5DLQE 2CT4A 3CC7T 2P0QA 4M78F 1EZZB 2DERA 1KQ1A 4J9CA 4M7AF 4EPCA 1PG5B 1BYMA 2I0NA 4O5VA 1WQ7A 3EG2A 1QLYA 2XU8A 4PK4A 3X20B 1D09B 5GJWB 3KXTA 4M75A 2K57A 3VYHB 1GFCA 1ZLMA 2FO0A 4ZGJB 4E7JA 2XHCA 4LDUA 2DMOA 3VS7A 1G8XA 3MKDA 4PFOA 5FROA 2JM8A 3OA6A 4OB2B 1XJWB 4FSSA 3JB9H 1RAAB 3EGXA 2PUKB 2XICA 4PJJA 2MWPA 4D8KA 4F7UG 5GAN3 1YJNQ 1VQ5T 3VS0A 1WHHA 3RKXA 5FW9A 1EFNA 3D7SB 2JXBA 4E7SA 1T0JA 4E47A 1TUGB 2HMAA 4BD3A 1MMAA 3P8BB 4Z02A 2K3XA 4C92B 2EKHA 2HL5C 1LCKA 2E5KA 3CD6A 4PJOA 4NL2A 1H3HA 2XMFA 1NJIC 2F5KA 1NZ9A 3JSCA 1YIJT 5KE2A 2DL7A 3ZEHA 5LJ3h 4PJNA 3REAB 1E7OA 3OY9A 2QGGA 4BB7A 1QWEA 1X2QA 4OMOA 4M75E 1S72A 4AG1C 4HCKA 3CCET 3OYIA 2CZ0B 2KT1A 1RAIB 4XTXA 2PVOB 3CBOA 2HBPA 1S1NA 2RHYA 3RESA 5GMKe 1PRMC 1T0HA 2GFAA 2FPDA 5I21A 1WHKA 1PM3A 4BI8B 3MP8A 5CO7A 3ER0A 1M30A 2M1HA 1SG5A 1VQPQ 3HRSA 1KD1C 2JTEA 2C0TA 3G71A 1VQOA 2QQBA 3META 2O4XA 4C8QD 1K4US 4PJOE 1YNZA 1VQLA 1KQSP 1R0BG 2MF2A 2M0YA 2CYZB 4ZN1A 1G83A 1UTIA 2ABLA 3GBQA 2MI6A 1G3SA 3I56Q 1K8AU 5GAN2 4J6YA 4KUIA 2A0FB 5HK0A 1UB4A 1N8RU 2LCSA 1QMCA 5A0LA 2CP6A 1ZUKA 4GLMA 4JJDA 4JJCA 2RA2A 1MNEA 1D0YA 1VUBA 3CCSQ 2W10A 1YJNT 2JNGA 3MCAB 2L5QA 5GMKj 1T3SA 1NYFA 2DXBA 1W6XA 1IGQA 4PJMA 2DJQA 2DPPB 2ROLA 3OW2A 5CR2A 4RTZA 2YUOA 1OQKA 3QDFA 1HYOA 4CC2A 1WXBA 2VC8A 1YHQA 2ESWA 3CXCS 3R6OA 2L0AA 3C94A 5CKEA 1G3TA 2KT8A 2K9GA 1QVGP 2RB6A 4E7IA 4IIMA 3RKWA 3RERA 1I0CA 2RHUA 3VS1A 3GPLA 4XU3A 2MAMA 1Z9ZA 2DA9A 1GCPA 5IHNA 4AMCA 4JJBA 2E65A 4OB0B 2D0NA 3CXCP 3OYNA 2DZCA 3ME9A 5C6SA 2NUPA 1PHTA 1V76A 2RM4A 2V26A 2X4JA 2P84A 2CUBA 4ZGDB 2QA4A 5D6WA 2HCKA 2YDLA 4C8QF 1NBEB 4BY6C 1QCFA 1M3AA 1M90C 5KYXA 2YLCA 4RTYA 2CGHA 1AD5A 1MMNA 5GAN5 4C0FA 1VQ4A 2NUZA 1VQPT 5KE3A 4ATOA 4OMQA 2DXTA 4GY5A 3TSWA 4AT1B 5I2MA 2EYQA 2KGTA 2VUBA 4FIBA 3C95A 3EH1A 1B3QA 2X35A 5GAN7 4J9EA 5KYNA 2KYMA 1VQKA 1MHNA 2DKGA 3HL8A 4J9BA 3JCMW 4MMLA 4EMGA 3S3NA 5KYUA 3CCST 3ASKA 1X6GA 3PMTA 1BCMA 1AOJA 2BZ8A 3KFVA 1YJWQ 1UE9A 3A1PA 2RQRA 4Z89A 7AT1B 3OB9A 5LL6S 1RLPC 2F5TX 5EC7A 3ZL7C 3CCUT 5AT1B 1ZSZC 1RAGB 4F7UA 4M75B 2OTJQ 1TSFA 3OYLA 1K8AC 1QCOA 2RD1A 2DO3A 1QW1A 1BIBA 3E1SA 5LJ5e 2A3LA 1N8RC 2A7YA 5CVIA 1UEBA 1KQ2A 1TH7A 1RAFB 1Z9QA 1TXQA 1BK2A 5CIUA 3EGXB 3SWNC 3PIOA 3LGFA 3OQ5A 5FRMA 5FLXE 3L2WA 3CPWS 3VU3C 3SB2A 1ZA2B 3VS4A 1RUWA 3RIRA 3PGGA 4GLKA 2GNCA 3J80E 4RTWA 3CCVA 1ZQ1A 2ZPEB 4C5IA 3JCMP 2KEAA 2EGAA 2OJ2A 3EAEA 5GAMf 4LD9K 3I35A 5CKBA 5GMKi 5KCHA 3CC4Q 3VRZA 5DLOA 3CCLQ 1AWJA 1SPKA 3M0UA 1UGSB 3M59A 2KNBB 4BI3A 3V7RA 2QDYB 3JB9G 2P0PA 3E2UA 1RAHB 4F7UE 2OX7A
chains in the Genus database with same CATH topology
3QUIA 2OTLT 3NFCA 2X4WA 2JTFA 5DY9A 4CRIA 3C4SA 3HSBA 1AHJB 2RK2A 1OZ3A 1OZ2A 3X26B 1BKBA 2EJFA 2KSSA 1VQ5A 4M7AA 1KC8C 2HQEA 5D6YA 1YI2A 2E1HA 5L8RE 1YITT 4HCZA 1SSFA 4LDVA 4QQGA 3MHXA 3NTHA 1D3BA 4JLGA 4M7DE 3P8HA 3QYHB 2E41A 2X4XA 3GLXA 3LYIA 5GMKh 1U1TA 3F70A 3M56A 3OMGA 3PMIA 4PLLA 1ZBXA 3VV0A 1P92A 2B8AA 1YJWA 1YJWT 3JB9F 4XU1A 2XIDA 3MO8A 3G4ST 3WVEB 3G4SA 2QXFA 3T9NA 3GF5A 5IN1A 2D9TA 4LD6A 4XTVA 4C5HA 3JCMd 2CKKA 3M4YA 2XDDA 5GAOr 1Q7YC 4MDWA 4BE0A 2RH2A 1H641 5A0GA 1K73U 1U1SA 4DA4A 4HKEA 2GF7A 4X9DA 4XK8E 4OP0A 5CK9A 4C92G 2HNIA 2L89A 2LQKA 4JRPA 2DZ9A 3GNGA 2OTJA 2OTJT 4J83A 4II1A 1Q86C 1VQ9A 2L8DA 4M78G 1YBYA 5HKCA 5J3BA 4OGEA 3UT1A 4QVCA 4RG8A 4HT9A 5GMKm 3HRTA 5FU7C 2QQ9A 3DLMA 3J81E 4M7AG 4Y91A 1WGSA 5FU7B 3MP6A 1XQHA 2DTOA 3L2RA 2EJGA 3KBGA 3G71T 3JAME 1I5LA 2Y4YA 2LT1A 4XU2A 2YLBA 4FT4A 5IT9E 1QVFS 3FEOA 1VIFA 2DVEA 3MEVA 4M78E 5D6XA 4ELYC 3CCUA 4J7IA 3VUZA 1K73C 2VXEA 3E9FA 3QHSA 3QIIA 2NLUA 4A4HA 3LW5E 4V2SA 3JB9D 4OF1A 2K2VA 4M7AE 4C8QA 3CCJT 4M7DA 3QZ5B 2LVMA 3PIPA 2KY9A 3ZFJA 4C92F 3OYJA 4LDYA 1M5Q1 3GNFB 3CCQT 3HHTB 1V29B 3CCQA 1JB0E 2GCXA 2CS7A 2RHIA 2ZPIB 3HRUA 5DLQE 3CMET 3CC7T 4FM4B 3GOXA 2P0QA 4M78F 2KQWA 1KQ1A 2MMPA 3EFSA 4QVZA 1OYXA 3M4GA 1IZ6A 4M7AF 4EPCA 1BYMA 2K5LA 4FL6A 4N4IA 1WQ7A 4O5VA 4NS5A 3TEEA 2E10A 2XU8A 3M58A 3L1AA 3CXCA 4J6XA 3X20B 2ZPFB 4QW2A 3OYEA 3CC4T 3CC4A 3AHUA 3OSSC 3KXTA 4A4GA 4M75A 2K57A 4QQ6A 4XTUA 4BDYA 1ZHIA 3M53A 3VYHB 3CCLA 2BUDA 4ZGJB 4E7JA 1DJ7B 2EQUA 2XHCA 4LDUA 3OYGA 3V8LA 2VYTA 2LRQA 5A0DA 2RJFA 5HY6A 5HK3A 2EQMA 5FROA 4RCCA 4N0AC 3Q1JA 3OA6A 4JLIA 4ZN3A 1EIFA 2OAUA 3ZBDA 1Y07A 1I8FA 1W4SA 2DXUA 3RMQA 4OB2B 2O01E 3JB9H 3OYCA 3S6WA 3FIFA 4JRKA 5GANh 5CQXA 3OYBA 1G3WA 2PUKB 2XICA 2MWPA 3BFMA 4F7UG 5GAN3 4RG2A 3OYHA 2DXCA 1VQ5T 4D6WA 1VQ6T 3RKXA 1PSEA 2RO0A 3UDCA 3QXEB 4OB1B 4JJNK 5CQYA 5GANf 3INZA 4E47A 2XG8D 2KAFA 2LCCA 4HCCA 4C92C 2G3RA 3FDRA 4BD3A 4M78D 3P8BB 4Z02A 2K3XA 3V7CA 1BI1A 4JRIA 5GAOq 4C92B 4J7FA 3I55A 3FC3A 1Q82U 2EIFA 2LX9A 4M78C 3J7AF 2EQKA 1H3ZA 5GAOp 3GP8A 1JRIA 4OB3B 4C5GA 4M7AD 4M78B 5CKFA 2K5IA 5GAOm 3CC2T 3CD6A 2RJCA 3CD6T 4PJOA 1VQNA 2E70A 3HPWA 4NL2A 4OVAA 2OTLA 4C8QE 2JZ2A 1NJIC 2DD4A 4FT2A 3DB4A 3L2QA 2GFUA 4M7AC 2F5KA 3S3OA 4M7AB 5LJ5j 1NZ9A 2XI9A 2QI2A 4IUQA 1X75C 1Q81C 3HKSA 1M1KU 3BY7A 3JSCA 1YIJT 5KE2A 3M9QA 1KG1A 1YITA 5GMKl 4F7UF 2DJZA 4ME7A 2K4YA 1JJ2A 3ZEHA 1D3BB 5LJ3d 5LJ3h 4R56A 3QPHA 3OY9A 4BB7A 2Y90A 1KQSA 5LJ5g 4JS4A 1R8OB 4ELZC 1N27A 5LJ3f 5IAYA 4M75E 1S72T 1S72A 4PNOA 3TCJA 3CCEA 3OYIA 3CCET 2CZ0B 2E5QA 2HD0A 4XTXA 1B34A 1IREB 2HBPA 2PVOB 3A8GB 3CBOA 3OBWA 3QDRB 1VQ4T 4XAXB 3CMAT 2RHYA 1FWZA 4MDXA 3RESA 3JCMh 2BKDN 4EDUA 1WJQA 5GMKe 2V8IA 3QO3A 3OS2A 3L42A 1JJ2S 2GFAA 1M8VA 2LC4A 5I21A 2VV5A 2Y4XA 3JCMf 2PUOB 4BI8B 5GAMj 3OBYA 3JCMe 1HK9A 4QQDA 3BW1A 3MP8A 3BDUA 1Q86U 4PL6A 5CO7A 3N5BB 4PJOG 3I56T 1UGPB 4N4GA 4X34A 3UWNA 1K9MC 3NTKA 2RJEA 3ER0A 2M1HA 2FYKA 3JCMJ 2RI3A 3M57A 5GAMg 1YCYA 2K5FA 1XOVA 3CPFA 3HRSA 4J6WA 1KD1C 4NOYA 1WJRA 3FB9A 4A53A 3G71A 1VQOT 1VQOA 1BI3A 1X01A 2QQBA 3META 4PKCC 3L2VA 4HT8A 4JRQA 4HCBA 4M77A 1W2BA 2O4XA 4C8QD 4M7DD 3HFNA 2R5MA 4PJOE 2DAQA 1VQLA 1VQLT 1VQ8T 1VQ8A 5CAIA 4F7UB 1QVGA 2MF2A 4JDSA 2CYZB 3WXMB 4C0DC 4ZN1A 2MI6A 2JUFA 4IUUA 4IKFA 1G3SA 3M5AA 1QP3A 3FJPA 4C0DB 5GAN2 3CCJA 1K8AU 2DIQA 4J6YA 4KUIA 2RHXA 3MEWA 3JB9J 5HK0A 3CC7A 1UB4A 3CMEA 2AHJB 4PJOF 1N8RU 4BI4A 2FHDA 5A0LA 4M75D 2XDPA 4C5EA 3LWIA 2RA2A 1U8RA 1VUBA 2DEQA 1NPRA 2ZPBB 4IURA 5DM7R 1X6OA 5LJ5d 1YJNT 1YJNA 3JB9I 2EFIA 2JNGA 1RL2A 4C0ZA 3MCAB 2JN0A 2L5QA 3JRZA 3M54A 2CZ6B 5GMKj 4L6V5 3OYYA 2I2LA 3RUXA 2DXBA 3CPWA 2E64A 2DPPB 3PNWC 3OW2A 3CBMA 3S3MA 3VKIA 5FU6C 5CR2A 1O9SA 4IUPA 5FU6B 2VC8A 3JCMQ 1GXIE 1I81A 4RKUE 1YHQT 1YHQA 3JCMX 3CXCS 2H3JA 3MEAA 1Y71A 3R6OA 3OYDA 3C94A 2P4TA 2RI2A 5CKEA 3OS5A 3SDZA 4E7HA 1G3TA 4E7KA 4MZTA 2WACA 3JCMV 1Y96A 3G7ZA 3LGLA 1MGQA 1Y7XA 3LLRA 3SWNA 4EMHA 3QJYA 4ZTFA 4C8QG 1VQ6A 4M7DG 3FRNA 2QTXA 4TVRA 5EG2A 2RB6A 2EQJA 4E7IA 3DB3A 4B9XA 2X4YA 2IG0A 4BE2A 4PJOD 5GANe 1WNLA 2M16A 5GAMd 3RKWA 3CCRT 3CCRA 4M77E 2RHUA 4EMKA 3CCVT 3RERA 3GPLA 4PJOC 4XU3A 2MAMA 2QEXA 2QEXT 1M1FA 4XTWA 4QVDA 2DIGA 4PJOB 3DLLA 5I2SA 2VGMA 4MMKA 3CC2A 4XTYA 3PT9A 4LDWA 2R58A 1NJIU 2E65A 2R5AA 4OB0B 4M75G 3OYNA 2DZCA 2V8KA 2ZZDA 3KUFA 3NTIA 3OSVA 3ME9A 1N9RA 1KHCA 1YJ9T 1YJ9A 5C6SA 5KH6A 1KC8U 1UGQB 2RM4A 4XQ3A 3A5ZB 2X4JA 1YIJA 4ZGDB 1VQMA 2QA4T 2QA4A 2ZGWA 5D6WA 4X9CA 3PFSA 4C92A 4C8QF 4M7DF 3OMCA 2KMTA 2PQWA 2VGNA 2QQRA 3BDLA 4BY6C 3CCMT 3CCMA 2WSFE 4O6JA 1M90C 2YLCA 2CZ1B 4BY6B 2CGHA 2M9UA 2GQVA 3UPUA 1BI0A 2MWOA 3P8DA 3OS1A 5GAN5 1B34B 4C0FA 5LJ3e 2PVGB 4L59A 2JOYA 3X24B 1VQ4A 2LCLA 1HXDA 3CMAA 1VQPA 4VUBA 1VQPT 3QG1A 2QQSA 4XTZA 2DK3A 1M1KC 5KE3A 1YI2T 1Q7YU 4ATOA 2DXTA 4GY5A 3OS0A 3H8ZA 5I2MA 2EYQA 1QVPA 1FXXA 4DOWA 3QJ6A 3A8MB 4M75F 1KQSS 2VUBA 5M9OA 3HP9A 3SD4A 4NL3A 4FIBA 3C95A 4CI0C 2RJDA 4R55A 4YTLA 3OYKA 2EAYA 4OGCA 5KCOA 2X35A 3I56A 5GAN7 1WQWA 2DTHA 3M55A 1G5VA 4C0GA 1K9MU 4Y28E 3C12A 3A8OB 2XKOC 5GAN6 1LJOA 3CEYA 3DKMA 5GANj 5J26A 2E6NA 2L3RA 4M77D 3LWHA 3X28B 1VQKT 1VQKA 4HA8A 4UC4A 1VIEA 2EKOA 3TU4K 4A4EA 1KD1U 1MHNA 2DKGA 4M77C 3HL8A 3MP1A 3JCMW 3H6ZA 2D6FA 4MMLA 3CBPA 1O75A 4M77B 2O4XB 3O8VA 4EMGA 2EWNA 4JS5A 3S3NA 2M0OA 4ZGEB 3A8HB 2JVVA 3ASKA 3CCSA 3L2ZA 3CCST 5GANg 1QVFA 2HAXA 4RCBA 4A4KA 2ZPHB 4C8QC 4DOVA 4BE1A 1VQ9T 4M7DC 2JTMA 3PMTA 4IUTA 5AYFA 2K3YA 4C8QB 2XD0A 4M7DB 3V8KA 4B9WA 1LOJA 3RKYA 1WPYA 2IVWA 2FL7A 2BIVA 5CCAA 3QBYA 4J8OA 1M9SA 5CKHA 4C92E 2HQXA 4FU6A 3V8JA 3OB9A 2PVDB 2RI5A 3E19A 5LL6S 1W2BS 3V7SA 2FVUA 3VYGA 3FLGA 2F5TX 3CCUT 4KT0E 5LJ3j 4M75C 1QVGS 2LTOA 5LJ5h 2XK0A 4E7LA 4F7UA 1G3YA 4M75B 4MZMA 1VQ7T 3JCMb 1VQ7A 2DTIA 3VJPA 1QP2A 3OYLA 5GAOl 1K8AC 2KDSA 3OYAA 1N9SA 5GAN8 5LJ5f 3A8LB 4A4FA 2LDMA 1WJSA 2RD1A 1VQMT 2DO3A 1QW1A 1BIBA 4OMFB 2ZCFB 3E1SA 5LJ3g 4KULA 5LJ5e 2VXFA 2A3LA 1N8RC 1I4K1 2F69A 2A7YA 2EJ9A 5CVIA 3QYGB 4PLIA 1OI1A 4J5YA 2E6ZA 2WSEE 2LQ8A 4XU0A 2QQAA 1UEBA 4M77G 1KQ2A 1TH7A 3SFMA 1XTDA 3L2UA 3PTAA 5CIUA 3SWNC 3PIOA 5GAOn 3LGFA 4FSXA 3X25B 1NPPA 1M4ZA 1Y96B 3SWNB 4MZPA 3CCLT 3GIBA 3OQ5A 3JCMg 4RMOA 5FLXE 3L2WA 3CPWS 3VU3C 5FRMA 3SB2A 1KHIA 3QSUA 5GAN4 2FB7A 2CZ7B 2DD5A 2KK4A 2YHTA 3WVDB 3OW2S 2D0QB 1BI2A 4JUVA 3RIRA 4EMKC 3QZ9B 3G6EA 3G6ET 3PGGA 3LX7A 4GLKA 4WF2A 3J80E 4EMKB 5GAMh 2PU9B 2WSCE 3URGA 2C06A 3CCVA 4DQ2A 1ZQ1A 3HFOA 2ZPEB 5J39A 4P5NA 2E12A 4C5IA 3JCMP 3VUBA 3EFRA 4ZTJA 4N0AA 4N4HA 3LH0A 4BUGA 3EAEA 1XNIA 3TREA 5GAMf 5A2QE 3QKJA 1NE8A 2LNVA 4LD9K 4BDZA 1BIAA 2ZPGB 5CKBA 5GAMe 5CKDA 5GANd 4A54A 4IUVA 2LT4A 4L5GA 5GMKi 5KCHA 2KVQG 5C0MA 1N6AA 4M77F 2P0KA 4C92D 5DLOA 3OYFA 4Q5WA 4BACA 2V8JA 1Q81U 4KUDK 2RHZA 1RI0A 1UGRB 1UGSB 2YRVA 3M59A 2RK1A 4KBMB 3V7RA 2R57A 4BI3A 2QDYB 3E9GA 3RMSA 1LNXA 4LDXA 3JB9G 3I55T 2XDBA 1FX7A 1M1GA 1Q82C 1JBMA 2P0PA 1PSFA 1M90U 3JCMc 4F7UE 3MEUA 4M78A 3OYMA 1VQNT 5FRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4S A;  4LD9 K;  3PT9 A;  4FT2 A;  3TU4 K;  2FVU A;  3PTA A;  4FT4 A;  4DA4 A;  4FSX A;  1M4Z A;  4KUD K;  4DOW A;  1ZHI A;  4JJN K;  4DOV A;  4BB7 A;  4KUI A;  4KUL A;  1ZBX A;  2FL7 A; 
#chains in the Genus database with same CATH topology
 3QUI A;  3HSB A;  2RK2 A;  1OZ2 A;  2KSS A;  5L8R E;  2DEU A;  2ENM A;  1SSF A;  3MHX A;  4F16 A;  2AZV A;  3I55 Q;  2E41 A;  1IGU A;  2V1R A;  3F70 A;  3PMI A;  4PFP A;  1YJW T;  1VQN Q;  2OTL Q;  1CKA A;  2F1L A;  1YWP A;  3GF5 A;  3JCM d;  3M4Y A;  2XDD A;  5GAO r;  1UG1 A;  5A0G A;  1K73 U;  1U1S A;  4DA4 A;  1WZO A;  1YIT Q;  4DEX A;  2HNI A;  2L89 A;  2LQK A;  2FPF A;  3GNG A;  2OTJ T;  1M3B A;  4OMP A;  4M78 G;  4WCI A;  1Q86 R;  2HEQ A;  4QVC A;  3J81 E;  4M7A G;  2KXC A;  4AFZ C;  4RTX A;  3L2R A;  2EJG A;  3KBG A;  3G71 T;  3JAM E;  2Y4Y A;  2LT1 A;  3EH2 A;  3FEO A;  2DVE A;  4J7I A;  2VXE A;  4J9G A;  3JB9 D;  1D1B A;  4R0K A;  2KY9 A;  3ZFJ A;  3GNF B;  3HHT B;  2ZPI B;  3GOX A;  2KQW A;  4N4I A;  4Z8A A;  3OYE A;  3CC4 T;  4XTU A;  1ZHI A;  3M53 A;  1J3T A;  2RMO A;  3CCJ Q;  2CUD A;  3V8L A;  5A0D A;  5HK3 A;  1OEB A;  2EQM A;  4CC4 B;  2H8H A;  4JLI A;  1EIF A;  2OAU A;  1NLO C;  2RQU A;  3EHR A;  2JMC A;  3S6W A;  3BFM A;  2DXC A;  4D6W A;  4CC3 A;  2K6D A;  5GAN f;  3INZ A;  4HCC A;  2KAF A;  2K2M A;  4M78 D;  1TWB A;  1GFD A;  5GAO q;  4JRI A;  1LPL A;  4J7F A;  1Q82 U;  1NM7 A;  4M78 C;  2AK5 A;  3GP8 A;  4OB3 B;  5KYX B;  4C5G A;  4M7A D;  3VRY A;  2RJC A;  1WFW A;  2E70 A;  3I9Q A;  4M7A C;  2JZ2 A;  2GBQ A;  3EG3 A;  2KRS A;  2BTT A;  1NJI R;  3REB B;  2LQW A;  1M1K U;  1QCN A;  1AZG B;  3M9Q A;  4LE9 A;  1FMK A;  1HSQ A;  4ME7 A;  2K4Y A;  1JJ2 A;  5LJ3 d;  4R56 A;  3CCR Q;  3QPH A;  4J9H A;  2Y90 A;  2DM1 A;  2LP5 A;  2QEX Q;  4PNO A;  3TCJ A;  1GBR A;  1Q95 G;  3QDR B;  1VQ4 T;  1BCO A;  4MDX A;  1FWZ A;  2YWW A;  3JCM h;  4EDU A;  2KR3 A;  3QO3 A;  3OS2 A;  1YJ9 Q;  1YIJ Q;  1YCS B;  2CT3 A;  2VV5 A;  2PUO B;  5GAM j;  1A0N B;  1RAC B;  1HK9 A;  4QQD A;  3BW1 A;  3H9N A;  3CCM Q;  4N4G A;  4X34 A;  1K9M C;  2EGE A;  3UWN A;  2RJE A;  2OAW A;  1PKT A;  5GAM g;  4PJL A;  3CPF A;  4J6W A;  4NOY A;  1WJR A;  4FYY B;  1K73 C;  2HL3 A;  4HCB A;  1KD1 R;  4HT8 A;  2HZY A;  5I22 A;  1W2B A;  4M7D D;  2DFU A;  2NUT A;  4LUD A;  1VQ8 A;  1JXO A;  4F7U B;  2E3I A;  3UAT A;  4JDS A;  4C0D C;  1IHV A;  3M5A A;  2RHX A;  3JB9 J;  1B7T A;  3CME A;  1OV3 A;  4PJO F;  3VS6 A;  4C5E A;  3LWI A;  1NPR A;  1TUD A;  4K11 A;  4IUR A;  3JB9 I;  2EFI A;  3JRZ A;  3M54 A;  2O2O A;  2DF6 A;  4LNP A;  2I2L A;  1KJW A;  1QWF A;  3S3M A;  5FU6 C;  3EGU A;  2CRE A;  3JCM Q;  1I81 A;  3JCM X;  2EYX A;  2H3J A;  1Y71 A;  2RI2 A;  1QQJ A;  3CQT A;  1SF9 A;  3OS5 A;  4E7K A;  2VWF A;  4MZT A;  2WAC A;  3JCM V;  4EMH A;  1VQ7 Q;  1VQ6 A;  2DL4 A;  4ZTF A;  4C8Q G;  3FRN A;  2EQJ A;  5GAN e;  3CCR T;  2M16 A;  4PFZ A;  3CCV T;  2QEX T;  4KH1 B;  1W1F A;  3CC2 A;  1WHG A;  2W0Z A;  3NTI A;  3OSV A;  3QWY A;  1YJ9 T;  1IO6 A;  1PD0 A;  3A5Z B;  1Q81 R;  4QT7 A;  3G6E Q;  1UUE A;  4X9C A;  4M7D F;  3BDL A;  3CCM T;  4O6J A;  1FYN A;  1F1B B;  2CZ1 B;  4BY6 B;  1M90 R;  2MWO A;  1QKX A;  5KYY A;  2JOY A;  2LCL A;  3CMA A;  1E6G A;  3QG1 A;  1M1K C;  4AFQ C;  4DOW A;  1KQS S;  4AFS C;  2NYS A;  1WLP B;  2RJD A;  4CI0 C;  4FYX B;  4R55 A;  5KCO A;  1WQW A;  3M55 A;  1ZBJ A;  1WDX A;  3C12 A;  3A8O B;  2XKO C;  5GAN j;  4M77 D;  2L3R A;  1KIK A;  4HA8 A;  1VIE A;  2EKO A;  4A4E A;  4M77 C;  2D6F A;  5KYW B;  1O75 A;  2EWN A;  4LN2 A;  1PCX A;  4ZGE B;  2JVV A;  1QVF A;  3L2Z A;  5GAN g;  1PC0 A;  2ZPH B;  4C8Q C;  5AYF A;  3V8K A;  3RKY A;  2KRN A;  4RTV A;  2MPX C;  2HBW A;  2IVW A;  2L3Q A;  3G4S Q;  1M9S A;  5CKH A;  1M27 C;  4OMM A;  2HQX A;  2JS2 A;  3V7S A;  3VYG A;  2CDT A;  4WTO B;  4KT0 E;  1QVG S;  1IXD A;  2XK0 A;  1ZSZ B;  4MZM A;  1VQ7 T;  1RAE B;  1N9S A;  5LJ5 f;  4KGX B;  2QTV A;  1I4K 1;  4FYW B;  2EJ9 A;  5IHK A;  2E6Z A;  2WSE E;  2QQA A;  1I07 A;  3L2U A;  2FRY A;  3CCU Q;  2FZC B;  3X25 B;  1NPP A;  3SWN B;  3GIB A;  4RMO A;  2JS0 A;  2J7I A;  1KHI A;  5GAN 4;  2CZ7 B;  2DD5 A;  2DYB A;  1NEB A;  1BI2 A;  4JUV A;  4EMK C;  1ZSG A;  3QZ9 B;  3G6E T;  3CCQ Q;  3TVT A;  4WF2 A;  2JJ9 A;  2PU9 B;  2RQV A;  5J39 A;  4P5N A;  3EFR A;  3LH0 A;  1UHC A;  1GCQ C;  3QKJ A;  4BDZ A;  1BIA A;  4IUV A;  2AT1 B;  3EG9 A;  1N6A A;  4M77 F;  4C92 D;  4KUD K;  4Q5W A;  2V8J A;  2RHZ A;  2X3X D;  2RK1 A;  2R57 A;  3RMS A;  1OPK A;  2J6F A;  1FX7 A;  2COW A;  3JCM c;  3MEU A;  2IIM A;  2HDA A;  2JW4 A;  2DVJ A;  2EJF A;  2JM9 A;  1YI2 A;  1CSK A;  2E1H A;  3BE3 A;  3MPU B;  3NTH A;  2D1X A;  4EIK A;  2L3S A;  2X4X A;  3EG1 A;  3GLX A;  5GMK h;  3M56 A;  3CC2 Q;  1R0C B;  1ZBX A;  2D8H A;  1BB9 A;  1P92 A;  3CD6 Q;  1D1A A;  1GL5 A;  2QG9 B;  3MO8 A;  2DYI A;  3MJX A;  3WVE B;  3G4S T;  1N5Z A;  4XTV A;  1VYV A;  2DBM A;  2EYY A;  2CKK A;  1WXT A;  2BZX A;  2NUT B;  4JRP A;  2DZ9 A;  2YRC A;  4AFU C;  1VQ9 A;  2L8D A;  1YBY A;  3PVL A;  1S72 Q;  1IB8 A;  4HT9 A;  2QQ9 A;  2KI7 A;  1WGS A;  2KE9 A;  1PKS A;  1LVK A;  1MMG A;  2DTO A;  4AG2 C;  1I5L A;  4FT4 A;  2EQI A;  3MEV A;  2YUN A;  4JZ3 A;  2ED1 A;  1IHW A;  4V2S A;  2LJ3 A;  4OF1 A;  2K2V A;  4C8Q A;  2COZ A;  2LVM A;  1I5O B;  4C92 F;  5IXF A;  1JEG A;  4LXC A;  2LX7 A;  3CCQ T;  1VQM A;  1V29 B;  2GCX A;  2RHI A;  3CME T;  1KFZ A;  4FM4 B;  4D8D A;  2MMP A;  4QVZ A;  1VQO Q;  3G71 Q;  1IZ6 A;  1K9A A;  4B6M A;  2K5L A;  4KGZ B;  2QAZ A;  4NS5 A;  2E10 A;  3M58 A;  3CXC A;  2ZPF B;  1VQL Q;  3OSS C;  4QQ6 A;  1QKW A;  2BUD A;  1AT1 B;  2EQU A;  1PNJ A;  2DBK A;  2LZ6 B;  3NMZ C;  3OYG A;  2VYT A;  2ED0 A;  2CP5 A;  2GQI A;  2DL3 A;  3FJ5 A;  1JQQ A;  4RCC A;  4N0A C;  3Q1J A;  4ZN3 A;  2VB6 A;  4ORZ A;  1Y07 A;  1I8F A;  1W4S A;  3RMQ A;  9ATC B;  1NEG A;  4Z88 A;  1SKU B;  5I11 A;  2QDL A;  3FIF A;  4JRK A;  5CQX A;  1G3W A;  1PWT A;  1ZUY A;  1VQ6 T;  1PSE A;  2RO0 A;  3UDC A;  5CQY A;  2X9H A;  1ZA1 B;  2XG8 D;  2LCC A;  8AT1 B;  3FC3 A;  3V7C A;  5IXB A;  2EQK A;  1H3Z A;  4M78 B;  5CKF A;  2K5I A;  3CC2 T;  3CD6 T;  1YHQ Q;  3HPW A;  1OX8 A;  4C8Q E;  4FT2 A;  5KYY B;  2GFU A;  4RTT A;  1X69 A;  4M7A B;  5LJ5 j;  2QI2 A;  4F17 A;  4IUQ A;  1WI7 A;  3HKS A;  2SRC A;  3BY7 A;  2MOX A;  1D1C A;  2KXD A;  5GMK l;  2LMJ A;  1KC8 R;  2CP2 A;  1TUC A;  5LJ5 g;  4JS4 A;  1BBZ A;  1N27 A;  5LJ3 f;  5IAY A;  1S72 T;  3CCE A;  1IRE B;  3A8G B;  3OBW A;  3CMA T;  4ZNX A;  3LH5 A;  1WJQ A;  4HVU A;  2V8I A;  1JJ2 S;  3EFO B;  3U23 A;  3O5Z A;  1M8V A;  2LC4 A;  1Q7Y R;  2Y4X A;  1JXM A;  2QA4 Q;  4HVW A;  3OBY A;  3JCM e;  1Q86 U;  3HTR A;  1H92 A;  4PJO G;  3H41 A;  3JV3 A;  2FYK A;  1K9M R;  2QK0 A;  3JCM J;  2RI3 A;  1VQ4 Q;  1YCY A;  2PZ1 A;  1VYT A;  3FB9 A;  4A53 A;  1VQO T;  2HKQ B;  1BI3 A;  1X01 A;  1SRM A;  4PKC C;  3L2V A;  5KYW A;  4JRQ A;  3HFN A;  2R5M A;  1JJ2 P;  2DAQ A;  1VQL T;  3WXM B;  1SSH A;  2JUF A;  4IKF A;  1QP3 A;  4C0D B;  2KYB A;  3MEW A;  2O9V A;  2AHJ B;  3H0F A;  1VQK Q;  1TG0 A;  2MK5 A;  2FHD A;  4M75 D;  2FRW A;  4CC7 A;  3NGP A;  1K1Z A;  1U8R A;  2DEQ A;  5DM7 R;  1X6O A;  1YJN A;  1ZSZ A;  4C0Z A;  2JN0 A;  2CZ6 B;  4L6V 5;  1UEC A;  2RF0 A;  2YUQ A;  3CPW A;  3CBM A;  3VKI A;  4KRT A;  4IUP A;  5FU6 B;  1U06 A;  1YHQ T;  3QWX X;  3MEA A;  3OYD A;  2P4T A;  4E7H A;  1M8M A;  2O31 A;  3EG9 B;  3G7Z A;  3LGL A;  1MGQ A;  3LLR A;  3SWN A;  4M7D G;  1GBQ A;  4M4Z A;  3G1J A;  3UA6 A;  3DB3 A;  2HQH A;  4B9X A;  2X4Y A;  2IG0 A;  4BE2 A;  4PJO D;  5GAM d;  4F04 B;  1OOT A;  4PJO C;  1M1F A;  1X6B A;  4XTW A;  5I2S A;  2VGM A;  4MMK A;  1WYX A;  3PT9 A;  2R58 A;  1NJI U;  1SHG A;  2R5A A;  2LJ1 A;  2PTK A;  2ECZ A;  2V8K A;  2ZZD A;  1OPL A;  1N9R A;  4XQ3 A;  2LJ0 A;  2QA4 T;  4DBQ A;  3VS3 A;  2KMT A;  2PQW A;  3CCV Q;  2EBP A;  1ZUU A;  2GQV A;  1SRL A;  1B34 B;  5LJ3 e;  2PVG B;  3X24 B;  1VQP A;  2CP3 A;  4XTZ A;  1YI2 T;  2L2P A;  2DL8 A;  3OS0 A;  1FXX A;  3QJ6 A;  4M75 F;  4NL3 A;  1T3L A;  5FWB A;  5ECA A;  2EAY A;  4OGC A;  2DET A;  3I56 A;  2DTH A;  4A63 B;  1AVZ C;  4C0G A;  2SEM A;  4Y28 E;  3UF4 A;  1LJO A;  3CEY A;  2BE9 B;  3DKM A;  3NHN A;  4LUE A;  5J26 A;  3LWH A;  3X28 B;  1FMW A;  1VQK T;  4UC4 A;  2EPD A;  1KD1 U;  3MP1 A;  2O88 A;  3H6Z A;  2A36 A;  2KRM A;  3CBP A;  4M77 B;  2O9S A;  3EGD A;  1I1J A;  2E3H A;  3A8H B;  3CCS A;  1RAB B;  2ROT A;  4A4K A;  4DOV A;  4BE1 A;  4M7D C;  1VQ9 T;  2K3Y A;  1MMD A;  4C8Q B;  1WPY A;  1AEY A;  1ACM B;  2L3P A;  4FU6 A;  3E19 A;  1OU9 A;  2FVU A;  1YWO A;  4DBR A;  5LJ3 j;  2LTO A;  2NWM A;  1NG2 A;  3VJP A;  4QKU A;  3PE0 A;  4RUG A;  5GAO l;  4HVV A;  3M0Q A;  3RR6 A;  4FW1 A;  1VQM T;  2LDM A;  1UFF A;  5LJ3 g;  4KUL A;  2VXF A;  2EGC A;  4PLI A;  1OI1 A;  4J5Y A;  4XU0 A;  4M77 G;  3SFM A;  2MIO A;  5GAO n;  3RDV A;  3VS2 A;  1QVF P;  1M4Z A;  1Y96 B;  4GBQ A;  4MZP A;  3QSU A;  3WVD B;  3OW2 S;  2D0Q B;  4EMK B;  5GAM h;  2C06 A;  2E12 A;  4N4H A;  1JU5 C;  1XNI A;  3TRE A;  2LNV A;  5GAN d;  5CKD A;  2LT4 A;  4L5G A;  2EYW A;  1Q81 U;  2P0K A;  1UDL A;  1X27 A;  1RI0 A;  1UGR B;  2YRV A;  4KBM B;  3E9G A;  2CSI A;  4LDX A;  1NLP C;  3OW2 P;  1Q82 C;  1PSF A;  2YRD A;  1M90 U;  4M78 A;  3OYM A;  2RN8 A;  4X1V A;  5FRN A;  1K0X A;  2X4W A;  2JTF A;  4F14 A;  3C4S A;  1AHJ B;  4M7A A;  1K76 A;  1YP5 A;  4LDV A;  1OUL A;  2AKL A;  1E6H A;  1C6V X;  2K3B A;  1Y0M A;  2BZY A;  1RAD B;  2RQT A;  3OMG A;  4PLL A;  3VV0 A;  1YJW A;  2B8A A;  2XID A;  2FZG B;  2QXF A;  5IN1 A;  2D9T A;  4LD6 A;  4E6R A;  4DEY A;  4BE0 A;  1H64 1;  3EFO A;  2GF7 A;  2MYS A;  4OML A;  4XK8 E;  5CK9 A;  4C92 G;  1WHJ A;  2Z0W A;  2OTJ A;  4J83 A;  4II1 A;  2KBT A;  5HKC A;  4OGE A;  3UT1 A;  3HRT A;  2CH4 A;  5FU7 C;  1WX6 A;  1XQH A;  3SEM A;  3RBB B;  1TS9 A;  4XU2 A;  3M0S A;  5IT9 E;  1ARK A;  1VIF A;  5D6X A;  4M78 E;  2HSE B;  4ELY C;  3VUZ A;  2DLP A;  3E9F A;  3QHS A;  3QII A;  2NLU A;  2QGF B;  4M7A E;  4M7D A;  3OYJ A;  4J9I A;  4Y92 A;  2CS7 A;  2H3E B;  1K8A R;  4HXJ A;  2MCN A;  3H0I A;  3EFS A;  1NYG A;  1OYX A;  1N8R R;  3M4G A;  1FMV A;  4FL6 A;  2C0O A;  3TEE A;  3L1A A;  1YFN A;  4J6X A;  1OU8 A;  4QW2 A;  3CC4 A;  3AHU A;  1VQ8 Q;  2BE7 D;  4A4G A;  4BDY A;  3CCL A;  5GJV B;  1D0Z A;  1DJ7 B;  2V1Q A;  4JPB W;  2LRQ A;  2RJF A;  5HY6 A;  2C0I A;  3CME Q;  1M2O A;  3ZBD A;  2CSQ A;  2DXU A;  1MND A;  2O01 E;  1WXU A;  3I5S A;  3OYC A;  4FYV B;  5GAN h;  3OYB A;  3M0R A;  3OYH A;  4RG2 A;  2FPE A;  3QXE B;  4OB1 B;  4JJN K;  1MUZ A;  2X51 A;  4C92 C;  1WHL A;  2G3R A;  3FDR A;  1BI1 A;  2M51 A;  3I5R A;  1X43 A;  3I55 A;  2EIF A;  2LX9 A;  3PVQ A;  3J7A F;  5HCK A;  5GAO p;  1JRI A;  5GAO m;  4DBH A;  1VQN A;  4OVA A;  2OTL A;  4M7D E;  2DD4 A;  3DB4 A;  3L2Q A;  3NPF A;  4KGV B;  3S3O A;  2XI9 A;  1AWW A;  1X75 C;  1Q81 C;  1YN8 A;  1VQ6 Q;  2RQW A;  2FZK B;  1KG1 A;  1JO8 A;  1YIT A;  2KRO A;  2DJZ A;  4F7U F;  1D3B B;  1KQS A;  1BU1 A;  2DX1 A;  1R8O B;  4ELZ C;  1C0M A;  1UGV A;  2JMA A;  2LNH B;  2E5Q A;  2HD0 A;  1B34 A;  4XAX B;  2BKD N;  2IPO B;  1UHF A;  3TSZ A;  1TOV A;  1ZX6 A;  3L42 A;  3EGD B;  3JCM f;  3ULR B;  3M0T A;  3BDU A;  4PL6 A;  3N5B B;  3M0P A;  3I56 T;  1VA7 A;  1UGP B;  3NTK A;  4FCY A;  2DNU A;  3M57 A;  2P4R A;  3CMA Q;  2K5F A;  1XOV A;  4OMN A;  3VS5 A;  6AT1 B;  4M77 A;  1MV0 B;  2A08 A;  1VQ8 T;  5CAI A;  2HSP A;  1QVG A;  2D8J A;  4IUU A;  2YSQ A;  3CCJ A;  3FJP A;  1M2V A;  2DIQ A;  3CC7 A;  2CP0 A;  1KK7 A;  1H8K A;  4BI4 A;  1G2B A;  2XDP A;  3THK A;  1ABO A;  2ZPB B;  2DE0 X;  4JZ4 A;  5LJ5 d;  1RL2 A;  2J05 A;  3EG0 A;  3RUX A;  3OYY A;  1UJY A;  3IQL A;  1PRL C;  2E64 A;  3PNW C;  1O9S A;  4FW2 A;  1HJD A;  1GXI E;  4RKU E;  2X3W D;  3SDZ A;  2JT4 A;  1VQ5 A;  1Y96 A;  1Y7X A;  3QJY A;  4TVR A;  2QTX A;  5EG2 A;  2J6K A;  4RTU A;  3CCR A;  1WNL A;  1K0S A;  4M77 E;  2A37 A;  4EMK A;  4E7Z A;  2QEX A;  4QVD A;  2DIG A;  4PJO B;  3DLL A;  4XTY A;  4LDW A;  3SHW A;  1C1A A;  1GCQ A;  2GGR A;  4M75 G;  3KUF A;  1YJ9 A;  1KHC A;  5KH6 A;  1KC8 U;  1UGQ B;  1YIJ A;  3CPW P;  1HD3 A;  2ZGW A;  3PFS A;  2VKN A;  4C92 A;  3OMC A;  2VGN A;  1VYU A;  2QQR A;  3CCM A;  2DIL A;  2WSF E;  2M9U A;  3UPU A;  1BI0 A;  3OS1 A;  3P8D A;  4L59 A;  1HXD A;  5L23 A;  4VUB A;  2QQS A;  4J9F A;  2DK3 A;  2DRK A;  2QYZ A;  1Q7Y U;  3H8Z A;  1EX4 A;  1QVP A;  3A8M B;  5M9O A;  3C0C A;  3HP9 A;  3SD4 A;  4YTL A;  3OYK A;  2RNA A;  2YXY A;  8ATC B;  1G5V A;  4J9D A;  1K9M U;  5GAN 6;  1RI9 A;  2FEI A;  2E6N A;  2EYZ A;  1SHF A;  3TU4 K;  1Y57 A;  1YI2 Q;  2COY A;  2O4X B;  3O8V A;  1R77 A;  4JS5 A;  2M0O A;  1K73 R;  2ATC B;  2HAX A;  4RCB A;  2YUP A;  2G6F X;  2JTM A;  4IUT A;  4M7D B;  2XD0 A;  4B9W A;  1LOJ A;  2FL7 A;  2BIV A;  5CCA A;  3QBY A;  4J8O A;  2K7A A;  4C92 E;  3V8J A;  2PVD B;  2RI5 A;  1W2B S;  1M3C A;  3FLG A;  4M75 C;  1WHM A;  5LJ5 h;  4E7L A;  1G3Y A;  1VQ7 A;  3JCM b;  2DTI A;  1QP2 A;  1VQ9 Q;  2J06 A;  1MV3 A;  2KDS A;  3OYA A;  5GAN 8;  3A8L B;  3UA7 A;  1CKB A;  1WJS A;  2GTO A;  2F2W A;  4A4F A;  4OMF B;  1TTH B;  2ZCF B;  1B07 A;  2ZAE A;  3AT1 B;  2F69 A;  1IRX A;  3QYG B;  5IHI A;  2LQ8 A;  2FG0 A;  2B86 A;  2YT6 A;  1XTD A;  4IIO A;  3PTA A;  1W2B P;  4FSX A;  3CCL T;  3JCM g;  1RLQ C;  2FB7 A;  2KK4 A;  2YHT A;  3G6E A;  1VQM Q;  3LX7 A;  3CC7 Q;  2F2X A;  1X2K A;  2WSC E;  3URG A;  4ANJ A;  4DQ2 A;  1AZE A;  3HFO A;  3VUB A;  4ZTJ A;  4N0A A;  4BUG A;  2EW3 A;  5A2Q E;  1NE8 A;  2ZPG B;  4E2F B;  1W70 A;  2RPN A;  5GAM e;  4A54 A;  2KVQ G;  5C0M A;  3R6N A;  2K79 A;  3OYF A;  2NUP B;  2EVR A;  4BAC A;  1LNX A;  3I55 T;  2XDB A;  1M1G A;  1JBM A;  1D0X A;  1Q82 R;  2E4H A;  4DBF A;  1VQN T;  2OTL T;  3NFC A;  5DY9 A;  4CRI A;  1OZ3 A;  3X26 B;  1U3O A;  1BKB A;  1AWX A;  1VQ5 Q;  1UJ0 A;  1KC8 C;  2HQE A;  2HKN A;  5D6Y A;  2QAS A;  1YIT T;  1M1K R;  4HCZ A;  4QQG A;  1GRI A;  1D3B A;  4JLG A;  3P8H A;  3RNJ A;  3QYH B;  1ABQ A;  3LYI A;  1U1T A;  2M02 A;  5IH2 A;  3EHQ A;  5D7U A;  3JB9 F;  1TU0 B;  4XU1 A;  3G4S A;  2CH4 W;  1OX9 A;  3T9N A;  4C5H A;  1VOM A;  1Q7Y C;  4MDW A;  1SEM A;  2RH2 A;  2VVK A;  4HKE A;  4X9D A;  1U5S A;  5KYU B;  4OP0 A;  5FWC A;  1PD1 A;  1V1C A;  1Q86 C;  4ESR A;  5J3B A;  1M2V B;  4RG8 A;  3CCE Q;  2LQN A;  2AIR B;  5GMK m;  2J6O A;  3DLM A;  1KSW A;  4Y91 A;  2PNI A;  2AKK A;  5FU7 B;  4KH0 B;  3MP6 A;  1WIE A;  2F2V A;  1AWO A;  2DRM A;  1WA7 A;  2YLB A;  1QVF S;  2A28 A;  3CCU A;  2AZS A;  2VAS A;  2CP7 A;  3TQ7 P;  2DL5 A;  4A4H A;  3LW5 E;  2OI3 A;  3CCJ T;  3H0H A;  3QZ5 B;  3PIP A;  4LDY A;  1M5Q 1;  2GTJ A;  3CCQ A;  1JB0 E;  3A98 A;  3HRU A;  5DLQ E;  2CT4 A;  3CC7 T;  2P0Q A;  4M78 F;  1EZZ B;  2DER A;  1KQ1 A;  4J9C A;  4M7A F;  4EPC A;  1PG5 B;  1BYM A;  2I0N A;  4O5V A;  1WQ7 A;  3EG2 A;  1QLY A;  2XU8 A;  4PK4 A;  3X20 B;  1D09 B;  5GJW B;  3KXT A;  4M75 A;  2K57 A;  3VYH B;  1GFC A;  1ZLM A;  2FO0 A;  4ZGJ B;  4E7J A;  2XHC A;  4LDU A;  2DMO A;  3VS7 A;  1G8X A;  3MKD A;  4PFO A;  5FRO A;  2JM8 A;  3OA6 A;  4OB2 B;  1XJW B;  4FSS A;  3JB9 H;  1RAA B;  3EGX A;  2PUK B;  2XIC A;  4PJJ A;  2MWP A;  4D8K A;  4F7U G;  5GAN 3;  1YJN Q;  1VQ5 T;  3VS0 A;  1WHH A;  3RKX A;  5FW9 A;  1EFN A;  3D7S B;  2JXB A;  4E7S A;  1T0J A;  4E47 A;  1TUG B;  2HMA A;  4BD3 A;  1MMA A;  3P8B B;  4Z02 A;  2K3X A;  4C92 B;  2EKH A;  2HL5 C;  1LCK A;  2E5K A;  3CD6 A;  4PJO A;  4NL2 A;  1H3H A;  2XMF A;  1NJI C;  2F5K A;  1NZ9 A;  3JSC A;  1YIJ T;  5KE2 A;  2DL7 A;  3ZEH A;  5LJ3 h;  4PJN A;  3REA B;  1E7O A;  3OY9 A;  2QGG A;  4BB7 A;  1QWE A;  1X2Q A;  4OMO A;  4M75 E;  1S72 A;  4AG1 C;  4HCK A;  3CCE T;  3OYI A;  2CZ0 B;  2KT1 A;  1RAI B;  4XTX A;  2PVO B;  3CBO A;  2HBP A;  1S1N A;  2RHY A;  3RES A;  5GMK e;  1PRM C;  1T0H A;  2GFA A;  2FPD A;  5I21 A;  1WHK A;  1PM3 A;  4BI8 B;  3MP8 A;  5CO7 A;  3ER0 A;  1M30 A;  2M1H A;  1SG5 A;  1VQP Q;  3HRS A;  1KD1 C;  2JTE A;  2C0T A;  3G71 A;  1VQO A;  2QQB A;  3MET A;  2O4X A;  4C8Q D;  1K4U S;  4PJO E;  1YNZ A;  1VQL A;  1KQS P;  1R0B G;  2MF2 A;  2M0Y A;  2CYZ B;  4ZN1 A;  1G83 A;  1UTI A;  2ABL A;  3GBQ A;  2MI6 A;  1G3S A;  3I56 Q;  1K8A U;  5GAN 2;  4J6Y A;  4KUI A;  2A0F B;  5HK0 A;  1UB4 A;  1N8R U;  2LCS A;  1QMC A;  5A0L A;  2CP6 A;  1ZUK A;  4GLM A;  4JJD A;  4JJC A;  2RA2 A;  1MNE A;  1D0Y A;  1VUB A;  3CCS Q;  2W10 A;  1YJN T;  2JNG A;  3MCA B;  2L5Q A;  5GMK j;  1T3S A;  1NYF A;  2DXB A;  1W6X A;  1IGQ A;  4PJM A;  2DJQ A;  2DPP B;  2ROL A;  3OW2 A;  5CR2 A;  4RTZ A;  2YUO A;  1OQK A;  3QDF A;  1HYO A;  4CC2 A;  1WXB A;  2VC8 A;  1YHQ A;  2ESW A;  3CXC S;  3R6O A;  2L0A A;  3C94 A;  5CKE A;  1G3T A;  2KT8 A;  2K9G A;  1QVG P;  2RB6 A;  4E7I A;  4IIM A;  3RKW A;  3RER A;  1I0C A;  2RHU A;  3VS1 A;  3GPL A;  4XU3 A;  2MAM A;  1Z9Z A;  2DA9 A;  1GCP A;  5IHN A;  4AMC A;  4JJB A;  2E65 A;  4OB0 B;  2D0N A;  3CXC P;  3OYN A;  2DZC A;  3ME9 A;  5C6S A;  2NUP A;  1PHT A;  1V76 A;  2RM4 A;  2V26 A;  2X4J A;  2P84 A;  2CUB A;  4ZGD B;  2QA4 A;  5D6W A;  2HCK A;  2YDL A;  4C8Q F;  1NBE B;  4BY6 C;  1QCF A;  1M3A A;  1M90 C;  5KYX A;  2YLC A;  4RTY A;  2CGH A;  1AD5 A;  1MMN A;  5GAN 5;  4C0F A;  1VQ4 A;  2NUZ A;  1VQP T;  5KE3 A;  4ATO A;  4OMQ A;  2DXT A;  4GY5 A;  3TSW A;  4AT1 B;  5I2M A;  2EYQ A;  2KGT A;  2VUB A;  4FIB A;  3C95 A;  3EH1 A;  1B3Q A;  2X35 A;  5GAN 7;  4J9E A;  5KYN A;  2KYM A;  1VQK A;  1MHN A;  2DKG A;  3HL8 A;  4J9B A;  3JCM W;  4MML A;  4EMG A;  3S3N A;  5KYU A;  3CCS T;  3ASK A;  1X6G A;  3PMT A;  1BCM A;  1AOJ A;  2BZ8 A;  3KFV A;  1YJW Q;  1UE9 A;  3A1P A;  2RQR A;  4Z89 A;  7AT1 B;  3OB9 A;  5LL6 S;  1RLP C;  2F5T X;  5EC7 A;  3ZL7 C;  3CCU T;  5AT1 B;  1ZSZ C;  1RAG B;  4F7U A;  4M75 B;  2OTJ Q;  1TSF A;  3OYL A;  1K8A C;  1QCO A;  2RD1 A;  2DO3 A;  1QW1 A;  1BIB A;  3E1S A;  5LJ5 e;  2A3L A;  1N8R C;  2A7Y A;  5CVI A;  1UEB A;  1KQ2 A;  1TH7 A;  1RAF B;  1Z9Q A;  1TXQ A;  1BK2 A;  5CIU A;  3EGX B;  3SWN C;  3PIO A;  3LGF A;  3OQ5 A;  5FRM A;  5FLX E;  3L2W A;  3CPW S;  3VU3 C;  3SB2 A;  1ZA2 B;  3VS4 A;  1RUW A;  3RIR A;  3PGG A;  4GLK A;  2GNC A;  3J80 E;  4RTW A;  3CCV A;  1ZQ1 A;  2ZPE B;  4C5I A;  3JCM P;  2KEA A;  2EGA A;  2OJ2 A;  3EAE A;  5GAM f;  4LD9 K;  3I35 A;  5CKB A;  5GMK i;  5KCH A;  3CC4 Q;  3VRZ A;  5DLO A;  3CCL Q;  1AWJ A;  1SPK A;  3M0U A;  1UGS B;  3M59 A;  2KNB B;  4BI3 A;  3V7R A;  2QDY B;  3JB9 G;  2P0P A;  3E2U A;  1RAH B;  4F7U E;  2OX7 A; 
#chains in the Genus database with same CATH homology
 3QUI A;  2OTL T;  3NFC A;  2X4W A;  2JTF A;  5DY9 A;  4CRI A;  3C4S A;  3HSB A;  1AHJ B;  2RK2 A;  1OZ3 A;  1OZ2 A;  3X26 B;  1BKB A;  2EJF A;  2KSS A;  1VQ5 A;  4M7A A;  1KC8 C;  2HQE A;  5D6Y A;  1YI2 A;  2E1H A;  5L8R E;  1YIT T;  4HCZ A;  1SSF A;  4LDV A;  4QQG A;  3MHX A;  3NTH A;  1D3B A;  4JLG A;  4M7D E;  3P8H A;  3QYH B;  2E41 A;  2X4X A;  3GLX A;  3LYI A;  5GMK h;  1U1T A;  3F70 A;  3M56 A;  3OMG A;  3PMI A;  4PLL A;  1ZBX A;  3VV0 A;  1P92 A;  2B8A A;  1YJW A;  1YJW T;  3JB9 F;  4XU1 A;  2XID A;  3MO8 A;  3G4S T;  3WVE B;  3G4S A;  2QXF A;  3T9N A;  3GF5 A;  5IN1 A;  2D9T A;  4LD6 A;  4XTV A;  4C5H A;  3JCM d;  2CKK A;  3M4Y A;  2XDD A;  5GAO r;  1Q7Y C;  4MDW A;  4BE0 A;  2RH2 A;  1H64 1;  5A0G A;  1K73 U;  1U1S A;  4DA4 A;  4HKE A;  2GF7 A;  4X9D A;  4XK8 E;  4OP0 A;  5CK9 A;  4C92 G;  2HNI A;  2L89 A;  2LQK A;  4JRP A;  2DZ9 A;  3GNG A;  2OTJ A;  2OTJ T;  4J83 A;  4II1 A;  1Q86 C;  1VQ9 A;  2L8D A;  4M78 G;  1YBY A;  5HKC A;  5J3B A;  4OGE A;  3UT1 A;  4QVC A;  4RG8 A;  4HT9 A;  5GMK m;  3HRT A;  5FU7 C;  2QQ9 A;  3DLM A;  3J81 E;  4M7A G;  4Y91 A;  1WGS A;  5FU7 B;  3MP6 A;  1XQH A;  2DTO A;  3L2R A;  2EJG A;  3KBG A;  3G71 T;  3JAM E;  1I5L A;  2Y4Y A;  2LT1 A;  4XU2 A;  2YLB A;  4FT4 A;  5IT9 E;  1QVF S;  3FEO A;  1VIF A;  2DVE A;  3MEV A;  4M78 E;  5D6X A;  4ELY C;  3CCU A;  4J7I A;  3VUZ A;  1K73 C;  2VXE A;  3E9F A;  3QHS A;  3QII A;  2NLU A;  4A4H A;  3LW5 E;  4V2S A;  3JB9 D;  4OF1 A;  2K2V A;  4M7A E;  4C8Q A;  3CCJ T;  4M7D A;  3QZ5 B;  2LVM A;  3PIP A;  2KY9 A;  3ZFJ A;  4C92 F;  3OYJ A;  4LDY A;  1M5Q 1;  3GNF B;  3CCQ T;  3HHT B;  1V29 B;  3CCQ A;  1JB0 E;  2GCX A;  2CS7 A;  2RHI A;  2ZPI B;  3HRU A;  5DLQ E;  3CME T;  3CC7 T;  4FM4 B;  3GOX A;  2P0Q A;  4M78 F;  2KQW A;  1KQ1 A;  2MMP A;  3EFS A;  4QVZ A;  1OYX A;  3M4G A;  1IZ6 A;  4M7A F;  4EPC A;  1BYM A;  2K5L A;  4FL6 A;  4N4I A;  1WQ7 A;  4O5V A;  4NS5 A;  3TEE A;  2E10 A;  2XU8 A;  3M58 A;  3L1A A;  3CXC A;  4J6X A;  3X20 B;  2ZPF B;  4QW2 A;  3OYE A;  3CC4 T;  3CC4 A;  3AHU A;  3OSS C;  3KXT A;  4A4G A;  4M75 A;  2K57 A;  4QQ6 A;  4XTU A;  4BDY A;  1ZHI A;  3M53 A;  3VYH B;  3CCL A;  2BUD A;  4ZGJ B;  4E7J A;  1DJ7 B;  2EQU A;  2XHC A;  4LDU A;  3OYG A;  3V8L A;  2VYT A;  2LRQ A;  5A0D A;  2RJF A;  5HY6 A;  5HK3 A;  2EQM A;  5FRO A;  4RCC A;  4N0A C;  3Q1J A;  3OA6 A;  4JLI A;  4ZN3 A;  1EIF A;  2OAU A;  3ZBD A;  1Y07 A;  1I8F A;  1W4S A;  2DXU A;  3RMQ A;  4OB2 B;  2O01 E;  3JB9 H;  3OYC A;  3S6W A;  3FIF A;  4JRK A;  5GAN h;  5CQX A;  3OYB A;  1G3W A;  2PUK B;  2XIC A;  2MWP A;  3BFM A;  4F7U G;  5GAN 3;  4RG2 A;  3OYH A;  2DXC A;  1VQ5 T;  4D6W A;  1VQ6 T;  3RKX A;  1PSE A;  2RO0 A;  3UDC A;  3QXE B;  4OB1 B;  4JJN K;  5CQY A;  5GAN f;  3INZ A;  4E47 A;  2XG8 D;  2KAF A;  2LCC A;  4HCC A;  4C92 C;  2G3R A;  3FDR A;  4BD3 A;  4M78 D;  3P8B B;  4Z02 A;  2K3X A;  3V7C A;  1BI1 A;  4JRI A;  5GAO q;  4C92 B;  4J7F A;  3I55 A;  3FC3 A;  1Q82 U;  2EIF A;  2LX9 A;  4M78 C;  3J7A F;  2EQK A;  1H3Z A;  5GAO p;  3GP8 A;  1JRI A;  4OB3 B;  4C5G A;  4M7A D;  4M78 B;  5CKF A;  2K5I A;  5GAO m;  3CC2 T;  3CD6 A;  2RJC A;  3CD6 T;  4PJO A;  1VQN A;  2E70 A;  3HPW A;  4NL2 A;  4OVA A;  2OTL A;  4C8Q E;  2JZ2 A;  1NJI C;  2DD4 A;  4FT2 A;  3DB4 A;  3L2Q A;  2GFU A;  4M7A C;  2F5K A;  3S3O A;  4M7A B;  5LJ5 j;  1NZ9 A;  2XI9 A;  2QI2 A;  4IUQ A;  1X75 C;  1Q81 C;  3HKS A;  1M1K U;  3BY7 A;  3JSC A;  1YIJ T;  5KE2 A;  3M9Q A;  1KG1 A;  1YIT A;  5GMK l;  4F7U F;  2DJZ A;  4ME7 A;  2K4Y A;  1JJ2 A;  3ZEH A;  1D3B B;  5LJ3 d;  5LJ3 h;  4R56 A;  3QPH A;  3OY9 A;  4BB7 A;  2Y90 A;  1KQS A;  5LJ5 g;  4JS4 A;  1R8O B;  4ELZ C;  1N27 A;  5LJ3 f;  5IAY A;  4M75 E;  1S72 T;  1S72 A;  4PNO A;  3TCJ A;  3CCE A;  3OYI A;  3CCE T;  2CZ0 B;  2E5Q A;  2HD0 A;  4XTX A;  1B34 A;  1IRE B;  2HBP A;  2PVO B;  3A8G B;  3CBO A;  3OBW A;  3QDR B;  1VQ4 T;  4XAX B;  3CMA T;  2RHY A;  1FWZ A;  4MDX A;  3RES A;  3JCM h;  2BKD N;  4EDU A;  1WJQ A;  5GMK e;  2V8I A;  3QO3 A;  3OS2 A;  3L42 A;  1JJ2 S;  2GFA A;  1M8V A;  2LC4 A;  5I21 A;  2VV5 A;  2Y4X A;  3JCM f;  2PUO B;  4BI8 B;  5GAM j;  3OBY A;  3JCM e;  1HK9 A;  4QQD A;  3BW1 A;  3MP8 A;  3BDU A;  1Q86 U;  4PL6 A;  5CO7 A;  3N5B B;  4PJO G;  3I56 T;  1UGP B;  4N4G A;  4X34 A;  3UWN A;  1K9M C;  3NTK A;  2RJE A;  3ER0 A;  2M1H A;  2FYK A;  3JCM J;  2RI3 A;  3M57 A;  5GAM g;  1YCY A;  2K5F A;  1XOV A;  3CPF A;  3HRS A;  4J6W A;  1KD1 C;  4NOY A;  1WJR A;  3FB9 A;  4A53 A;  3G71 A;  1VQO T;  1VQO A;  1BI3 A;  1X01 A;  2QQB A;  3MET A;  4PKC C;  3L2V A;  4HT8 A;  4JRQ A;  4HCB A;  4M77 A;  1W2B A;  2O4X A;  4C8Q D;  4M7D D;  3HFN A;  2R5M A;  4PJO E;  2DAQ A;  1VQL A;  1VQL T;  1VQ8 T;  1VQ8 A;  5CAI A;  4F7U B;  1QVG A;  2MF2 A;  4JDS A;  2CYZ B;  3WXM B;  4C0D C;  4ZN1 A;  2MI6 A;  2JUF A;  4IUU A;  4IKF A;  1G3S A;  3M5A A;  1QP3 A;  3FJP A;  4C0D B;  5GAN 2;  3CCJ A;  1K8A U;  2DIQ A;  4J6Y A;  4KUI A;  2RHX A;  3MEW A;  3JB9 J;  5HK0 A;  3CC7 A;  1UB4 A;  3CME A;  2AHJ B;  4PJO F;  1N8R U;  4BI4 A;  2FHD A;  5A0L A;  4M75 D;  2XDP A;  4C5E A;  3LWI A;  2RA2 A;  1U8R A;  1VUB A;  2DEQ A;  1NPR A;  2ZPB B;  4IUR A;  5DM7 R;  1X6O A;  5LJ5 d;  1YJN T;  1YJN A;  3JB9 I;  2EFI A;  2JNG A;  1RL2 A;  4C0Z A;  3MCA B;  2JN0 A;  2L5Q A;  3JRZ A;  3M54 A;  2CZ6 B;  5GMK j;  4L6V 5;  3OYY A;  2I2L A;  3RUX A;  2DXB A;  3CPW A;  2E64 A;  2DPP B;  3PNW C;  3OW2 A;  3CBM A;  3S3M A;  3VKI A;  5FU6 C;  5CR2 A;  1O9S A;  4IUP A;  5FU6 B;  2VC8 A;  3JCM Q;  1GXI E;  1I81 A;  4RKU E;  1YHQ T;  1YHQ A;  3JCM X;  3CXC S;  2H3J A;  3MEA A;  1Y71 A;  3R6O A;  3OYD A;  3C94 A;  2P4T A;  2RI2 A;  5CKE A;  3OS5 A;  3SDZ A;  4E7H A;  1G3T A;  4E7K A;  4MZT A;  2WAC A;  3JCM V;  1Y96 A;  3G7Z A;  3LGL A;  1MGQ A;  1Y7X A;  3LLR A;  3SWN A;  4EMH A;  3QJY A;  4ZTF A;  4C8Q G;  1VQ6 A;  4M7D G;  3FRN A;  2QTX A;  4TVR A;  5EG2 A;  2RB6 A;  2EQJ A;  4E7I A;  3DB3 A;  4B9X A;  2X4Y A;  2IG0 A;  4BE2 A;  4PJO D;  5GAN e;  1WNL A;  2M16 A;  5GAM d;  3RKW A;  3CCR T;  3CCR A;  4M77 E;  2RHU A;  4EMK A;  3CCV T;  3RER A;  3GPL A;  4PJO C;  4XU3 A;  2MAM A;  2QEX A;  2QEX T;  1M1F A;  4XTW A;  4QVD A;  2DIG A;  4PJO B;  3DLL A;  5I2S A;  2VGM A;  4MMK A;  3CC2 A;  4XTY A;  3PT9 A;  4LDW A;  2R58 A;  1NJI U;  2E65 A;  2R5A A;  4OB0 B;  4M75 G;  3OYN A;  2DZC A;  2V8K A;  2ZZD A;  3KUF A;  3NTI A;  3OSV A;  3ME9 A;  1N9R A;  1KHC A;  1YJ9 T;  1YJ9 A;  5C6S A;  5KH6 A;  1KC8 U;  1UGQ B;  2RM4 A;  4XQ3 A;  3A5Z B;  2X4J A;  1YIJ A;  4ZGD B;  1VQM A;  2QA4 T;  2QA4 A;  2ZGW A;  5D6W A;  4X9C A;  3PFS A;  4C92 A;  4C8Q F;  4M7D F;  3OMC A;  2KMT A;  2PQW A;  2VGN A;  2QQR A;  3BDL A;  4BY6 C;  3CCM T;  3CCM A;  2WSF E;  4O6J A;  1M90 C;  2YLC A;  2CZ1 B;  4BY6 B;  2CGH A;  2M9U A;  2GQV A;  3UPU A;  1BI0 A;  2MWO A;  3P8D A;  3OS1 A;  5GAN 5;  1B34 B;  4C0F A;  5LJ3 e;  2PVG B;  4L59 A;  2JOY A;  3X24 B;  1VQ4 A;  2LCL A;  1HXD A;  3CMA A;  1VQP A;  4VUB A;  1VQP T;  3QG1 A;  2QQS A;  4XTZ A;  2DK3 A;  1M1K C;  5KE3 A;  1YI2 T;  1Q7Y U;  4ATO A;  2DXT A;  4GY5 A;  3OS0 A;  3H8Z A;  5I2M A;  2EYQ A;  1QVP A;  1FXX A;  4DOW A;  3QJ6 A;  3A8M B;  4M75 F;  1KQS S;  2VUB A;  5M9O A;  3HP9 A;  3SD4 A;  4NL3 A;  4FIB A;  3C95 A;  4CI0 C;  2RJD A;  4R55 A;  4YTL A;  3OYK A;  2EAY A;  4OGC A;  5KCO A;  2X35 A;  3I56 A;  5GAN 7;  1WQW A;  2DTH A;  3M55 A;  1G5V A;  4C0G A;  1K9M U;  4Y28 E;  3C12 A;  3A8O B;  2XKO C;  5GAN 6;  1LJO A;  3CEY A;  3DKM A;  5GAN j;  5J26 A;  2E6N A;  2L3R A;  4M77 D;  3LWH A;  3X28 B;  1VQK T;  1VQK A;  4HA8 A;  4UC4 A;  1VIE A;  2EKO A;  3TU4 K;  4A4E A;  1KD1 U;  1MHN A;  2DKG A;  4M77 C;  3HL8 A;  3MP1 A;  3JCM W;  3H6Z A;  2D6F A;  4MML A;  3CBP A;  1O75 A;  4M77 B;  2O4X B;  3O8V A;  4EMG A;  2EWN A;  4JS5 A;  3S3N A;  2M0O A;  4ZGE B;  3A8H B;  2JVV A;  3ASK A;  3CCS A;  3L2Z A;  3CCS T;  5GAN g;  1QVF A;  2HAX A;  4RCB A;  4A4K A;  2ZPH B;  4C8Q C;  4DOV A;  4BE1 A;  1VQ9 T;  4M7D C;  2JTM A;  3PMT A;  4IUT A;  5AYF A;  2K3Y A;  4C8Q B;  2XD0 A;  4M7D B;  3V8K A;  4B9W A;  1LOJ A;  3RKY A;  1WPY A;  2IVW A;  2FL7 A;  2BIV A;  5CCA A;  3QBY A;  4J8O A;  1M9S A;  5CKH A;  4C92 E;  2HQX A;  4FU6 A;  3V8J A;  3OB9 A;  2PVD B;  2RI5 A;  3E19 A;  5LL6 S;  1W2B S;  3V7S A;  2FVU A;  3VYG A;  3FLG A;  2F5T X;  3CCU T;  4KT0 E;  5LJ3 j;  4M75 C;  1QVG S;  2LTO A;  5LJ5 h;  2XK0 A;  4E7L A;  4F7U A;  1G3Y A;  4M75 B;  4MZM A;  1VQ7 T;  3JCM b;  1VQ7 A;  2DTI A;  3VJP A;  1QP2 A;  3OYL A;  5GAO l;  1K8A C;  2KDS A;  3OYA A;  1N9S A;  5GAN 8;  5LJ5 f;  3A8L B;  4A4F A;  2LDM A;  1WJS A;  2RD1 A;  1VQM T;  2DO3 A;  1QW1 A;  1BIB A;  4OMF B;  2ZCF B;  3E1S A;  5LJ3 g;  4KUL A;  5LJ5 e;  2VXF A;  2A3L A;  1N8R C;  1I4K 1;  2F69 A;  2A7Y A;  2EJ9 A;  5CVI A;  3QYG B;  4PLI A;  1OI1 A;  4J5Y A;  2E6Z A;  2WSE E;  2LQ8 A;  4XU0 A;  2QQA A;  1UEB A;  4M77 G;  1KQ2 A;  1TH7 A;  3SFM A;  1XTD A;  3L2U A;  3PTA A;  5CIU A;  3SWN C;  3PIO A;  5GAO n;  3LGF A;  4FSX A;  3X25 B;  1NPP A;  1M4Z A;  1Y96 B;  3SWN B;  4MZP A;  3CCL T;  3GIB A;  3OQ5 A;  3JCM g;  4RMO A;  5FLX E;  3L2W A;  3CPW S;  3VU3 C;  5FRM A;  3SB2 A;  1KHI A;  3QSU A;  5GAN 4;  2FB7 A;  2CZ7 B;  2DD5 A;  2KK4 A;  2YHT A;  3WVD B;  3OW2 S;  2D0Q B;  1BI2 A;  4JUV A;  3RIR A;  4EMK C;  3QZ9 B;  3G6E A;  3G6E T;  3PGG A;  3LX7 A;  4GLK A;  4WF2 A;  3J80 E;  4EMK B;  5GAM h;  2PU9 B;  2WSC E;  3URG A;  2C06 A;  3CCV A;  4DQ2 A;  1ZQ1 A;  3HFO A;  2ZPE B;  5J39 A;  4P5N A;  2E12 A;  4C5I A;  3JCM P;  3VUB A;  3EFR A;  4ZTJ A;  4N0A A;  4N4H A;  3LH0 A;  4BUG A;  3EAE A;  1XNI A;  3TRE A;  5GAM f;  5A2Q E;  3QKJ A;  1NE8 A;  2LNV A;  4LD9 K;  4BDZ A;  1BIA A;  2ZPG B;  5CKB A;  5GAM e;  5CKD A;  5GAN d;  4A54 A;  4IUV A;  2LT4 A;  4L5G A;  5GMK i;  5KCH A;  2KVQ G;  5C0M A;  1N6A A;  4M77 F;  2P0K A;  4C92 D;  5DLO A;  3OYF A;  4Q5W A;  4BAC A;  2V8J A;  1Q81 U;  4KUD K;  2RHZ A;  1RI0 A;  1UGR B;  1UGS B;  2YRV A;  3M59 A;  2RK1 A;  4KBM B;  3V7R A;  2R57 A;  4BI3 A;  2QDY B;  3E9G A;  3RMS A;  1LNX A;  4LDX A;  3JB9 G;  3I55 T;  2XDB A;  1FX7 A;  1M1G A;  1Q82 C;  1JBM A;  2P0P A;  1PSF A;  1M90 U;  3JCM c;  4F7U E;  3MEU A;  4M78 A;  3OYM A;  1VQN T;  5FRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...