2FL7A

S. cerevisiae sir3 bah domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
208
structure length
183
Chain Sequence
LDGWQVIITDDQGRVIENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein SIR3
publication title Structure of the Sir3 protein bromo adjacent homology (BAH) domain from S. cerevisiae at 1.95 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 47
structure length 183
sequence length 208
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fl7A00
1W4SA 4DOVA 1ZBXA 4BB7A 2FL7A 4DOWA 4KUIA 4FT2A 1ZHIA 4KULA 4FSXA 4FT4A 3TU4K 1M4ZA 4KUDK 4JJNK 2FVUA 3PTAA 4DA4A 4LD9K 3PT9A
chains in the Genus database with same CATH superfamily
2MWOA 1MMNA 4C8QG 4A54A 1F1BB 4PK4A 1E6GA 3P8BB 3CXCS 3DLLA 5AYFA 2SRCA 1X75C 1Y96A 2AZVA 3FDRA 2JS2A 5FRMA 2DEQA 4RTYA 4HVWA 2XD0A 2XU8A 2RD1A 4XU3A 3I5RA 4HCCA 3RR6A 2C0IA 3HHTB 1FMVA 2QGGA 1TOVA 3HL8A 4A63B 5CK9A 4J83A 1VQ8A 2FRWA 2BTTA 1B7TA 2FZGB 2QEXT 5IHNA 3HKSA 1WQWA 2FPFA 4JUVA 1AHJB 1Y57A 4OB1B 4D6WA 1NLOC 1VQ7T 3JB9D 3CCMA 5CKFA 1W2BS 4HCKA 2IPOB 3KXTA 2DK3A 2DILA 1VQ8Q 2LC4A 5KYYA 5GAN8 4WF2A 3J80E 3OYDA 2CP7A 2YUNA 2ATCB 1H641 2K5IA 2KRMA 5HKCA 2J6FA 4Y91A 4M7AE 1Q86C 3CCMQ 5FU7B 3PNWC 4M77A 5FWBA 4LXCA 4AT1B 2RQVA 3LX7A 4F17A 2FPEA 1VQNA 3PT9A 3URGA 2HSEB 2F2VA 3SWNA 4N0AC 1MMGA 1IZ6A 3JV3A 4BE0A 2JZ2A 2MWPA 4M7DD 2MF2A 3MEUA 1VQPT 4C92A 1JRIA 1PKSA 1YWPA 1D1BA 2CSIA 5A0GA 1M90R 1PRLC 2K7AA 1QP2A 4M77G 4RTWA 3CMEA 3L2QA 2EW3A 2DXTA 1I5OB 2FZKB 3VS3A 2ESWA 2LP5A 3CCRQ 1KJWA 2M1HA 2A3LA 2K3XA 2LCCA 3G7ZA 1RI9A 4M75C 4PJJA 2A28A 3RKYA 2GQIA 1M8MA 3UATA 3SDZA 4C5IA 2LJ1A 3CMEQ 4C92G 2XI9A 3JCMh 4D8KA 5A2QE 2K57A 1AZEA 3RESA 2RK1A 5GAMj 1ZUYA 3HFNA 4M78B 3SFMA 4A53A 2NUTB 1KHIA 4FYVB 4FSSA 4E7ZA 1YHQT 3ZL7C 2DD4A 3OS1A 4OMLA 4JLIA 4PKCC 4HVVA 3CC2T 4E7IA 4AFSC 4PFPA 3GLXA 1W70A 5KYWB 1W4SA 5KCHA 2D1XA 3H9NA 5CKBA 2BUDA 2RQUA 5GAN3 1DJ7B 2GGRA 1QCNA 1QVFS 2CZ6B 1VQ5A 3H0IA 1QVGP 2MI6A 1GBQA 1N8RC 2GNCA 3LYIA 1NG2A 3UPUA 1WGSA 4BDZA 2L5QA 5IT9E 4JJBA 3SEMA 2E6ZA 2DF6A 4M78F 1RAHB 3E9FA 1VYTA 2CGHA 1QMCA 1FMKA 3HRSA 1VQ5Q 1XTDA 3OYYA 4C0FA 1E6HA 2DLPA 3P8HA 4ORZA 1MV0B 1WHGA 2CDTA 1K9MC 3EFRA 2WSCE 4IUQA 2DAQA 2RMOA 3JB9G 1VQ4T 1WDXA 1SF9A 4B9WA 1YJWT 3RERA 1Y0MA 5KE3A 3A1PA 3MEAA 4OMNA 2L3PA 3VS4A 1WHKA 3FRNA 3CCSQ 2RQTA 4PJOG 3KUFA 4E7LA 2AZSA 3M0TA 2RO0A 2Y4XA 1MNDA 4LDXA 2XK0A 3G4SA 4OP0A 4M7DA 4BB7A 2JMCA 1JEGA 2EAYA 3CC4T 3NPFA 4JRIA 5GMKe 1CKBA 2QXFA 3S3NA 1M9SA 1I0CA 4EMKB 2NWMA 1ZLMA 3CCJQ 3SB2A 3G4SQ 3DB3A 3OYIA 1VQOA 2HL3A 2DZCA 3LH5A 4M75E 3MP8A 1PM3A 1TU0B 2M0YA 4IKFA 1Q7YC 2DERA 3OMCA 5DM7R 1B07A 1Y71A 4E2FB 3R6NA 4EMHA 3VU3C 2K79A 1I07A 2JVVA 1UHCA 1VQOQ 3T9NA 2EGCA 3EGXB 1H8KA 1LOJA 2RHZA 4BD3A 1U3OA 4OGEA 4J8OA 4M7AB 2HBPA 4J9CA 2DTHA 2DVJA 1RAIB 2W0ZA 1X01A 3QPHA 2GF7A 2QQ9A 3MP6A 2R58A 2YWWA 3PFSA 3KFVA 2X4XA 4J9BA 4F7UE 3DKMA 3S3MA 3M53A 7AT1B 1UJYA 2X9HA 1QVGA 2QTXA 3V8LA 2O4XA 2DNUA 2QEXA 2YLBA 4RTTA 3O8VA 5GAN2 5GMKj 1VQ7A 1C6VX 3ZEHA 2KMTA 4NL3A 2OI3A 2VGMA 1P92A 1BIAA 1UE9A 4PJLA 2V8KA 4M7AF 2K5LA 4PLIA 4OMFB 3VS7A 2QEXQ 2ZPGB 4AFUC 2KYMA 1IRXA 3A5ZB 3C4SA 3FLGA 4HXJA 4QVDA 2MOXA 1W6XA 1PSFA 1VQ7Q 1M3AA 4GLMA 3OW2S 1NJIR 5GAMd 1RAEB 2OTJA 5GAN7 1Z9ZA 5GJVB 1M30A 5LJ5f 1MV3A 4QVCA 4IIMA 3G6EA 1TG0A 4HCBA 4ELYC 4HT8A 3GIBA 2DL8A 4QT7A 2ZPHB 1TXQA 2XDDA 2X51A 4BI8B 3OYGA 2G6FX 4XTZA 2KEAA 1VQPA 2FG0A 2V8IA 2DX1A 2E70A 3CCQT 2E3IA 2RA2A 1NM7A 4L6V5 3TSZA 1M2VB 3CD6T 1KQSS 3E1SA 1UGQB 3HP9A 2RNAA 2DYIA 2NUPA 5HCKA 2F2WA 4LDWA 2R5AA 1RABB 2Z0WA 2DMOA 4MDXA 1XJWB 1OYXA 1VQPQ 1BCOA 3GPLA 3BDUA 1ZHIA 1M5Q1 1ABOA 2YRVA 3OBWA 1ACMB 2ROTA 1MHNA 2CP5A 1SSHA 2AKLA 1WLPB 2CREA 1X2QA 3QZ5B 1GL5A 2ZAEA 2EQKA 1IGUA 2DXBA 2QA4T 1EZZB 1PRMC 1ZX6A 5HK3A 4FW1A 2P0QA 2ZPEB 1YHQA 2WACA 4C8QD 2YDLA 4DOWA 2RF0A 8ATCB 1UFFA 4WCIA 1GFCA 1FWZA 3CC2A 4N4IA 3J7AF 2O9VA 1RI0A 4BI4A 4XTWA 2HSPA 1KC8R 3AT1B 2C0TA 2RI5A 3HRTA 2X4JA 2A7YA 2QQRA 4N4GA 3CC2Q 1K8AU 2PVGB 2RJCA 3JSCA 1G8XA 3REBB 2QDLA 2NYSA 3G71A 4KUDK 1U06A 1Q81C 2KRSA 1QCOA 3P8DA 2E64A 4M75B 3A8OB 4OMOA 2ZPIB 3MKDA 3VRZA 3A98A 1GBRA 1VQ4A 1WZOA 1YJWA 2ZCFB 4F16A 1K73C 1G3WA 5LJ3g 2OAUA 3NHNA 4KT0E 1AOJA 4CC2A 1N6AA 1WHMA 5J26A 1PC0A 4OMQA 1MGQA 2D0NA 2DL3A 1VQ4Q 3CC4A 1AWXA 1YJWQ 1N27A 1VQLT 2JT4A 2HQXA 1C1AA 3SWNC 2ZPFB 4M75F 4C0ZA 1BI2A 4F7UB 2HBWA 1QP3A 1IHWA 2BZYA 3EGDB 1RAAB 2COWA 1G2BA 3CC4Q 2RB6A 4C0DC 1YITT 4J9EA 5CKHA 4J5YA 1Q86R 1PSEA 4KGXB 1A0NB 2JTEA 3BY7A 4XU0A 2K3YA 1QVPA 3CCET 5IAYA 3GBQA 5I11A 2P4TA 2P84A 4OF1A 4CC7A 3LWIA 6AT1B 3CBMA 1U1SA 4OMPA 2NUTA 2LX7A 1GCQC 4GBQA 4C8QA 4O6JA 4Z88A 4DBFA 1BIBA 1NE8A 4M7AD 4F7UF 2FPDA 4PLLA 4JS5A 4LNPA 1D1AA 1Q95G 4FYYB 4FT4A 2LX9A 4ZN3A 1UG1A 5KYWA 1ZUKA 4XK8E 2CH4A 2KNBB 2LZ6B 5FWCA 2RQWA 3HSBA 4QVZA 2J6KA 2PVOB 4M78G 4A4EA 3OYAA 2BIVA 4JDSA 5KYNA 2JXBA 1TWBA 1WHLA 1X27A 4MMLA 4O5VA 2BKDN 2YT6A 1W1FA 1VQ6T 1T3LA 1YJ9T 1UHFA 3THKA 4PFOA 4J6XA 1HYOA 1UGSB 1ZBXA 2BE9B 4FU6A 4HVUA 4AG1C 2QK0A 4ZGJB 1KD1C 3NFCA 2EVRA 3QKJA 5GANj 1UEBA 3N5BB 1OU8A 3RIRA 2FZCB 3OMGA 4BE2A 4J7FA 4PJOD 2D0QB 1M8VA 2HDAA 2MPXC 3CPWS 3VKIA 3CCQA 2F1LA 1BBZA 4PL6A 5GAMe 2FEIA 3ME9A 2YUPA 2MCNA 1BYMA 9ATCB 1K4US 4EMKA 3CD6A 4J9HA 2DIGA 4FW2A 4M7DC 1UGVA 1OEBA 4CC3A 1PWTA 2EKOA 1YFNA 1IGQA 3V7CA 3CCQQ 3CCRA 1Q82C 3OB9A 2VYTA 2L0AA 3CD6Q 2EWNA 1QWFA 1NJIU 5J3BA 1RAGB 3M9QA 3C95A 3MEWA 4IURA 1PG5B 3MO8A 1NPPA 3EGXA 5KCOA 4IIOA 2QA4A 1JJ2S 4J6WA 1VA7A 2DM1A 4M7AA 1TUGB 4QKUA 4C5GA 2RHXA 2K4YA 3R6OA 1TTHB 4HA8A 5GMKi 3RNJA 1K8AR 3L2ZA 4RCBA 3HRUA 2KI7A 5IXBA 4FYXB 4FT2A 5GJWB 1ZBJA 2F69A 2CZ0B 1VIFA 2JMAA 2MK5A 3FEOA 1UECA 2QA4Q 1M1KR 5I2SA 3JCMX 1SRLA 2XIDA 4E7JA 4Q5WA 2CUDA 1AVZC 1G3SA 4M7AG 3X26B 3OYCA 1QCFA 2J6OA 3M54A 3TQ7P 3QDRB 4OVAA 1NYGA 2DTIA 3GNGA 1KSWA 2I0NA 1D0XA 1R0CB 1G5VA 3OYHA 3EG0A 2DEUA 1JQQA 2KDSA 4KGZB 4AFZC 5CIUA 3WXMB 1IO6A 4C5EA 3JCMg 4M75D 2DL5A 2JM8A 4CRIA 3OYEA 4ME7A 3PVQA 3SD4A 3RMSA 2JS0A 3LGLA 3CCUT 4RG2A 1QQJA 3OYBA 1MMAA 1T0JA 2LT4A 2DRKA 2V1RA 2QI2A 3LLRA 1U8RA 4DEXA 4V2SA 4PJOA 5GANg 3E9GA 3I55Q 3HPWA 2GTOA 1HK9A 3CCSA 4ZTJA 5I22A 2V8JA 3PIOA 5KE2A 1VQLA 2RN8A 2YRCA 1OV3A 2IG0A 1KC8U 1M2VA 1BI0A 2YUQA 3EFOB 4M7DE 1D1CA 3H41A 1WXBA 1R0BG 2I2LA 1KQ1A 3M4GA 5EG2A 3RUXA 2NLUA 1VQLQ 3CXCP 1YITA 3CCJA 4AG2C 2FL7A 5I21A 2J06A 2L2PA 1T0HA 4RTUA 1JXOA 5A0LA 1VQMT 5GAN5 3PMIA 5J39A 2EGAA 2Y90A 2JN0A 5C6SA 3VS5A 1M90C 1FMWA 1EX4A 4ANJA 1M2OA 3LW5E 5GANd 1YITQ 1JU5C 2F5KA 5GMKm 3RBBB 3KBGA 5GAN4 2DXCA 5GAOp 1VUBA 3CCEQ 2KGTA 3GNFB 5KYYB 2AHJB 4IUPA 1AT1B 1H3HA 4JLGA 1W2BP 3E19A 5LJ3e 1HJDA 1OX9A 3CBPA 2EYWA 3GP8A 2FVUA 2RQRA 4DA4A 1WI7A 1AEYA 3EHQA 4ZTFA 1U5SA 1ZQ1A 2LMJA 1YNZA 2YLCA 2GQVA 2J05A 5GAMh 1NEBA 5GMKl 3M55A 1ZSZB 2E41A 2K3BA 1WJRA 4QW2A 2RI3A 2P0KA 2DYBA 1JBMA 1OZ2A 3M4YA 1VQ6A 2ENMA 2OJ2A 4B9XA 5GAOn 4OB0B 3PMTA 1Q86U 1FXXA 2F2XA 1YJ9A 2KE9A 1S1NA 2FRYA 3VJPA 4M75A 3EG9B 2D8JA 2YSQA 2XHCA 4KRTA 4C0DB 3X20B 2RHYA 1UB4A 3D7SB 2WSEE 2HL5C 3A8HB 1VQ6Q 4F04B 3ER0A 5IXFA 2EGEA 1YJ9Q 5DY9A 4PNOA 3QYGB 4ESRA 5IN1A 5ECAA 1IXDA 5FU7C 5GAN6 1X69A 2VC8A 4M75G 4P5NA 3QZ9B 3OYFA 2OTLT 3A8GB 4EMGA 1D09B 2O9SA 4RTVA 4UC4A 4BY6B 4F7UA 2VXEA 5LJ3j 1OULA 2CH4W 2E5KA 5FLXE 3TU4K 4KH0B 1M4ZA 1G83A 3EGDA 1K0XA 2K2MA 4RMOA 1X2KA 1QLYA 3CXCA 4OGCA 8AT1B 2KK4A 1IHVA 1AD5A 5CQYA 2CKKA 3WVDB 3QUIA 2CZ7B 2DRMA 2PUOB 1WXTA 1CKAA 4E7KA 1S72T 4FM4B 4XAXB 2EKHA 4F7UG 2H3JA 2BZ8A 5FRNA 3C12A 1X43A 3O5ZA 3SHWA 2HKQB 4LDVA 2LDMA 1SHGA 1QVFP 2EJGA 4QQGA 1OZ3A 2M0OA 2MYSA 3OYMA 3FIFA 4AFQC 4FCYA 1W2BA 1N8RU 3I56T 5LL6S 2X4YA 4BUGA 3CCVT 4C8QC 2VUBA 3CPFA 2VB6A 2RHUA 2K9GA 2SEMA 3BDLA 2EJFA 3JCMc 4M78D 2YUOA 2JTFA 5KYXB 2CZ1B 3C0CA 4GY5A 3OYNA 1K9MU 1I81A 1NPRA 3UF4A 1RLQC 1SPKA 4RUGA 2VGNA 3HFOA 1UDLA 1GCPA 3JCMJ 2JOYA 3A8LB 1PNJA 4JRKA 2R5MA 3CCLQ 3EG3A 2KR3A 2M51A 1EFNA 1TUCA 1YIJQ 3CCUA 3PE0A 5GMKh 2R57A 2RK2A 5L8RE 2IVWA 5LJ5j 2CP6A 4KULA 4JS4A 1ZSGA 1YCYA 1OI1A 4JJNK 3PTAA 2KT8A 2PQWA 1X6GA 1X6OA 1YN8A 3MHXA 1QKXA 1M1KU 2LRQA 4DEYA 4M7DF 3CC7T 1TH7A 3CCUQ 3I55T 4FIBA 1YI2Q 1RL2A 4ELZC 2LJ0A 2VV5A 1NJIC 2VWFA 4LDUA 4Y28E 1WYXA 2DFUA 4JJCA 4MZTA 3QWYA 2DBKA 2GFUA 4M4ZA 2RPNA 3CEYA 2XG8D 1K1ZA 2H3EB 2QASA 1FYNA 1WJQA 3PGGA 5CCAA 4EMKC 3M56A 4XU1A 4M77C 1KD1R 4PJMA 2QYZA 4E6RA 1VQMA 3GOXA 2B86A 1YP5A 2DJZA 1FX7A 1XOVA 2A36A 2DO3A 3S3OA 2JW4A 3X24B 4IUVA 1QVFA 2M02A 4LD9K 4RTZA 2F5TX 3M0RA 3JCMe 2CT3A 3QJYA 4C92C 1BK2A 4JRQA 1VQMQ 2VVKA 4HT9A 4C5HA 1O9SA 4C8QE 4JPBW 2E4HA 5LJ3d 5L23A 4JRPA 3EFSA 5CQXA 2QTVA 2CYZB 2DVEA 5GANe 4M78A 2EBPA 3X25B 4K11A 4DBRA 1Q82R 3RMQA 3EG2A 3OW2P 2PZ1A 2HKNA 5FW9A 1D3BB 2CP3A 1QVGS 3JCMP 1OU9A 4BI3A 1I5LA 1M27C 3QIIA 3DLMA 1SEMA 1I8FA 5KYUB 2YRDA 4R55A 2IIMA 3EH1A 3RKXA 1KC8C 5IHKA 3EH2A 2HQEA 4F14A 2DKGA 1NYFA 4Z89A 3OSSC 5LJ5g 1KQSP 3A8MB 1MNEA 1MMDA 2OTLA 1WIEA 1H3ZA 3BFMA 2LQKA 2LQ8A 5FROA 5CVIA 1JO8A 1WA7A 2BZXA 2G3RA 2B8AA 4DOVA 1WHJA 2KXCA 2ROLA 4NL2A 2KT1A 3EFOA 4RKUE 2DTOA 4PJOC 3QJ6A 4KUIA 4EPCA 3JRZA 1MUZA 2GFAA 2A0FB 4MMKA 3M0PA 2OTLQ 3JB9H 1OX8A 4E7SA 1LVKA 3FJPA 1M3CA 1AWJA 1BCMA 4A4KA 1BI3A 5C0MA 4FYWB 1V29B 1Y7XA 4E47A 1S72A 5D6WA 2DETA 1PCXA 4M77E 1Z9QA 1N8RR 5DLOA 1YJNT 5GAMf 5CO7A 1LCKA 2X4WA 2EJ9A 2AIRB 5EC7A 1E7OA 2HZYA 5LJ5d 1SKUB 2RJDA 2QQAA 2E5QA 1ZUUA 4L5GA 4N4HA 1KQ2A 3VUZA 3GF5A 4CI0C 1S72Q 3JB9I 4C92E 3AHUA 3QO3A 2DA9A 3VYGA 2KXDA 3I56A 1K9MR 3NGPA 2V26A 3QDFA 3CCVA 1NEGA 2HAXA 2V1QA 2P0PA 2E6NA 3JAME 4LDYA 2OTJT 2KYBA 2MMPA 5GAOq 4OB3B 4ZGEB 1Q81U 1ZSZA 4LUDA 1WQ7A 3G6ET 3Q1JA 2EFIA 3CMAT 2DJQA 3I5SA 1V76A 3OW2A 3QHSA 3UWNA 3I56Q 3L2UA 2CP2A 2P4RA 2PU9B 3CCVQ 1B34B 3EGUA 3EG9A 4RTXA 1SSFA 3VV0A 1K73U 1GRIA 5IHIA 5FU6C 3OSVA 3L2VA 1NBEB 2DPPB 1RAFB 4XTYA 1VQNQ 1QWEA 3MP1A 2DIQA 2QQSA 2XDBA 2JUFA 3JCMQ 1ABQA 2DD5A 1Q7YR 4XTXA 1KQSA 3CCLT 4XQ3A 1GCQA 4FSXA 3INZA 2CT4A 3M58A 1YIJT 1OPKA 2LCSA 1M3BA 4XU2A 2FYKA 2DBMA 2RI2A 4Z8AA 3CC7A 2EYYA 4X34A 3I55A 1RACB 3WVEB 5I2MA 3META 3NTIA 4R56A 4PJOE 4C8QB 1UGRB 3E2UA 2LNHB 2KY9A 1N9RA 5GANh 3V7RA 1YI2T 1VQKT 3ASKA 2KAFA 2XICA 4BE1A 3CC7Q 3OS0A 4BACA 1I1JA 3OA6A 1K9AA 2EQMA 1LJOA 3QXEB 3QYHB 4J9DA 2KVQG 4CC4B 2COZA 3QSUA 1PD0A 1KHCA 4OMMA 2XMFA 3J81E 3TVTA 1T3SA 2AK5A 2GCXA 3QBYA 4R0KA 2K5FA 2D6FA 3FJ5A 4MZMA 3VYHB 1Y96B 2QGFB 3NMZC 3G71T 1I4K1 2CP0A 1QW1A 3NTKA 2GTJA 4C8QF 3OYKA 2EYQA 2LVMA 2EPDA 1KIKA 5D6YA 2E65A 3JCMd 3EG1A 4EDUA 1R8OB 2JM9A 4VUBA 3V8KA 2KQWA 4EIKA 1SG5A 3OY9A 2LTOA 3VS6A 3PIPA 3CCEA 1TS9A 4ATOA 2ABLA 3CBOA 4HKEA 2DE0X 3I9QA 3IQLA 1BI1A 1OOTA 3L1AA 3TCJA 5KYXA 2LJ3A 1D0YA 5M9OA 1K0SA 1SRMA 2PUKB 1SHFA 2M16A 2LT1A 1J3TA 3TEEA 4RCCA 2LQWA 2C0OA 1VQ9T 4LUEA 1VYUA 3LGFA 1K8AC 4C0GA 2CSQA 2RM4A 1KD1U 3RDVA 4N0AA 2GBQA 5HK0A 5LJ3f 5D7UA 1LPLA 4DQ2A 4AMCA 1M1FA 4XTUA 1NLPC 2XKOC 1M1KC 1WXUA 4M77B 3L42A 4JZ4A 2DL7A 3CPWP 2KSSA 4ZNXA 4M7DG 2PNIA 1KG1A 5IH2A 2ED0A 3SWNB 1V1CA 2DZ9A 1WNLA 4J9IA 2FHDA 1TSFA 3V8JA 1AWWA 4C92B 3UA6A 2EYXA 3FC3A 2ECZA 4KGVB 2CUBA 1WX6A 2COYA 3VS1A 5GAMg 1R77A 1BB9A 1Q82U 1AZGB 1RUWA 3VS2A 2OAWA 4MDWA 2E1HA 4M77F 3M0QA 5D6XA 3NTHA 2ZZDA 4MZPA 1UUEA 1JJ2P 1WJSA 2CS7A 4TVRA 1ZA2B 1HD3A 1WPYA 2EIFA 4XTVA 3V7SA 2FO0A 1RADB 5DLQE 3H6ZA 5GAOm 1YJNA 3ZFJA 5CR2A 3U23A 2HQHA 4C92F 5HY6A 2VASA 3ZBDA 4WTOB 3M59A 2FB7A 1Q81R 2M9UA 4J9GA 1JXMA 1YWOA 3UT1A 2O88A 5CKDA 3EHRA 3C94A 4JJDA 2O01E 1XNIA 3L2RA 1YJNQ 1RLPC 5GAOl 2BE7D 2YHTA 4J6YA 1WHHA 3MPUB 1VQ8T 4II1A 2LNVA 2JJ9A 1K73R 4A4FA 2LQNA 4ZGDB 2H8HA 4LE9A 1LNXA 5LJ5e 3FB9A 1ZA1B 3CMAA 1BKBA 3CCMT 4GLKA 4D8DA 1CSKA 1D3BA 3JCMb 2QDYB 3TREA 2QG9B 2KBTA 4PJOB 3M0SA 2J7IA 4L59A 2A37A 1YBYA 2OTJQ 2EQJA 2QQBA 2HEQA 4M78C 2KROA 3G6EQ 3CMAQ 3JCMV 2O31A 4OB2B 4NS5A 2HCKA 5KYUA 1KFZA 3QG1A 4DBHA 1X6BA 3CPWA 1G3YA 3BW1A 1HSQA 2AT1B 4PJNA 1VQNT 1C0MA 3CCLA 2ZPBB 3JB9F 2RJEA 1K76A 3CCRT 1YIJA 1GFDA 4M7DB 3S6WA 2WSFE 3OYJA 1O75A 4PJOF 3L2WA 3H8ZA 4B6MA 4FL6A 2X3WD 3OQ5A 2KRNA 3CMET 4KH1B 3EAEA 1N5ZA 4IUUA 3VUBA 4RG8A 1XQHA 5CKEA 3DB4A 3HTRA 3VRYA 3ULRB 1VOMA 2YXYA 4ZN1A 1YI2A 1JJ2A 1VQKA 3UDCA 2L3RA 1BU1A 3BE3A 3M57A 2VXFA 3REAB 1ARKA 2ED1A 3G1JA 1M90U 2NUZA 4Y92A 1GXIE 3JCMW 1D0ZA 2RJFA 2ZGWA 1YHQQ 4HCZA 4JZ3A 1M1GA 2O2OA 4A4HA 3OBYA 4J9FA 1B3QA 2QAZA 3I35A 2OX7A 3MCAB 4J7IA 5FU6B 5LJ3h 2A08A 1VQKQ 1AWOA 1Q7YU 1JB0E 2EQUA 3LH0A 1UGPB 3MJXA 5GAOr 1WFWA 3CQTA 4LN2A 1TUDA 3RKWA 3M0UA 1IB8A 2LCLA 1U1TA 5CAIA 1VQ5T 2O4XB 3G71Q 4BDYA 4YTLA 5A0DA 5KH6A 2DXUA 2K6DA 2L8DA 4QQDA 3UA7A 3QWXX 1PD1A 2RHIA 4IUTA 1IREB 1VYVA 2Y4YA 2K2VA 3JCMf 1B34A 4KBMB 3LWHA 3JB9J 3CCST 3OS5A 4X9DA 1VQ9A 2EQIA 1ZSZC 2PVDB 2HNIA 4M78E 1PKTA 2W10A 2C06A 4M7AC 3H0HA 2HMAA 1NZ9A 1UJ0A 2JTMA 3VS0A 2RH2A 2L3SA 2E10A 2XDPA 4M77D 5AT1B 4DBQA 3MEVA 5GANf 3H0FA 3F70A 4A4GA 1VQ9Q 2VKNA 2X35A 3CCJT 3G4ST 2E12A 2X3XD 2L3QA 1N9SA 3OS2A 1OPLA 4X1VA 1VIEA 4C92D 1KK7A 1UTIA 1HXDA 4E7HA 1QKWA 3TSWA 2PTKA 2L89A 4LD6A 3X28B 2E3HA 3M5AA 2D8HA 2MIOA 2HD0A 1H92A 1YCSB 2NUPB 4X9CA 1EIFA 2D9TA 4Z02A 1VQOT 5LJ5h 4NOYA 2MAMA 1OQKA 2DL4A 2JNGA 4BY6C 1Y07A 4PFZA 2AKKA 1PHTA 4QQ6A 2EYZA 1G3TA 3PVLA 3OYLA
chains in the Genus database with same CATH topology
2MWOA 4X34A 4C0DB 4XTWA 2RHYA 1UB4A 3X20B 3I55A 2WSEE 4C8QG 3WVEB 5I2MA 4A54A 3META 2RI5A 3CXCS 3NTIA 3P8BB 3HRTA 4R56A 3DLLA 2X4JA 3A8HB 5AYFA 4PJOE 2A7YA 2QQRA 4N4GA 4C8QB 1UGRB 3ER0A 1X75C 1Y96A 2KY9A 5DY9A 2PVGB 2RJCA 3FDRA 3JSCA 4PNOA 3QYGB 1K8AU 5FRMA 2DEQA 1N9RA 5GANh 2XD0A 3V7RA 1YI2T 2XU8A 2RD1A 3G71A 4XU3A 5IN1A 3ASKA 1VQKT 4HCCA 2KAFA 2XICA 4BE1A 4KUDK 1Q81C 3OS0A 5FU7C 4BACA 5GAN6 3OA6A 2VC8A 4M75G 3HHTB 4P5NA 3QZ9B 3OYFA 2EQMA 2OTLT 3A8GB 1LJOA 3HL8A 3QXEB 3P8DA 3QYHB 2KVQG 2E64A 4J83A 4EMGA 5CK9A 4M75B 3A8OB 2ZPIB 1VQ8A 3QSUA 2QEXT 1KHCA 3HKSA 4UC4A 4BY6B 1WQWA 4JUVA 4F7UA 1AHJB 2VXEA 3J81E 1VQ4A 5LJ3j 4OB1B 1YJWA 4D6WA 2ZCFB 1K73C 1G3WA 5FLXE 2GCXA 5LJ3g 3TU4K 3QBYA 1VQ7T 3JB9D 1M4ZA 2K5FA 2OAUA 3CCMA 4MZMA 2D6FA 5CKFA 3VYHB 1W2BS 1Y96B 4RMOA 3G71T 3KXTA 1I4K1 2DK3A 4KT0E 3CXCA 1QW1A 1N6AA 3NTKA 4C8QF 3OYKA 2EYQA 2LVMA 2KK4A 4OGCA 5J26A 5D6YA 2E65A 2CKKA 5CQYA 3QUIA 3WVDB 3JCMd 2LC4A 2CZ7B 1MGQA 2PUOB 5GAN8 4WF2A 3J80E 4EDUA 1R8OB 4VUBA 3V8KA 2KQWA 3OYDA 3CC4A 4E7KA 1S72T 1H641 1N27A 4FM4B 1VQLT 4XAXB 2K5IA 2HQXA 5HKCA 3OY9A 2LTOA 4F7UG 2H3JA 3PIPA 4Y91A 5FRNA 3C12A 4M7AE 1Q86C 3SWNC 2ZPFB 3CCEA 4M75F 3PNWC 5FU7B 4ATOA 4M77A 3CBOA 4HKEA 4C0ZA 1BI2A 4F7UB 1QP3A 3LX7A 1BI1A 3L1AA 4LDVA 2LDMA 3TCJA 1VQNA 3PT9A 3URGA 2EJGA 4QQGA 5M9OA 2PUKB 1OZ3A 3SWNA 2M0OA 4N0AC 2M16A 1IZ6A 2LT1A 2RB6A 3FIFA 3OYMA 3TEEA 4C0DC 1YITT 4BE0A 2JZ2A 4RCCA 5CKHA 4J5YA 1VQ9T 1W2BA 2MWPA 1PSEA 1N8RU 4M7DD 2MF2A 3BY7A 3LGFA 3MEUA 1K8AC 4C0GA 2RM4A 4XU0A 5LL6S 2X4YA 4BUGA 3I56T 4C92A 1VQPT 1KD1U 1JRIA 3CCVT 2K3YA 4C8QC 4N0AA 5HK0A 1QVPA 5LJ3f 5A0GA 2VUBA 4DQ2A 3CCET 3CPFA 5IAYA 1QP2A 4M77G 3CMEA 2RHUA 3L2QA 1M1FA 2P4TA 4OF1A 4XTUA 3LWIA 2XKOC 2DXTA 3CBMA 1M1KC 1U1SA 4M77B 3L42A 3BDLA 4C8QA 2EJFA 4O6JA 3JCMc 1BIBA 1NE8A 2M1HA 4M78D 2A3LA 4M7AD 2K3XA 2KSSA 2LCCA 3G7ZA 2JTFA 4F7UF 4M7DG 1KG1A 2CZ1B 4M75C 3RKYA 3SWNB 4PLLA 4GY5A 4JS5A 3OYNA 1K9MU 1I81A 2DZ9A 4FT4A 1NPRA 1WNLA 2LX9A 3SDZA 4C5IA 4ZN3A 2FHDA 4XK8E 4C92G 2XI9A 2VGNA 3HFOA 3JCMh 3V8JA 3JCMJ 4C92B 5A2QE 2K57A 2JOYA 3A8LB 3HSBA 4JRKA 4QVZA 2R5MA 3FC3A 2PVOB 4M78G 3RESA 2RK1A 4A4EA 5GAMj 3OYAA 2BIVA 4JDSA 3HFNA 5GAMg 3CCUA 4M78B 3SFMA 4A53A 5GMKh 2R57A 1KHIA 2RK2A 1Q82U 5L8RE 4MMLA 4O5VA 2BKDN 2IVWA 5LJ5j 1YHQT 4MDWA 2DD4A 4KULA 2E1HA 4M77F 3OS1A 5D6XA 4JS4A 4JLIA 1YCYA 4PKCC 3NTHA 2ZZDA 1OI1A 4MZPA 3CC2T 1VQ6T 4E7IA 4JJNK 3PTAA 1YJ9T 1WJSA 2PQWA 2CS7A 4TVRA 1X6OA 3MHXA 3GLXA 1WPYA 2EIFA 4XTVA 3V7SA 1W4SA 2LRQA 5KCHA 5CKBA 1M1KU 4M7DF 2BUDA 5GAN3 5DLQE 3CC7T 1DJ7B 1TH7A 3H6ZA 1UGSB 4J6XA 5GAOm 2CZ6B 1ZBXA 1YJNA 3ZFJA 1VQ5A 1QVFS 5CR2A 4FU6A 3I55T 4FIBA 1RL2A 4ELZC 2MI6A 1N8RC 4C92F 3LYIA 5HY6A 2VV5A 4ZGJB 3ZBDA 1WGSA 3UPUA 1NJIC 1KD1C 3M59A 4BDZA 3NFCA 2FB7A 4LDUA 2L5QA 5IT9E 3QKJA 2M9UA 2E6ZA 5GANj 4Y28E 1UEBA 3N5BB 3UT1A 4M78F 4MZTA 3RIRA 2GFUA 3C94A 3OMGA 5CKDA 3CEYA 3E9FA 4BE2A 2XG8D 4J7FA 2O01E 2CGHA 1XNIA 1WJQA 3L2RA 3PGGA 4PJOD 3HRSA 5CCAA 1XTDA 4EMKC 3OYYA 5GAOl 2D0QB 4C0FA 2YHTA 1M8VA 3M56A 4J6YA 4XU1A 3P8HA 4M77C 3CPWS 3VKIA 3CCQA 5GAMe 4PL6A 4II1A 1VQ8T 2LNVA 3ME9A 1VQMA 3GOXA 1BYMA 4A4FA 1K9MC 3EFRA 2WSCE 4IUQA 2DAQA 4EMKA 4ZGDB 3JB9G 1VQ4T 1LNXA 1FX7A 1XOVA 2DJZA 2DIGA 3CD6A 2DO3A 4B9WA 3FB9A 5LJ5e 3S3OA 1YJWT 3CMAA 3X24B 5KE3A 3RERA 4M7DC 3MEAA 4IUVA 1QVFA 1BKBA 3FRNA 4LD9K 3CCMT 4PJOG 3KUFA 4GLKA 2F5TX 3JCMe 4E7LA 2EKOA 2RO0A 2Y4XA 1D3BA 3QJYA 3JCMb 2QDYB 4LDXA 3TREA 4C92C 4PJOB 2XK0A 3G4SA 4OP0A 3V7CA 4L59A 4M7DA 4BB7A 3CCRA 1YBYA 4JRQA 1Q82C 3OB9A 4HT9A 2EQJA 2QQBA 2VYTA 4C5HA 2EAYA 3CC4T 2EWNA 4M78C 4JRIA 5GMKe 1NJIU 1O9SA 3M9QA 5J3BA 3JCMV 4C8QE 4OB2B 3C95A 4NS5A 3MEWA 2QXFA 4IURA 5LJ3d 3MO8A 4JRPA 1NPPA 3QG1A 5KCOA 3EFSA 5CQXA 3S3NA 1M9SA 2CYZB 2DVEA 3CPWA 4EMKB 5GANe 2QA4A 1JJ2S 1G3YA 3BW1A 4J6WA 3SB2A 4M78A 4M7AA 3X25B 3DB3A 4C5GA 2RHXA 1VQNT 3RMQA 3OYIA 2K4YA 3R6OA 1VQOA 4HA8A 5GMKi 2DZCA 3CCLA 2ZPBB 4M75E 3MP8A 3JB9F 3L2ZA 4RCBA 2RJEA 4IKFA 3HRUA 3CCRT 1D3BB 1QVGS 3JCMP 4FT2A 1YIJA 1Q7YC 2F69A 3OMCA 4M7DB 3S6WA 2WSFE 5DM7R 3OYJA 1O75A 2CZ0B 4PJOF 3L2WA 3H8ZA 1VIFA 4BI3A 3FEOA 3OYLA 1I5LA 1Y71A 4FL6A 5I2SA 4EMHA 3JCMX 3VU3C 3QIIA 3OQ5A 2XIDA 4E7JA 4Q5WA 2JVVA 3DLMA 3CMET 1I8FA 3EAEA 3T9NA 1G3SA 4M7AG 3X26B 1LOJA 2RHZA 4IUUA 3VUBA 4BD3A 4R55A 3OYCA 4RG8A 1XQHA 3M54A 5CKEA 4OGEA 3DB4A 3QDRB 4J8OA 4OVAA 3RKXA 1KC8C 4M7AB 2HBPA 2DTIA 2DTHA 3GNGA 2HQEA 4ZN1A 3QPHA 1X01A 1YI2A 2DKGA 1G5VA 1JJ2A 2GF7A 2QQ9A 3UDCA 2L3RA 3OYHA 1VQKA 3MP6A 3OSSC 5LJ5g 2R58A 3M57A 2VXFA 3A8MB 3PFSA 2KDSA 2OTLA 5CIUA 3WXMB 1M90U 2X4XA 3BFMA 2LQKA 1H3ZA 4C5EA 2LQ8A 4F7UE 5FROA 3JCMW 3JCMg 4M75D 3DKMA 1GXIE 3S3MA 2RJFA 3M53A 5CVIA 1QVGA 2ZGWA 2QTXA 3V8LA 2G3RA 2O4XA 2B8AA 4ME7A 4HCZA 3SD4A 4CRIA 3OYEA 4DOVA 1M1GA 3RMSA 2YLBA 4A4HA 4NL2A 3O8VA 4RKUE 2DTOA 3OBYA 5FU6B 5GAN2 4PJOC 5LJ3h 3MCAB 3QJ6A 3LGLA 4J7IA 4KUIA 5GMKj 1VQ7A 4EPCA 3CCUT 3JRZA 4RG2A 3OYBA 1Q7YU 1JB0E 2EQUA 3LH0A 2LT4A 2GFAA 1UGPB 3ZEHA 4MMKA 2KMTA 4NL3A 5GAOr 3JB9H 2VGMA 1P92A 2QI2A 3LLRA 3FJPA 1U8RA 1BIAA 4V2SA 2V8KA 4PJOA 5GANg 3E9GA 4M7AF 2K5LA 4A4KA 4PLIA 3HPWA 4OMFB 2ZPGB 1BI3A 3RKWA 5C0MA 1HK9A 3CCSA 2LCLA 4ZTJA 1U1TA 1V29B 1Y7XA 3A5ZB 3C4SA 1RI0A 2V8JA 3FLGA 3PIOA 4E47A 1S72A 5KE2A 5D6WA 4QVDA 1VQLA 4M77E 1PSFA 5DLOA 1YJNT 3OW2S 2IG0A 5GAMf 5CAIA 1KC8U 5GAMd 1VQ5T 5CO7A 1BI0A 2O4XB 2OTJA 5GAN7 4BDYA 4YTLA 5A0DA 2X4WA 2EJ9A 5KH6A 2DXUA 2L8DA 4QQDA 5LJ5f 5LJ5d 4M7DE 4QVCA 3G6EA 2RJDA 2RHIA 4IUTA 2QQAA 2E5QA 4HCBA 1IREB 4L5GA 4ELYC 4N4HA 2I2LA 4HT8A 1KQ1A 2Y4YA 1KQ2A 3GIBA 3M4GA 2K2VA 3GF5A 5EG2A 3RUXA 3JCMf 3VUZA 4CI0C 1B34A 4KBMB 2NLUA 3JB9I 3LWHA 3JB9J 4C92E 3AHUA 3QO3A 1YITA 3CCJA 3CCST 3OS5A 3VYGA 4X9DA 2ZPHB 2XDDA 1VQ9A 4BI8B 2FL7A 3OYGA 4XTZA 3I56A 1VQPA 5I21A 3CCVA 2PVDB 2HAXA 2V8IA 2E70A 3CCQT 2HNIA 2P0PA 4M78E 2E6NA 3JAME 4LDYA 5A0LA 1VQMT 5GAN5 2C06A 4M7AC 2OTJT 3PMIA 5J39A 2MMPA 2RA2A 5GAOq 2Y90A 4OB3B 2JN0A 4L6V5 5C6SA 4ZGEB 1NZ9A 2JTMA 1Q81U 1KQSS 3CD6T 2RH2A 1UGQB 1WQ7A 2XDPA 2E10A 3E1SA 3HP9A 2EFIA 3Q1JA 4M77D 3G6ET 1M90C 3CMAT 3MEVA 2QEXA 5GANf 3LW5E 4LDWA 5GANd 3OW2A 2R5AA 3F70A 3QHSA 4A4GA 2F5KA 4MDXA 5GMKm 3UWNA 1OYXA 2X35A 3L2UA 3CCJT 2PU9B 3KBGA 3G4ST 3GPLA 5GAN4 1B34B 2DXCA 5GAOp 1VUBA 2E12A 3BDUA 3GNFB 1SSFA 1ZHIA 2AHJB 1M5Q1 4IUPA 1N9SA 3VV0A 1K73U 2YRVA 3OBWA 4JLGA 5FU6C 3OSVA 3E19A 5LJ3e 3L2VA 1MHNA 3OS2A 2DPPB 3CBPA 3GP8A 4XTYA 1VIEA 4C92D 2FVUA 3MP1A 2DIQA 2QQSA 4DA4A 2XDBA 4ZTFA 3QZ5B 2JUFA 1HXDA 1ZQ1A 4E7HA 2YLCA 2GQVA 2EQKA 2DXBA 2L89A 5GAMh 5GMKl 4LD6A 3X28B 3M55A 3JCMQ 2QA4T 3M5AA 2E41A 5HK3A 2HD0A 2P0QA 2ZPEB 4X9CA 2DD5A 1YHQA 2WACA 4C8QD 4DOWA 1EIFA 2D9TA 4XTXA 4Z02A 1WJRA 1VQOT 5LJ5h 4NOYA 2RI3A 2P0KA 4QW2A 1KQSA 1JBMA 2MAMA 3CCLT 1OZ2A 1FWZA 3M4YA 4XQ3A 2JNGA 3CC2A 1VQ6A 4BY6C 4FSXA 4B9XA 3INZA 5GAOn 4OB0B 3PMTA 4N4IA 1FXXA 1YJ9A 3M58A 1YIJT 1Y07A 1Q86U 3J7AF 3VJPA 4XU2A 4M75A 4QQ6A 2FYKA 1G3TA 2RI2A 3CC7A 4BI4A 2XHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4S A;  4DOV A;  1ZBX A;  4BB7 A;  2FL7 A;  4DOW A;  4KUI A;  4FT2 A;  1ZHI A;  4KUL A;  4FSX A;  4FT4 A;  3TU4 K;  1M4Z A;  4KUD K;  4JJN K;  2FVU A;  3PTA A;  4DA4 A;  4LD9 K;  3PT9 A; 
#chains in the Genus database with same CATH topology
 2MWO A;  1MMN A;  4C8Q G;  4A54 A;  1F1B B;  4PK4 A;  1E6G A;  3P8B B;  3CXC S;  3DLL A;  5AYF A;  2SRC A;  1X75 C;  1Y96 A;  2AZV A;  3FDR A;  2JS2 A;  5FRM A;  2DEQ A;  4RTY A;  4HVW A;  2XD0 A;  2XU8 A;  2RD1 A;  4XU3 A;  3I5R A;  4HCC A;  3RR6 A;  2C0I A;  3HHT B;  1FMV A;  2QGG A;  1TOV A;  3HL8 A;  4A63 B;  5CK9 A;  4J83 A;  1VQ8 A;  2FRW A;  2BTT A;  1B7T A;  2FZG B;  2QEX T;  5IHN A;  3HKS A;  1WQW A;  2FPF A;  4JUV A;  1AHJ B;  1Y57 A;  4OB1 B;  4D6W A;  1NLO C;  1VQ7 T;  3JB9 D;  3CCM A;  5CKF A;  1W2B S;  4HCK A;  2IPO B;  3KXT A;  2DK3 A;  2DIL A;  1VQ8 Q;  2LC4 A;  5KYY A;  5GAN 8;  4WF2 A;  3J80 E;  3OYD A;  2CP7 A;  2YUN A;  2ATC B;  1H64 1;  2K5I A;  2KRM A;  5HKC A;  2J6F A;  4Y91 A;  4M7A E;  1Q86 C;  3CCM Q;  5FU7 B;  3PNW C;  4M77 A;  5FWB A;  4LXC A;  4AT1 B;  2RQV A;  3LX7 A;  4F17 A;  2FPE A;  1VQN A;  3PT9 A;  3URG A;  2HSE B;  2F2V A;  3SWN A;  4N0A C;  1MMG A;  1IZ6 A;  3JV3 A;  4BE0 A;  2JZ2 A;  2MWP A;  4M7D D;  2MF2 A;  3MEU A;  1VQP T;  4C92 A;  1JRI A;  1PKS A;  1YWP A;  1D1B A;  2CSI A;  5A0G A;  1M90 R;  1PRL C;  2K7A A;  1QP2 A;  4M77 G;  4RTW A;  3CME A;  3L2Q A;  2EW3 A;  2DXT A;  1I5O B;  2FZK B;  3VS3 A;  2ESW A;  2LP5 A;  3CCR Q;  1KJW A;  2M1H A;  2A3L A;  2K3X A;  2LCC A;  3G7Z A;  1RI9 A;  4M75 C;  4PJJ A;  2A28 A;  3RKY A;  2GQI A;  1M8M A;  3UAT A;  3SDZ A;  4C5I A;  2LJ1 A;  3CME Q;  4C92 G;  2XI9 A;  3JCM h;  4D8K A;  5A2Q E;  2K57 A;  1AZE A;  3RES A;  2RK1 A;  5GAM j;  1ZUY A;  3HFN A;  4M78 B;  3SFM A;  4A53 A;  2NUT B;  1KHI A;  4FYV B;  4FSS A;  4E7Z A;  1YHQ T;  3ZL7 C;  2DD4 A;  3OS1 A;  4OML A;  4JLI A;  4PKC C;  4HVV A;  3CC2 T;  4E7I A;  4AFS C;  4PFP A;  3GLX A;  1W70 A;  5KYW B;  1W4S A;  5KCH A;  2D1X A;  3H9N A;  5CKB A;  2BUD A;  2RQU A;  5GAN 3;  1DJ7 B;  2GGR A;  1QCN A;  1QVF S;  2CZ6 B;  1VQ5 A;  3H0I A;  1QVG P;  2MI6 A;  1GBQ A;  1N8R C;  2GNC A;  3LYI A;  1NG2 A;  3UPU A;  1WGS A;  4BDZ A;  2L5Q A;  5IT9 E;  4JJB A;  3SEM A;  2E6Z A;  2DF6 A;  4M78 F;  1RAH B;  3E9F A;  1VYT A;  2CGH A;  1QMC A;  1FMK A;  3HRS A;  1VQ5 Q;  1XTD A;  3OYY A;  4C0F A;  1E6H A;  2DLP A;  3P8H A;  4ORZ A;  1MV0 B;  1WHG A;  2CDT A;  1K9M C;  3EFR A;  2WSC E;  4IUQ A;  2DAQ A;  2RMO A;  3JB9 G;  1VQ4 T;  1WDX A;  1SF9 A;  4B9W A;  1YJW T;  3RER A;  1Y0M A;  5KE3 A;  3A1P A;  3MEA A;  4OMN A;  2L3P A;  3VS4 A;  1WHK A;  3FRN A;  3CCS Q;  2RQT A;  4PJO G;  3KUF A;  4E7L A;  2AZS A;  3M0T A;  2RO0 A;  2Y4X A;  1MND A;  4LDX A;  2XK0 A;  3G4S A;  4OP0 A;  4M7D A;  4BB7 A;  2JMC A;  1JEG A;  2EAY A;  3CC4 T;  3NPF A;  4JRI A;  5GMK e;  1CKB A;  2QXF A;  3S3N A;  1M9S A;  1I0C A;  4EMK B;  2NWM A;  1ZLM A;  3CCJ Q;  3SB2 A;  3G4S Q;  3DB3 A;  3OYI A;  1VQO A;  2HL3 A;  2DZC A;  3LH5 A;  4M75 E;  3MP8 A;  1PM3 A;  1TU0 B;  2M0Y A;  4IKF A;  1Q7Y C;  2DER A;  3OMC A;  5DM7 R;  1B07 A;  1Y71 A;  4E2F B;  3R6N A;  4EMH A;  3VU3 C;  2K79 A;  1I07 A;  2JVV A;  1UHC A;  1VQO Q;  3T9N A;  2EGC A;  3EGX B;  1H8K A;  1LOJ A;  2RHZ A;  4BD3 A;  1U3O A;  4OGE A;  4J8O A;  4M7A B;  2HBP A;  4J9C A;  2DTH A;  2DVJ A;  1RAI B;  2W0Z A;  1X01 A;  3QPH A;  2GF7 A;  2QQ9 A;  3MP6 A;  2R58 A;  2YWW A;  3PFS A;  3KFV A;  2X4X A;  4J9B A;  4F7U E;  3DKM A;  3S3M A;  3M53 A;  7AT1 B;  1UJY A;  2X9H A;  1QVG A;  2QTX A;  3V8L A;  2O4X A;  2DNU A;  2QEX A;  2YLB A;  4RTT A;  3O8V A;  5GAN 2;  5GMK j;  1VQ7 A;  1C6V X;  3ZEH A;  2KMT A;  4NL3 A;  2OI3 A;  2VGM A;  1P92 A;  1BIA A;  1UE9 A;  4PJL A;  2V8K A;  4M7A F;  2K5L A;  4PLI A;  4OMF B;  3VS7 A;  2QEX Q;  2ZPG B;  4AFU C;  2KYM A;  1IRX A;  3A5Z B;  3C4S A;  3FLG A;  4HXJ A;  4QVD A;  2MOX A;  1W6X A;  1PSF A;  1VQ7 Q;  1M3A A;  4GLM A;  3OW2 S;  1NJI R;  5GAM d;  1RAE B;  2OTJ A;  5GAN 7;  1Z9Z A;  5GJV B;  1M30 A;  5LJ5 f;  1MV3 A;  4QVC A;  4IIM A;  3G6E A;  1TG0 A;  4HCB A;  4ELY C;  4HT8 A;  3GIB A;  2DL8 A;  4QT7 A;  2ZPH B;  1TXQ A;  2XDD A;  2X51 A;  4BI8 B;  3OYG A;  2G6F X;  4XTZ A;  2KEA A;  1VQP A;  2FG0 A;  2V8I A;  2DX1 A;  2E70 A;  3CCQ T;  2E3I A;  2RA2 A;  1NM7 A;  4L6V 5;  3TSZ A;  1M2V B;  3CD6 T;  1KQS S;  3E1S A;  1UGQ B;  3HP9 A;  2RNA A;  2DYI A;  2NUP A;  5HCK A;  2F2W A;  4LDW A;  2R5A A;  1RAB B;  2Z0W A;  2DMO A;  4MDX A;  1XJW B;  1OYX A;  1VQP Q;  1BCO A;  3GPL A;  3BDU A;  1ZHI A;  1M5Q 1;  1ABO A;  2YRV A;  3OBW A;  1ACM B;  2ROT A;  1MHN A;  2CP5 A;  1SSH A;  2AKL A;  1WLP B;  2CRE A;  1X2Q A;  3QZ5 B;  1GL5 A;  2ZAE A;  2EQK A;  1IGU A;  2DXB A;  2QA4 T;  1EZZ B;  1PRM C;  1ZX6 A;  5HK3 A;  4FW1 A;  2P0Q A;  2ZPE B;  1YHQ A;  2WAC A;  4C8Q D;  2YDL A;  4DOW A;  2RF0 A;  8ATC B;  1UFF A;  4WCI A;  1GFC A;  1FWZ A;  3CC2 A;  4N4I A;  3J7A F;  2O9V A;  1RI0 A;  4BI4 A;  4XTW A;  2HSP A;  1KC8 R;  3AT1 B;  2C0T A;  2RI5 A;  3HRT A;  2X4J A;  2A7Y A;  2QQR A;  4N4G A;  3CC2 Q;  1K8A U;  2PVG B;  2RJC A;  3JSC A;  1G8X A;  3REB B;  2QDL A;  2NYS A;  3G71 A;  4KUD K;  1U06 A;  1Q81 C;  2KRS A;  1QCO A;  3P8D A;  2E64 A;  4M75 B;  3A8O B;  4OMO A;  2ZPI B;  3MKD A;  3VRZ A;  3A98 A;  1GBR A;  1VQ4 A;  1WZO A;  1YJW A;  2ZCF B;  4F16 A;  1K73 C;  1G3W A;  5LJ3 g;  2OAU A;  3NHN A;  4KT0 E;  1AOJ A;  4CC2 A;  1N6A A;  1WHM A;  5J26 A;  1PC0 A;  4OMQ A;  1MGQ A;  2D0N A;  2DL3 A;  1VQ4 Q;  3CC4 A;  1AWX A;  1YJW Q;  1N27 A;  1VQL T;  2JT4 A;  2HQX A;  1C1A A;  3SWN C;  2ZPF B;  4M75 F;  4C0Z A;  1BI2 A;  4F7U B;  2HBW A;  1QP3 A;  1IHW A;  2BZY A;  3EGD B;  1RAA B;  2COW A;  1G2B A;  3CC4 Q;  2RB6 A;  4C0D C;  1YIT T;  4J9E A;  5CKH A;  4J5Y A;  1Q86 R;  1PSE A;  4KGX B;  1A0N B;  2JTE A;  3BY7 A;  4XU0 A;  2K3Y A;  1QVP A;  3CCE T;  5IAY A;  3GBQ A;  5I11 A;  2P4T A;  2P84 A;  4OF1 A;  4CC7 A;  3LWI A;  6AT1 B;  3CBM A;  1U1S A;  4OMP A;  2NUT A;  2LX7 A;  1GCQ C;  4GBQ A;  4C8Q A;  4O6J A;  4Z88 A;  4DBF A;  1BIB A;  1NE8 A;  4M7A D;  4F7U F;  2FPD A;  4PLL A;  4JS5 A;  4LNP A;  1D1A A;  1Q95 G;  4FYY B;  4FT4 A;  2LX9 A;  4ZN3 A;  1UG1 A;  5KYW A;  1ZUK A;  4XK8 E;  2CH4 A;  2KNB B;  2LZ6 B;  5FWC A;  2RQW A;  3HSB A;  4QVZ A;  2J6K A;  2PVO B;  4M78 G;  4A4E A;  3OYA A;  2BIV A;  4JDS A;  5KYN A;  2JXB A;  1TWB A;  1WHL A;  1X27 A;  4MML A;  4O5V A;  2BKD N;  2YT6 A;  1W1F A;  1VQ6 T;  1T3L A;  1YJ9 T;  1UHF A;  3THK A;  4PFO A;  4J6X A;  1HYO A;  1UGS B;  1ZBX A;  2BE9 B;  4FU6 A;  4HVU A;  4AG1 C;  2QK0 A;  4ZGJ B;  1KD1 C;  3NFC A;  2EVR A;  3QKJ A;  5GAN j;  1UEB A;  3N5B B;  1OU8 A;  3RIR A;  2FZC B;  3OMG A;  4BE2 A;  4J7F A;  4PJO D;  2D0Q B;  1M8V A;  2HDA A;  2MPX C;  3CPW S;  3VKI A;  3CCQ A;  2F1L A;  1BBZ A;  4PL6 A;  5GAM e;  2FEI A;  3ME9 A;  2YUP A;  2MCN A;  1BYM A;  9ATC B;  1K4U S;  4EMK A;  3CD6 A;  4J9H A;  2DIG A;  4FW2 A;  4M7D C;  1UGV A;  1OEB A;  4CC3 A;  1PWT A;  2EKO A;  1YFN A;  1IGQ A;  3V7C A;  3CCQ Q;  3CCR A;  1Q82 C;  3OB9 A;  2VYT A;  2L0A A;  3CD6 Q;  2EWN A;  1QWF A;  1NJI U;  5J3B A;  1RAG B;  3M9Q A;  3C95 A;  3MEW A;  4IUR A;  1PG5 B;  3MO8 A;  1NPP A;  3EGX A;  5KCO A;  4IIO A;  2QA4 A;  1JJ2 S;  4J6W A;  1VA7 A;  2DM1 A;  4M7A A;  1TUG B;  4QKU A;  4C5G A;  2RHX A;  2K4Y A;  3R6O A;  1TTH B;  4HA8 A;  5GMK i;  3RNJ A;  1K8A R;  3L2Z A;  4RCB A;  3HRU A;  2KI7 A;  5IXB A;  4FYX B;  4FT2 A;  5GJW B;  1ZBJ A;  2F69 A;  2CZ0 B;  1VIF A;  2JMA A;  2MK5 A;  3FEO A;  1UEC A;  2QA4 Q;  1M1K R;  5I2S A;  3JCM X;  1SRL A;  2XID A;  4E7J A;  4Q5W A;  2CUD A;  1AVZ C;  1G3S A;  4M7A G;  3X26 B;  3OYC A;  1QCF A;  2J6O A;  3M54 A;  3TQ7 P;  3QDR B;  4OVA A;  1NYG A;  2DTI A;  3GNG A;  1KSW A;  2I0N A;  1D0X A;  1R0C B;  1G5V A;  3OYH A;  3EG0 A;  2DEU A;  1JQQ A;  2KDS A;  4KGZ B;  4AFZ C;  5CIU A;  3WXM B;  1IO6 A;  4C5E A;  3JCM g;  4M75 D;  2DL5 A;  2JM8 A;  4CRI A;  3OYE A;  4ME7 A;  3PVQ A;  3SD4 A;  3RMS A;  2JS0 A;  3LGL A;  3CCU T;  4RG2 A;  1QQJ A;  3OYB A;  1MMA A;  1T0J A;  2LT4 A;  2DRK A;  2V1R A;  2QI2 A;  3LLR A;  1U8R A;  4DEX A;  4V2S A;  4PJO A;  5GAN g;  3E9G A;  3I55 Q;  3HPW A;  2GTO A;  1HK9 A;  3CCS A;  4ZTJ A;  5I22 A;  2V8J A;  3PIO A;  5KE2 A;  1VQL A;  2RN8 A;  2YRC A;  1OV3 A;  2IG0 A;  1KC8 U;  1M2V A;  1BI0 A;  2YUQ A;  3EFO B;  4M7D E;  1D1C A;  3H41 A;  1WXB A;  1R0B G;  2I2L A;  1KQ1 A;  3M4G A;  5EG2 A;  3RUX A;  2NLU A;  1VQL Q;  3CXC P;  1YIT A;  3CCJ A;  4AG2 C;  2FL7 A;  5I21 A;  2J06 A;  2L2P A;  1T0H A;  4RTU A;  1JXO A;  5A0L A;  1VQM T;  5GAN 5;  3PMI A;  5J39 A;  2EGA A;  2Y90 A;  2JN0 A;  5C6S A;  3VS5 A;  1M90 C;  1FMW A;  1EX4 A;  4ANJ A;  1M2O A;  3LW5 E;  5GAN d;  1YIT Q;  1JU5 C;  2F5K A;  5GMK m;  3RBB B;  3KBG A;  5GAN 4;  2DXC A;  5GAO p;  1VUB A;  3CCE Q;  2KGT A;  3GNF B;  5KYY B;  2AHJ B;  4IUP A;  1AT1 B;  1H3H A;  4JLG A;  1W2B P;  3E19 A;  5LJ3 e;  1HJD A;  1OX9 A;  3CBP A;  2EYW A;  3GP8 A;  2FVU A;  2RQR A;  4DA4 A;  1WI7 A;  1AEY A;  3EHQ A;  4ZTF A;  1U5S A;  1ZQ1 A;  2LMJ A;  1YNZ A;  2YLC A;  2GQV A;  2J05 A;  5GAM h;  1NEB A;  5GMK l;  3M55 A;  1ZSZ B;  2E41 A;  2K3B A;  1WJR A;  4QW2 A;  2RI3 A;  2P0K A;  2DYB A;  1JBM A;  1OZ2 A;  3M4Y A;  1VQ6 A;  2ENM A;  2OJ2 A;  4B9X A;  5GAO n;  4OB0 B;  3PMT A;  1Q86 U;  1FXX A;  2F2X A;  1YJ9 A;  2KE9 A;  1S1N A;  2FRY A;  3VJP A;  4M75 A;  3EG9 B;  2D8J A;  2YSQ A;  2XHC A;  4KRT A;  4C0D B;  3X20 B;  2RHY A;  1UB4 A;  3D7S B;  2WSE E;  2HL5 C;  3A8H B;  1VQ6 Q;  4F04 B;  3ER0 A;  5IXF A;  2EGE A;  1YJ9 Q;  5DY9 A;  4PNO A;  3QYG B;  4ESR A;  5IN1 A;  5ECA A;  1IXD A;  5FU7 C;  5GAN 6;  1X69 A;  2VC8 A;  4M75 G;  4P5N A;  3QZ9 B;  3OYF A;  2OTL T;  3A8G B;  4EMG A;  1D09 B;  2O9S A;  4RTV A;  4UC4 A;  4BY6 B;  4F7U A;  2VXE A;  5LJ3 j;  1OUL A;  2CH4 W;  2E5K A;  5FLX E;  3TU4 K;  4KH0 B;  1M4Z A;  1G83 A;  3EGD A;  1K0X A;  2K2M A;  4RMO A;  1X2K A;  1QLY A;  3CXC A;  4OGC A;  8AT1 B;  2KK4 A;  1IHV A;  1AD5 A;  5CQY A;  2CKK A;  3WVD B;  3QUI A;  2CZ7 B;  2DRM A;  2PUO B;  1WXT A;  1CKA A;  4E7K A;  1S72 T;  4FM4 B;  4XAX B;  2EKH A;  4F7U G;  2H3J A;  2BZ8 A;  5FRN A;  3C12 A;  1X43 A;  3O5Z A;  3SHW A;  2HKQ B;  4LDV A;  2LDM A;  1SHG A;  1QVF P;  2EJG A;  4QQG A;  1OZ3 A;  2M0O A;  2MYS A;  3OYM A;  3FIF A;  4AFQ C;  4FCY A;  1W2B A;  1N8R U;  3I56 T;  5LL6 S;  2X4Y A;  4BUG A;  3CCV T;  4C8Q C;  2VUB A;  3CPF A;  2VB6 A;  2RHU A;  2K9G A;  2SEM A;  3BDL A;  2EJF A;  3JCM c;  4M78 D;  2YUO A;  2JTF A;  5KYX B;  2CZ1 B;  3C0C A;  4GY5 A;  3OYN A;  1K9M U;  1I81 A;  1NPR A;  3UF4 A;  1RLQ C;  1SPK A;  4RUG A;  2VGN A;  3HFO A;  1UDL A;  1GCP A;  3JCM J;  2JOY A;  3A8L B;  1PNJ A;  4JRK A;  2R5M A;  3CCL Q;  3EG3 A;  2KR3 A;  2M51 A;  1EFN A;  1TUC A;  1YIJ Q;  3CCU A;  3PE0 A;  5GMK h;  2R57 A;  2RK2 A;  5L8R E;  2IVW A;  5LJ5 j;  2CP6 A;  4KUL A;  4JS4 A;  1ZSG A;  1YCY A;  1OI1 A;  4JJN K;  3PTA A;  2KT8 A;  2PQW A;  1X6G A;  1X6O A;  1YN8 A;  3MHX A;  1QKX A;  1M1K U;  2LRQ A;  4DEY A;  4M7D F;  3CC7 T;  1TH7 A;  3CCU Q;  3I55 T;  4FIB A;  1YI2 Q;  1RL2 A;  4ELZ C;  2LJ0 A;  2VV5 A;  1NJI C;  2VWF A;  4LDU A;  4Y28 E;  1WYX A;  2DFU A;  4JJC A;  4MZT A;  3QWY A;  2DBK A;  2GFU A;  4M4Z A;  2RPN A;  3CEY A;  2XG8 D;  1K1Z A;  2H3E B;  2QAS A;  1FYN A;  1WJQ A;  3PGG A;  5CCA A;  4EMK C;  3M56 A;  4XU1 A;  4M77 C;  1KD1 R;  4PJM A;  2QYZ A;  4E6R A;  1VQM A;  3GOX A;  2B86 A;  1YP5 A;  2DJZ A;  1FX7 A;  1XOV A;  2A36 A;  2DO3 A;  3S3O A;  2JW4 A;  3X24 B;  4IUV A;  1QVF A;  2M02 A;  4LD9 K;  4RTZ A;  2F5T X;  3M0R A;  3JCM e;  2CT3 A;  3QJY A;  4C92 C;  1BK2 A;  4JRQ A;  1VQM Q;  2VVK A;  4HT9 A;  4C5H A;  1O9S A;  4C8Q E;  4JPB W;  2E4H A;  5LJ3 d;  5L23 A;  4JRP A;  3EFS A;  5CQX A;  2QTV A;  2CYZ B;  2DVE A;  5GAN e;  4M78 A;  2EBP A;  3X25 B;  4K11 A;  4DBR A;  1Q82 R;  3RMQ A;  3EG2 A;  3OW2 P;  2PZ1 A;  2HKN A;  5FW9 A;  1D3B B;  2CP3 A;  1QVG S;  3JCM P;  1OU9 A;  4BI3 A;  1I5L A;  1M27 C;  3QII A;  3DLM A;  1SEM A;  1I8F A;  5KYU B;  2YRD A;  4R55 A;  2IIM A;  3EH1 A;  3RKX A;  1KC8 C;  5IHK A;  3EH2 A;  2HQE A;  4F14 A;  2DKG A;  1NYF A;  4Z89 A;  3OSS C;  5LJ5 g;  1KQS P;  3A8M B;  1MNE A;  1MMD A;  2OTL A;  1WIE A;  1H3Z A;  3BFM A;  2LQK A;  2LQ8 A;  5FRO A;  5CVI A;  1JO8 A;  1WA7 A;  2BZX A;  2G3R A;  2B8A A;  4DOV A;  1WHJ A;  2KXC A;  2ROL A;  4NL2 A;  2KT1 A;  3EFO A;  4RKU E;  2DTO A;  4PJO C;  3QJ6 A;  4KUI A;  4EPC A;  3JRZ A;  1MUZ A;  2GFA A;  2A0F B;  4MMK A;  3M0P A;  2OTL Q;  3JB9 H;  1OX8 A;  4E7S A;  1LVK A;  3FJP A;  1M3C A;  1AWJ A;  1BCM A;  4A4K A;  1BI3 A;  5C0M A;  4FYW B;  1V29 B;  1Y7X A;  4E47 A;  1S72 A;  5D6W A;  2DET A;  1PCX A;  4M77 E;  1Z9Q A;  1N8R R;  5DLO A;  1YJN T;  5GAM f;  5CO7 A;  1LCK A;  2X4W A;  2EJ9 A;  2AIR B;  5EC7 A;  1E7O A;  2HZY A;  5LJ5 d;  1SKU B;  2RJD A;  2QQA A;  2E5Q A;  1ZUU A;  4L5G A;  4N4H A;  1KQ2 A;  3VUZ A;  3GF5 A;  4CI0 C;  1S72 Q;  3JB9 I;  4C92 E;  3AHU A;  3QO3 A;  2DA9 A;  3VYG A;  2KXD A;  3I56 A;  1K9M R;  3NGP A;  2V26 A;  3QDF A;  3CCV A;  1NEG A;  2HAX A;  2V1Q A;  2P0P A;  2E6N A;  3JAM E;  4LDY A;  2OTJ T;  2KYB A;  2MMP A;  5GAO q;  4OB3 B;  4ZGE B;  1Q81 U;  1ZSZ A;  4LUD A;  1WQ7 A;  3G6E T;  3Q1J A;  2EFI A;  3CMA T;  2DJQ A;  3I5S A;  1V76 A;  3OW2 A;  3QHS A;  3UWN A;  3I56 Q;  3L2U A;  2CP2 A;  2P4R A;  2PU9 B;  3CCV Q;  1B34 B;  3EGU A;  3EG9 A;  4RTX A;  1SSF A;  3VV0 A;  1K73 U;  1GRI A;  5IHI A;  5FU6 C;  3OSV A;  3L2V A;  1NBE B;  2DPP B;  1RAF B;  4XTY A;  1VQN Q;  1QWE A;  3MP1 A;  2DIQ A;  2QQS A;  2XDB A;  2JUF A;  3JCM Q;  1ABQ A;  2DD5 A;  1Q7Y R;  4XTX A;  1KQS A;  3CCL T;  4XQ3 A;  1GCQ A;  4FSX A;  3INZ A;  2CT4 A;  3M58 A;  1YIJ T;  1OPK A;  2LCS A;  1M3B A;  4XU2 A;  2FYK A;  2DBM A;  2RI2 A;  4Z8A A;  3CC7 A;  2EYY A;  4X34 A;  3I55 A;  1RAC B;  3WVE B;  5I2M A;  3MET A;  3NTI A;  4R56 A;  4PJO E;  4C8Q B;  1UGR B;  3E2U A;  2LNH B;  2KY9 A;  1N9R A;  5GAN h;  3V7R A;  1YI2 T;  1VQK T;  3ASK A;  2KAF A;  2XIC A;  4BE1 A;  3CC7 Q;  3OS0 A;  4BAC A;  1I1J A;  3OA6 A;  1K9A A;  2EQM A;  1LJO A;  3QXE B;  3QYH B;  4J9D A;  2KVQ G;  4CC4 B;  2COZ A;  3QSU A;  1PD0 A;  1KHC A;  4OMM A;  2XMF A;  3J81 E;  3TVT A;  1T3S A;  2AK5 A;  2GCX A;  3QBY A;  4R0K A;  2K5F A;  2D6F A;  3FJ5 A;  4MZM A;  3VYH B;  1Y96 B;  2QGF B;  3NMZ C;  3G71 T;  1I4K 1;  2CP0 A;  1QW1 A;  3NTK A;  2GTJ A;  4C8Q F;  3OYK A;  2EYQ A;  2LVM A;  2EPD A;  1KIK A;  5D6Y A;  2E65 A;  3JCM d;  3EG1 A;  4EDU A;  1R8O B;  2JM9 A;  4VUB A;  3V8K A;  2KQW A;  4EIK A;  1SG5 A;  3OY9 A;  2LTO A;  3VS6 A;  3PIP A;  3CCE A;  1TS9 A;  4ATO A;  2ABL A;  3CBO A;  4HKE A;  2DE0 X;  3I9Q A;  3IQL A;  1BI1 A;  1OOT A;  3L1A A;  3TCJ A;  5KYX A;  2LJ3 A;  1D0Y A;  5M9O A;  1K0S A;  1SRM A;  2PUK B;  1SHF A;  2M16 A;  2LT1 A;  1J3T A;  3TEE A;  4RCC A;  2LQW A;  2C0O A;  1VQ9 T;  4LUE A;  1VYU A;  3LGF A;  1K8A C;  4C0G A;  2CSQ A;  2RM4 A;  1KD1 U;  3RDV A;  4N0A A;  2GBQ A;  5HK0 A;  5LJ3 f;  5D7U A;  1LPL A;  4DQ2 A;  4AMC A;  1M1F A;  4XTU A;  1NLP C;  2XKO C;  1M1K C;  1WXU A;  4M77 B;  3L42 A;  4JZ4 A;  2DL7 A;  3CPW P;  2KSS A;  4ZNX A;  4M7D G;  2PNI A;  1KG1 A;  5IH2 A;  2ED0 A;  3SWN B;  1V1C A;  2DZ9 A;  1WNL A;  4J9I A;  2FHD A;  1TSF A;  3V8J A;  1AWW A;  4C92 B;  3UA6 A;  2EYX A;  3FC3 A;  2ECZ A;  4KGV B;  2CUB A;  1WX6 A;  2COY A;  3VS1 A;  5GAM g;  1R77 A;  1BB9 A;  1Q82 U;  1AZG B;  1RUW A;  3VS2 A;  2OAW A;  4MDW A;  2E1H A;  4M77 F;  3M0Q A;  5D6X A;  3NTH A;  2ZZD A;  4MZP A;  1UUE A;  1JJ2 P;  1WJS A;  2CS7 A;  4TVR A;  1ZA2 B;  1HD3 A;  1WPY A;  2EIF A;  4XTV A;  3V7S A;  2FO0 A;  1RAD B;  5DLQ E;  3H6Z A;  5GAO m;  1YJN A;  3ZFJ A;  5CR2 A;  3U23 A;  2HQH A;  4C92 F;  5HY6 A;  2VAS A;  3ZBD A;  4WTO B;  3M59 A;  2FB7 A;  1Q81 R;  2M9U A;  4J9G A;  1JXM A;  1YWO A;  3UT1 A;  2O88 A;  5CKD A;  3EHR A;  3C94 A;  4JJD A;  2O01 E;  1XNI A;  3L2R A;  1YJN Q;  1RLP C;  5GAO l;  2BE7 D;  2YHT A;  4J6Y A;  1WHH A;  3MPU B;  1VQ8 T;  4II1 A;  2LNV A;  2JJ9 A;  1K73 R;  4A4F A;  2LQN A;  4ZGD B;  2H8H A;  4LE9 A;  1LNX A;  5LJ5 e;  3FB9 A;  1ZA1 B;  3CMA A;  1BKB A;  3CCM T;  4GLK A;  4D8D A;  1CSK A;  1D3B A;  3JCM b;  2QDY B;  3TRE A;  2QG9 B;  2KBT A;  4PJO B;  3M0S A;  2J7I A;  4L59 A;  2A37 A;  1YBY A;  2OTJ Q;  2EQJ A;  2QQB A;  2HEQ A;  4M78 C;  2KRO A;  3G6E Q;  3CMA Q;  3JCM V;  2O31 A;  4OB2 B;  4NS5 A;  2HCK A;  5KYU A;  1KFZ A;  3QG1 A;  4DBH A;  1X6B A;  3CPW A;  1G3Y A;  3BW1 A;  1HSQ A;  2AT1 B;  4PJN A;  1VQN T;  1C0M A;  3CCL A;  2ZPB B;  3JB9 F;  2RJE A;  1K76 A;  3CCR T;  1YIJ A;  1GFD A;  4M7D B;  3S6W A;  2WSF E;  3OYJ A;  1O75 A;  4PJO F;  3L2W A;  3H8Z A;  4B6M A;  4FL6 A;  2X3W D;  3OQ5 A;  2KRN A;  3CME T;  4KH1 B;  3EAE A;  1N5Z A;  4IUU A;  3VUB A;  4RG8 A;  1XQH A;  5CKE A;  3DB4 A;  3HTR A;  3VRY A;  3ULR B;  1VOM A;  2YXY A;  4ZN1 A;  1YI2 A;  1JJ2 A;  1VQK A;  3UDC A;  2L3R A;  1BU1 A;  3BE3 A;  3M57 A;  2VXF A;  3REA B;  1ARK A;  2ED1 A;  3G1J A;  1M90 U;  2NUZ A;  4Y92 A;  1GXI E;  3JCM W;  1D0Z A;  2RJF A;  2ZGW A;  1YHQ Q;  4HCZ A;  4JZ3 A;  1M1G A;  2O2O A;  4A4H A;  3OBY A;  4J9F A;  1B3Q A;  2QAZ A;  3I35 A;  2OX7 A;  3MCA B;  4J7I A;  5FU6 B;  5LJ3 h;  2A08 A;  1VQK Q;  1AWO A;  1Q7Y U;  1JB0 E;  2EQU A;  3LH0 A;  1UGP B;  3MJX A;  5GAO r;  1WFW A;  3CQT A;  4LN2 A;  1TUD A;  3RKW A;  3M0U A;  1IB8 A;  2LCL A;  1U1T A;  5CAI A;  1VQ5 T;  2O4X B;  3G71 Q;  4BDY A;  4YTL A;  5A0D A;  5KH6 A;  2DXU A;  2K6D A;  2L8D A;  4QQD A;  3UA7 A;  3QWX X;  1PD1 A;  2RHI A;  4IUT A;  1IRE B;  1VYV A;  2Y4Y A;  2K2V A;  3JCM f;  1B34 A;  4KBM B;  3LWH A;  3JB9 J;  3CCS T;  3OS5 A;  4X9D A;  1VQ9 A;  2EQI A;  1ZSZ C;  2PVD B;  2HNI A;  4M78 E;  1PKT A;  2W10 A;  2C06 A;  4M7A C;  3H0H A;  2HMA A;  1NZ9 A;  1UJ0 A;  2JTM A;  3VS0 A;  2RH2 A;  2L3S A;  2E10 A;  2XDP A;  4M77 D;  5AT1 B;  4DBQ A;  3MEV A;  5GAN f;  3H0F A;  3F70 A;  4A4G A;  1VQ9 Q;  2VKN A;  2X35 A;  3CCJ T;  3G4S T;  2E12 A;  2X3X D;  2L3Q A;  1N9S A;  3OS2 A;  1OPL A;  4X1V A;  1VIE A;  4C92 D;  1KK7 A;  1UTI A;  1HXD A;  4E7H A;  1QKW A;  3TSW A;  2PTK A;  2L89 A;  4LD6 A;  3X28 B;  2E3H A;  3M5A A;  2D8H A;  2MIO A;  2HD0 A;  1H92 A;  1YCS B;  2NUP B;  4X9C A;  1EIF A;  2D9T A;  4Z02 A;  1VQO T;  5LJ5 h;  4NOY A;  2MAM A;  1OQK A;  2DL4 A;  2JNG A;  4BY6 C;  1Y07 A;  4PFZ A;  2AKK A;  1PHT A;  4QQ6 A;  2EYZ A;  1G3T A;  3PVL A;  3OYL A; 
#chains in the Genus database with same CATH homology
 2MWO A;  4X34 A;  4C0D B;  4XTW A;  2RHY A;  1UB4 A;  3X20 B;  3I55 A;  2WSE E;  4C8Q G;  3WVE B;  5I2M A;  4A54 A;  3MET A;  2RI5 A;  3CXC S;  3NTI A;  3P8B B;  3HRT A;  4R56 A;  3DLL A;  2X4J A;  3A8H B;  5AYF A;  4PJO E;  2A7Y A;  2QQR A;  4N4G A;  4C8Q B;  1UGR B;  3ER0 A;  1X75 C;  1Y96 A;  2KY9 A;  5DY9 A;  2PVG B;  2RJC A;  3FDR A;  3JSC A;  4PNO A;  3QYG B;  1K8A U;  5FRM A;  2DEQ A;  1N9R A;  5GAN h;  2XD0 A;  3V7R A;  1YI2 T;  2XU8 A;  2RD1 A;  3G71 A;  4XU3 A;  5IN1 A;  3ASK A;  1VQK T;  4HCC A;  2KAF A;  2XIC A;  4BE1 A;  4KUD K;  1Q81 C;  3OS0 A;  5FU7 C;  4BAC A;  5GAN 6;  3OA6 A;  2VC8 A;  4M75 G;  3HHT B;  4P5N A;  3QZ9 B;  3OYF A;  2EQM A;  2OTL T;  3A8G B;  1LJO A;  3HL8 A;  3QXE B;  3P8D A;  3QYH B;  2KVQ G;  2E64 A;  4J83 A;  4EMG A;  5CK9 A;  4M75 B;  3A8O B;  2ZPI B;  1VQ8 A;  3QSU A;  2QEX T;  1KHC A;  3HKS A;  4UC4 A;  4BY6 B;  1WQW A;  4JUV A;  4F7U A;  1AHJ B;  2VXE A;  3J81 E;  1VQ4 A;  5LJ3 j;  4OB1 B;  1YJW A;  4D6W A;  2ZCF B;  1K73 C;  1G3W A;  5FLX E;  2GCX A;  5LJ3 g;  3TU4 K;  3QBY A;  1VQ7 T;  3JB9 D;  1M4Z A;  2K5F A;  2OAU A;  3CCM A;  4MZM A;  2D6F A;  5CKF A;  3VYH B;  1W2B S;  1Y96 B;  4RMO A;  3G71 T;  3KXT A;  1I4K 1;  2DK3 A;  4KT0 E;  3CXC A;  1QW1 A;  1N6A A;  3NTK A;  4C8Q F;  3OYK A;  2EYQ A;  2LVM A;  2KK4 A;  4OGC A;  5J26 A;  5D6Y A;  2E65 A;  2CKK A;  5CQY A;  3QUI A;  3WVD B;  3JCM d;  2LC4 A;  2CZ7 B;  1MGQ A;  2PUO B;  5GAN 8;  4WF2 A;  3J80 E;  4EDU A;  1R8O B;  4VUB A;  3V8K A;  2KQW A;  3OYD A;  3CC4 A;  4E7K A;  1S72 T;  1H64 1;  1N27 A;  4FM4 B;  1VQL T;  4XAX B;  2K5I A;  2HQX A;  5HKC A;  3OY9 A;  2LTO A;  4F7U G;  2H3J A;  3PIP A;  4Y91 A;  5FRN A;  3C12 A;  4M7A E;  1Q86 C;  3SWN C;  2ZPF B;  3CCE A;  4M75 F;  3PNW C;  5FU7 B;  4ATO A;  4M77 A;  3CBO A;  4HKE A;  4C0Z A;  1BI2 A;  4F7U B;  1QP3 A;  3LX7 A;  1BI1 A;  3L1A A;  4LDV A;  2LDM A;  3TCJ A;  1VQN A;  3PT9 A;  3URG A;  2EJG A;  4QQG A;  5M9O A;  2PUK B;  1OZ3 A;  3SWN A;  2M0O A;  4N0A C;  2M16 A;  1IZ6 A;  2LT1 A;  2RB6 A;  3FIF A;  3OYM A;  3TEE A;  4C0D C;  1YIT T;  4BE0 A;  2JZ2 A;  4RCC A;  5CKH A;  4J5Y A;  1VQ9 T;  1W2B A;  2MWP A;  1PSE A;  1N8R U;  4M7D D;  2MF2 A;  3BY7 A;  3LGF A;  3MEU A;  1K8A C;  4C0G A;  2RM4 A;  4XU0 A;  5LL6 S;  2X4Y A;  4BUG A;  3I56 T;  4C92 A;  1VQP T;  1KD1 U;  1JRI A;  3CCV T;  2K3Y A;  4C8Q C;  4N0A A;  5HK0 A;  1QVP A;  5LJ3 f;  5A0G A;  2VUB A;  4DQ2 A;  3CCE T;  3CPF A;  5IAY A;  1QP2 A;  4M77 G;  3CME A;  2RHU A;  3L2Q A;  1M1F A;  2P4T A;  4OF1 A;  4XTU A;  3LWI A;  2XKO C;  2DXT A;  3CBM A;  1M1K C;  1U1S A;  4M77 B;  3L42 A;  3BDL A;  4C8Q A;  2EJF A;  4O6J A;  3JCM c;  1BIB A;  1NE8 A;  2M1H A;  4M78 D;  2A3L A;  4M7A D;  2K3X A;  2KSS A;  2LCC A;  3G7Z A;  2JTF A;  4F7U F;  4M7D G;  1KG1 A;  2CZ1 B;  4M75 C;  3RKY A;  3SWN B;  4PLL A;  4GY5 A;  4JS5 A;  3OYN A;  1K9M U;  1I81 A;  2DZ9 A;  4FT4 A;  1NPR A;  1WNL A;  2LX9 A;  3SDZ A;  4C5I A;  4ZN3 A;  2FHD A;  4XK8 E;  4C92 G;  2XI9 A;  2VGN A;  3HFO A;  3JCM h;  3V8J A;  3JCM J;  4C92 B;  5A2Q E;  2K57 A;  2JOY A;  3A8L B;  3HSB A;  4JRK A;  4QVZ A;  2R5M A;  3FC3 A;  2PVO B;  4M78 G;  3RES A;  2RK1 A;  4A4E A;  5GAM j;  3OYA A;  2BIV A;  4JDS A;  3HFN A;  5GAM g;  3CCU A;  4M78 B;  3SFM A;  4A53 A;  5GMK h;  2R57 A;  1KHI A;  2RK2 A;  1Q82 U;  5L8R E;  4MML A;  4O5V A;  2BKD N;  2IVW A;  5LJ5 j;  1YHQ T;  4MDW A;  2DD4 A;  4KUL A;  2E1H A;  4M77 F;  3OS1 A;  5D6X A;  4JS4 A;  4JLI A;  1YCY A;  4PKC C;  3NTH A;  2ZZD A;  1OI1 A;  4MZP A;  3CC2 T;  1VQ6 T;  4E7I A;  4JJN K;  3PTA A;  1YJ9 T;  1WJS A;  2PQW A;  2CS7 A;  4TVR A;  1X6O A;  3MHX A;  3GLX A;  1WPY A;  2EIF A;  4XTV A;  3V7S A;  1W4S A;  2LRQ A;  5KCH A;  5CKB A;  1M1K U;  4M7D F;  2BUD A;  5GAN 3;  5DLQ E;  3CC7 T;  1DJ7 B;  1TH7 A;  3H6Z A;  1UGS B;  4J6X A;  5GAO m;  2CZ6 B;  1ZBX A;  1YJN A;  3ZFJ A;  1VQ5 A;  1QVF S;  5CR2 A;  4FU6 A;  3I55 T;  4FIB A;  1RL2 A;  4ELZ C;  2MI6 A;  1N8R C;  4C92 F;  3LYI A;  5HY6 A;  2VV5 A;  4ZGJ B;  3ZBD A;  1WGS A;  3UPU A;  1NJI C;  1KD1 C;  3M59 A;  4BDZ A;  3NFC A;  2FB7 A;  4LDU A;  2L5Q A;  5IT9 E;  3QKJ A;  2M9U A;  2E6Z A;  5GAN j;  4Y28 E;  1UEB A;  3N5B B;  3UT1 A;  4M78 F;  4MZT A;  3RIR A;  2GFU A;  3C94 A;  3OMG A;  5CKD A;  3CEY A;  3E9F A;  4BE2 A;  2XG8 D;  4J7F A;  2O01 E;  2CGH A;  1XNI A;  1WJQ A;  3L2R A;  3PGG A;  4PJO D;  3HRS A;  5CCA A;  1XTD A;  4EMK C;  3OYY A;  5GAO l;  2D0Q B;  4C0F A;  2YHT A;  1M8V A;  3M56 A;  4J6Y A;  4XU1 A;  3P8H A;  4M77 C;  3CPW S;  3VKI A;  3CCQ A;  5GAM e;  4PL6 A;  4II1 A;  1VQ8 T;  2LNV A;  3ME9 A;  1VQM A;  3GOX A;  1BYM A;  4A4F A;  1K9M C;  3EFR A;  2WSC E;  4IUQ A;  2DAQ A;  4EMK A;  4ZGD B;  3JB9 G;  1VQ4 T;  1LNX A;  1FX7 A;  1XOV A;  2DJZ A;  2DIG A;  3CD6 A;  2DO3 A;  4B9W A;  3FB9 A;  5LJ5 e;  3S3O A;  1YJW T;  3CMA A;  3X24 B;  5KE3 A;  3RER A;  4M7D C;  3MEA A;  4IUV A;  1QVF A;  1BKB A;  3FRN A;  4LD9 K;  3CCM T;  4PJO G;  3KUF A;  4GLK A;  2F5T X;  3JCM e;  4E7L A;  2EKO A;  2RO0 A;  2Y4X A;  1D3B A;  3QJY A;  3JCM b;  2QDY B;  4LDX A;  3TRE A;  4C92 C;  4PJO B;  2XK0 A;  3G4S A;  4OP0 A;  3V7C A;  4L59 A;  4M7D A;  4BB7 A;  3CCR A;  1YBY A;  4JRQ A;  1Q82 C;  3OB9 A;  4HT9 A;  2EQJ A;  2QQB A;  2VYT A;  4C5H A;  2EAY A;  3CC4 T;  2EWN A;  4M78 C;  4JRI A;  5GMK e;  1NJI U;  1O9S A;  3M9Q A;  5J3B A;  3JCM V;  4C8Q E;  4OB2 B;  3C95 A;  4NS5 A;  3MEW A;  2QXF A;  4IUR A;  5LJ3 d;  3MO8 A;  4JRP A;  1NPP A;  3QG1 A;  5KCO A;  3EFS A;  5CQX A;  3S3N A;  1M9S A;  2CYZ B;  2DVE A;  3CPW A;  4EMK B;  5GAN e;  2QA4 A;  1JJ2 S;  1G3Y A;  3BW1 A;  4J6W A;  3SB2 A;  4M78 A;  4M7A A;  3X25 B;  3DB3 A;  4C5G A;  2RHX A;  1VQN T;  3RMQ A;  3OYI A;  2K4Y A;  3R6O A;  1VQO A;  4HA8 A;  5GMK i;  2DZC A;  3CCL A;  2ZPB B;  4M75 E;  3MP8 A;  3JB9 F;  3L2Z A;  4RCB A;  2RJE A;  4IKF A;  3HRU A;  3CCR T;  1D3B B;  1QVG S;  3JCM P;  4FT2 A;  1YIJ A;  1Q7Y C;  2F69 A;  3OMC A;  4M7D B;  3S6W A;  2WSF E;  5DM7 R;  3OYJ A;  1O75 A;  2CZ0 B;  4PJO F;  3L2W A;  3H8Z A;  1VIF A;  4BI3 A;  3FEO A;  3OYL A;  1I5L A;  1Y71 A;  4FL6 A;  5I2S A;  4EMH A;  3JCM X;  3VU3 C;  3QII A;  3OQ5 A;  2XID A;  4E7J A;  4Q5W A;  2JVV A;  3DLM A;  3CME T;  1I8F A;  3EAE A;  3T9N A;  1G3S A;  4M7A G;  3X26 B;  1LOJ A;  2RHZ A;  4IUU A;  3VUB A;  4BD3 A;  4R55 A;  3OYC A;  4RG8 A;  1XQH A;  3M54 A;  5CKE A;  4OGE A;  3DB4 A;  3QDR B;  4J8O A;  4OVA A;  3RKX A;  1KC8 C;  4M7A B;  2HBP A;  2DTI A;  2DTH A;  3GNG A;  2HQE A;  4ZN1 A;  3QPH A;  1X01 A;  1YI2 A;  2DKG A;  1G5V A;  1JJ2 A;  2GF7 A;  2QQ9 A;  3UDC A;  2L3R A;  3OYH A;  1VQK A;  3MP6 A;  3OSS C;  5LJ5 g;  2R58 A;  3M57 A;  2VXF A;  3A8M B;  3PFS A;  2KDS A;  2OTL A;  5CIU A;  3WXM B;  1M90 U;  2X4X A;  3BFM A;  2LQK A;  1H3Z A;  4C5E A;  2LQ8 A;  4F7U E;  5FRO A;  3JCM W;  3JCM g;  4M75 D;  3DKM A;  1GXI E;  3S3M A;  2RJF A;  3M53 A;  5CVI A;  1QVG A;  2ZGW A;  2QTX A;  3V8L A;  2G3R A;  2O4X A;  2B8A A;  4ME7 A;  4HCZ A;  3SD4 A;  4CRI A;  3OYE A;  4DOV A;  1M1G A;  3RMS A;  2YLB A;  4A4H A;  4NL2 A;  3O8V A;  4RKU E;  2DTO A;  3OBY A;  5FU6 B;  5GAN 2;  4PJO C;  5LJ3 h;  3MCA B;  3QJ6 A;  3LGL A;  4J7I A;  4KUI A;  5GMK j;  1VQ7 A;  4EPC A;  3CCU T;  3JRZ A;  4RG2 A;  3OYB A;  1Q7Y U;  1JB0 E;  2EQU A;  3LH0 A;  2LT4 A;  2GFA A;  1UGP B;  3ZEH A;  4MMK A;  2KMT A;  4NL3 A;  5GAO r;  3JB9 H;  2VGM A;  1P92 A;  2QI2 A;  3LLR A;  3FJP A;  1U8R A;  1BIA A;  4V2S A;  2V8K A;  4PJO A;  5GAN g;  3E9G A;  4M7A F;  2K5L A;  4A4K A;  4PLI A;  3HPW A;  4OMF B;  2ZPG B;  1BI3 A;  3RKW A;  5C0M A;  1HK9 A;  3CCS A;  2LCL A;  4ZTJ A;  1U1T A;  1V29 B;  1Y7X A;  3A5Z B;  3C4S A;  1RI0 A;  2V8J A;  3FLG A;  3PIO A;  4E47 A;  1S72 A;  5KE2 A;  5D6W A;  4QVD A;  1VQL A;  4M77 E;  1PSF A;  5DLO A;  1YJN T;  3OW2 S;  2IG0 A;  5GAM f;  5CAI A;  1KC8 U;  5GAM d;  1VQ5 T;  5CO7 A;  1BI0 A;  2O4X B;  2OTJ A;  5GAN 7;  4BDY A;  4YTL A;  5A0D A;  2X4W A;  2EJ9 A;  5KH6 A;  2DXU A;  2L8D A;  4QQD A;  5LJ5 f;  5LJ5 d;  4M7D E;  4QVC A;  3G6E A;  2RJD A;  2RHI A;  4IUT A;  2QQA A;  2E5Q A;  4HCB A;  1IRE B;  4L5G A;  4ELY C;  4N4H A;  2I2L A;  4HT8 A;  1KQ1 A;  2Y4Y A;  1KQ2 A;  3GIB A;  3M4G A;  2K2V A;  3GF5 A;  5EG2 A;  3RUX A;  3JCM f;  3VUZ A;  4CI0 C;  1B34 A;  4KBM B;  2NLU A;  3JB9 I;  3LWH A;  3JB9 J;  4C92 E;  3AHU A;  3QO3 A;  1YIT A;  3CCJ A;  3CCS T;  3OS5 A;  3VYG A;  4X9D A;  2ZPH B;  2XDD A;  1VQ9 A;  4BI8 B;  2FL7 A;  3OYG A;  4XTZ A;  3I56 A;  1VQP A;  5I21 A;  3CCV A;  2PVD B;  2HAX A;  2V8I A;  2E70 A;  3CCQ T;  2HNI A;  2P0P A;  4M78 E;  2E6N A;  3JAM E;  4LDY A;  5A0L A;  1VQM T;  5GAN 5;  2C06 A;  4M7A C;  2OTJ T;  3PMI A;  5J39 A;  2MMP A;  2RA2 A;  5GAO q;  2Y90 A;  4OB3 B;  2JN0 A;  4L6V 5;  5C6S A;  4ZGE B;  1NZ9 A;  2JTM A;  1Q81 U;  1KQS S;  3CD6 T;  2RH2 A;  1UGQ B;  1WQ7 A;  2XDP A;  2E10 A;  3E1S A;  3HP9 A;  2EFI A;  3Q1J A;  4M77 D;  3G6E T;  1M90 C;  3CMA T;  3MEV A;  2QEX A;  5GAN f;  3LW5 E;  4LDW A;  5GAN d;  3OW2 A;  2R5A A;  3F70 A;  3QHS A;  4A4G A;  2F5K A;  4MDX A;  5GMK m;  3UWN A;  1OYX A;  2X35 A;  3L2U A;  3CCJ T;  2PU9 B;  3KBG A;  3G4S T;  3GPL A;  5GAN 4;  1B34 B;  2DXC A;  5GAO p;  1VUB A;  2E12 A;  3BDU A;  3GNF B;  1SSF A;  1ZHI A;  2AHJ B;  1M5Q 1;  4IUP A;  1N9S A;  3VV0 A;  1K73 U;  2YRV A;  3OBW A;  4JLG A;  5FU6 C;  3OSV A;  3E19 A;  5LJ3 e;  3L2V A;  1MHN A;  3OS2 A;  2DPP B;  3CBP A;  3GP8 A;  4XTY A;  1VIE A;  4C92 D;  2FVU A;  3MP1 A;  2DIQ A;  2QQS A;  4DA4 A;  2XDB A;  4ZTF A;  3QZ5 B;  2JUF A;  1HXD A;  1ZQ1 A;  4E7H A;  2YLC A;  2GQV A;  2EQK A;  2DXB A;  2L89 A;  5GAM h;  5GMK l;  4LD6 A;  3X28 B;  3M55 A;  3JCM Q;  2QA4 T;  3M5A A;  2E41 A;  5HK3 A;  2HD0 A;  2P0Q A;  2ZPE B;  4X9C A;  2DD5 A;  1YHQ A;  2WAC A;  4C8Q D;  4DOW A;  1EIF A;  2D9T A;  4XTX A;  4Z02 A;  1WJR A;  1VQO T;  5LJ5 h;  4NOY A;  2RI3 A;  2P0K A;  4QW2 A;  1KQS A;  1JBM A;  2MAM A;  3CCL T;  1OZ2 A;  1FWZ A;  3M4Y A;  4XQ3 A;  2JNG A;  3CC2 A;  1VQ6 A;  4BY6 C;  4FSX A;  4B9X A;  3INZ A;  5GAO n;  4OB0 B;  3PMT A;  4N4I A;  1FXX A;  1YJ9 A;  3M58 A;  1YIJ T;  1Y07 A;  1Q86 U;  3J7A F;  3VJP A;  4XU2 A;  4M75 A;  4QQ6 A;  2FYK A;  1G3T A;  2RI2 A;  3CC7 A;  4BI4 A;  2XHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...