2FL7A

S. cerevisiae sir3 bah domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
208
structure length
183
Chain Sequence
LDGWQVIITDDQGRVIENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein SIR3
publication title Structure of the Sir3 protein bromo adjacent homology (BAH) domain from S. cerevisiae at 1.95 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 47
structure length 183
sequence length 208
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fl7A00
2FVUA 4FSXA 4FT4A 4KUIA 4DOWA 4FT2A 2FL7A 3PTAA 1ZBXA 4BB7A 3PT9A 4KUDK 4KULA 4LD9K 3TU4K 1ZHIA 4DA4A 4JJNK 1W4SA 4DOVA 1M4ZA
chains in the Genus database with same CATH superfamily
1JU5C 5GAN2 5I22A 4IIMA 5A0LA 4ZN3A 5GMKi 1R8OB 3VU3C 1YJWA 2RQRA 2V8KA 4QQGA 1VQ9Q 4M7AC 1VUBA 3V7RA 3LGLA 1H92A 1TSFA 3RDVA 1VQ6A 3L2ZA 2DZCA 1OQKA 2D9TA 1TG0A 1W70A 4FSSA 5GMKe 1ZUUA 2VUBA 1VQNQ 3CC4T 4IUPA 2A3LA 1YNZA 4BI3A 3BY7A 4J9CA 1WHJA 2IVWA 4PKCC 4J9EA 4FYWB 1YWPA 4HA8A 5I11A 3FIFA 5CKHA 5GMKm 4BDZA 1MMNA 5CK9A 3LWIA 4ANJA 1ZX6A 2L3PA 2R58A 2D8JA 2XDPA 3NHNA 1W6XA 2X3XD 1X75C 1M1KU 2V1QA 2RM4A 1BI3A 2AT1B 3QIIA 2VXFA 4JZ4A 1KJWA 1SG5A 5FROA 1M8MA 2P0PA 4RUGA 4OMPA 1KHCA 1VIFA 4PJOB 4ELYC 2M9UA 2K5LA 4A4GA 2ZPGB 4VUBA 1M2VA 3HPWA 3M55A 3OYDA 3CMAQ 4LDUA 4AMCA 3PMTA 2LX7A 1X6GA 1PD1A 1U06A 1YCYA 3CCST 4WCIA 3FJPA 3E9FA 2CP7A 4M78F 1Y0MA 3QBYA 2DRKA 3CC2T 2W0ZA 3GBQA 3CC7A 4XQ3A 4EMKC 3G71T 5GAN4 2QQ9A 1WLPB 2BTTA 3UATA 2OAWA 2JTMA 3JV3A 4M78C 2L3SA 2YHTA 2CSIA 1VQ7A 3N5BB 3H6ZA 2LQWA 3JB9D 1AWWA 3DKMA 1ZSZC 2NUPB 1V76A 4L59A 3MPUB 2RO0A 3X20B 2Y90A 3D7SB 4C0FA 1M2OA 2PNIA 3HP9A 4LDYA 1QP3A 4NS5A 5HK3A 2DNUA 2CT4A 4PJOG 2O88A 2XI9A 3C0CA 1WHKA 4E7LA 1MV0B 1IO6A 3CCVQ 4OB1B 1I4K1 1RABB 2LCLA 4XTXA 2LQ8A 4M78E 4NOYA 4M7DG 1QKXA 1XJWB 1H3HA 1N8RC 3M0QA 4OP0A 2QGFB 2E65A 3CCJA 4ZGEB 2O9SA 1H641 4R56A 2DKGA 5J3BA 1ZUKA 3CXCP 1Q7YC 5DLOA 3ULRB 5D6YA 2MAMA 1YJNA 3PVQA 4JRKA 3CD6A 1UEBA 4E2FB 5GAN5 2JUFA 1PG5B 2EW3A 1EFNA 4MMLA 4N0AC 3QDFA 4J83A 1Q82C 5DLQE 3EFOB 2JZ2A 5EG2A 4J7FA 1WXBA 2DL5A 2QGGA 1YJ9Q 4KGVB 1V1CA 2DXUA 3I5RA 2H3EB 4C8QG 3OYKA 2ESWA 2KRSA 4RTYA 1VYUA 2VGNA 2YLBA 2DZ9A 1YN8A 2LRQA 1VQ8T 2DX1A 3BDLA 3M0RA 1PRLC 2A0FB 2DPPB 2E1HA 4WTOB 1VQPT 1AWXA 3LWHA 2BE7D 2KAFA 4GY5A 3GPLA 9ATCB 1VQ4T 1PC0A 1WXTA 1W4SA 1X6OA 1TUGB 3OYBA 2B8AA 1VQOT 4NL2A 1UECA 2O2OA 4C5HA 1YJWT 1M30A 2DL7A 3O5ZA 3G7ZA 2YRVA 1NEGA 1W2BS 5C0MA 4Z8AA 2X35A 4M77E 4PJOF 3PIPA 3HRSA 2E12A 4A63B 4DBHA 4EMHA 4OB2B 3EG9B 2BZYA 1VQ6T 1KIKA 4AFUC 4E7HA 4ELZC 1X6BA 4XTYA 4F04B 1RUWA 1AWOA 2H8HA 1JBMA 3VRYA 4M7DF 4E7KA 1B34A 2F5KA 2K3BA 4F7UB 4PJOC 1O9SA 4FCYA 2DXCA 5A0DA 2DAQA 2K7AA 4RG8A 2LJ1A 1MGQA 4RKUE 2GTOA 4M7DC 2HNIA 2CYZB 3SHWA 2EPDA 1K0SA 5IHIA 1NG2A 2MMPA 3GLXA 1K73U 2F2VA 2D0QB 2O4XA 5AT1B 2L2PA 4BD3A 2KRNA 2ZAEA 2QQSA 1BIAA 2PUKB 4FYXB 3QZ5B 2KMTA 4LDVA 3C94A 4M77A 4C5GA 1YIJQ 3CPWA 3JB9H 1M1GA 3EGXA 2EJFA 3WVEB 4C8QF 1VQ7Q 4HCCA 2K4YA 3EGDB 4ZTFA 2HQXA 5DY9A 5A2QE 1UGVA 2DERA 4IKFA 4JZ3A 2ZPFB 5GAMf 2OI3A 4F7UG 4C8QC 3CC7T 1Q86C 1K0XA 1E6HA 3X26B 4QVZA 2DETA 3AT1B 2KROA 1QQJA 3M0PA 1VQ5Q 3JB9G 5LJ3g 4Q5WA 4RG2A 1BI0A 3C12A 4N4IA 1VOMA 2LNHB 1FXXA 3MP1A 3JCMf 3LYIA 3VUBA 2FZKB 3GNFB 2J6KA 2LT4A 1ABOA 2DTOA 2HZYA 3AHUA 2OTLA 2KNBB 1M3BA 4C0GA 3FEOA 4LD9K 1SSFA 5D6WA 3HHTB 2YLCA 3CQTA 1PKTA 2RI3A 4N4GA 2OAUA 4GLMA 2ECZA 3CCJT 2DE0X 3PVLA 3QJYA 4O5VA 3PFSA 4JJDA 2YT6A 4PNOA 4PFOA 1D0YA 4BY6B 1NJIC 3G1JA 2Z0WA 2WSCE 3CCLA 1YJNT 2ZPBB 2JTEA 3CD6T 4E7JA 5LJ3f 2LTOA 1M2VB 2K5FA 1Q81C 1BKBA 5GAMd 2MWOA 3NGPA 3UDCA 1M90R 1UB4A 1JQQA 1WA7A 1YFNA 5LJ5h 1X27A 1G3TA 1D3BA 5KYWB 3M4YA 5GANg 1VQ9A 2RD1A 4F7UF 1RI9A 3HTRA 4E7IA 4RTXA 1NLPC 3VS4A 4PFPA 4RCBA 1FYNA 1JJ2A 2ROLA 3JCMd 3JB9F 4FU6A 4HKEA 4AG2C 5FRMA 2X4YA 2J6FA 3UPUA 1RADB 1D0ZA 2RA2A 2AZSA 3OSSC 4BUGA 3JCMJ 1OZ2A 3DB4A 3R6NA 1SEMA 2CP5A 3RNJA 2K2MA 1I1JA 1SHGA 2COZA 4IIOA 2M16A 4IUUA 4FT2A 3META 3I56Q 1VQMT 4M77D 4QVCA 2X4WA 3CCEQ 2R5AA 3JRZA 4C92E 2I2LA 2H3JA 1GRIA 4J5YA 3GF5A 5GANf 4R55A 3CPWP 1QVGA 1B07A 2NUZA 4A4KA 3G4SQ 5GAOn 2BUDA 3EHRA 5GJVB 2EGAA 2QTVA 3CMAA 3LH0A 2DYBA 2B86A 1HJDA 2QYZA 3ME9A 4KULA 3KBGA 1WQ7A 4X1VA 2DIGA 5GAOr 1K8AU 2JN0A 2VC8A 3BFMA 1E7OA 2XIDA 1XOVA 2JS2A 1FMWA 2E6NA 5CO7A 2CZ1B 1NYFA 2AKLA 4OVAA 1YHQQ 1HD3A 3I5SA 2EVRA 1OZ3A 2E3HA 4BB7A 4AFZC 3M0TA 1V29B 2X4XA 2DJZA 4C92A 1OU9A 2W10A 1G8XA 1LVKA 1JO8A 4OMQA 5KH6A 5GAN8 1NPPA 1NLOC 1QVPA 3A98A 1FX7A 3X24B 1Y71A 1N8RU 2NYSA 1OULA 4AG1C 2CH4A 4DOWA 1KFZA 3MP6A 3OW2A 4PJJA 3GNGA 5CKFA 1T3SA 2XICA 5GAOl 3CCUQ 3CCVA 5LJ5d 5CCAA 2HCKA 2E70A 3T9NA 1HYOA 3NTIA 2HDAA 1SF9A 3MHXA 2EYWA 3NTKA 4AFQC 3OQ5A 1X2QA 5IXFA 4N4HA 3TVTA 1B34B 4BY6C 4GLKA 2KT8A 1WHHA 2QA4T 2OTLT 2GFAA 5GAOq 3CCLQ 1UGPB 5C6SA 2RK2A 3JCMQ 1M9SA 1KQSA 5CVIA 2PU9B 2LT1A 2L0AA 3P8HA 5KYXA 4QW2A 4B9WA 2KRMA 1QVFS 2XD0A 1KSWA 2FPEA 1ZA1B 2FRYA 2SRCA 1YJ9A 1HXDA 1C1AA 4ZGDB 2BZ8A 1U1SA 5CKEA 3DLLA 1QWEA 2GF7A 4M77B 3TCJA 1GCQC 3CCLT 1K9MR 3OYGA 1OI1A 1JJ2P 5KE2A 2YWWA 2CH4W 1IRXA 1G2BA 4XU2A 1NE8A 5ECAA 4RCCA 2RMOA 2GGRA 1VQLT 1GFDA 3L2VA 4LN2A 2FZCB 5GAN3 2FRWA 3R6OA 2P0QA 1MNDA 1MUZA 3OBWA 3THKA 4JRPA 1VQ9T 1WFWA 1QCNA 4M4ZA 1YI2Q 2HQEA 2SEMA 5J26A 4JRIA 2R5MA 1RLPC 2YUQA 3CCMQ 4PLLA 3TSZA 2RI5A 2GNCA 2HQHA 4XTVA 1XNIA 4HCZA 2YUOA 4HT9A 4CC4B 3QG1A 2QXFA 4J9IA 1VQNT 4Y92A 3ZL7C 3EGUA 2F5TX 3OYYA 4JLGA 2O01E 3MJXA 1H3ZA 2FG0A 1QVGP 4M77G 2QI2A 3OS2A 2DBKA 3C4SA 1KQ1A 4ESRA 4J6WA 1VQKQ 1Y96A 1TUDA 3UWNA 1YP5A 2CS7A 2VGMA 2OTJQ 3PT9A 2LJ3A 2X3WD 4MZTA 1G3SA 4HCKA 4OGEA 2AHJB 2DLPA 1VYVA 3GIBA 1N27A 4HT8A 4C92D 2FPDA 5IHNA 1UGRB 1IB8A 4DBQA 4XTUA 4CRIA 1YIJA 1OPKA 2K57A 2K6DA 1KHIA 1IGUA 2EJGA 4F17A 3CMAT 1BI1A 1N5ZA 4OGCA 2EGCA 4KT0E 1RAAB 5IT9E 4D8KA 4M7AA 2OX7A 2X9HA 3QO3A 3V7SA 1JEGA 1PKSA 4QQDA 2EQIA 3PNWC 1R77A 5I2MA 4Y91A 2YXYA 5KE3A 1UG1A 3OW2P 1VQ5A 3QYHB 2QK0A 2K9GA 3JCMb 3BW1A 2DL4A 2J06A 2XK0A 2JMAA 1NEBA 3RKWA 4KRTA 1WXUA 3X28B 4BE1A 1TXQA 2RJFA 4OB0B 1ZLMA 2E64A 4A4HA 5FU7B 4ATOA 2XDDA 2KSSA 1Z9QA 3MO8A 3E9GA 2MCNA 2M1HA 2EQUA 3M53A 3QSUA 3CCVT 1BK2A 2XG8D 1KQSP 2MK5A 4M77F 4LNPA 4BE0A 1XTDA 1NJIU 2WSFE 3M9QA 1TU0B 5IH2A 2KQWA 2LP5A 2EBPA 3REAB 2DM1A 1Q81U 2XHCA 1BYMA 4M77C 3M56A 5L23A 2CUBA 4KGZB 1TH7A 2PVDB 4IUVA 4JPBW 1IGQA 3EG2A 3SFMA 2E3IA 2DIQA 1N6AA 2CUDA 2RJCA 4JJNK 2HMAA 4DOVA 1IZ6A 1KC8R 3EH2A 1OV3A 1QMCA 4J9DA 2RQTA 2XMFA 3OYLA 3IQLA 1YJ9T 2D8HA 3OBYA 2RJEA 1ZSZA 3QPHA 2LCSA 5GAN7 1WPYA 3RMQA 1AT1B 3VYGA 3EH1A 2G3RA 1S72Q 4F14A 2DEQA 1MNEA 2DXTA 4C92B 2GQIA 1QP2A 1D0XA 3VUZA 2KK4A 4J8OA 2QEXA 4UC4A 2HBWA 3VS3A 1W2BA 1B3QA 1W1FA 5GAMh 2KE9A 3UT1A 2NUTA 3NMZC 1G83A 4EMGA 1XQHA 3FJ5A 5CAIA 1ZBJA 4LDXA 4F16A 3I56A 3M5AA 4JS4A 2MPXC 4QKUA 3MEUA 2YUPA 4X34A 3CCQQ 1ZQ1A 3CCEA 2DO3A 2KR3A 2JXBA 2RF0A 3JCMh 2QQBA 2M0OA 4IUQA 4M7AD 2JNGA 1YITQ 3SWNA 1RAFB 5J39A 4MZMA 2KXCA 3I55Q 3ASKA 3G4SA 2ZPIB 4FYVB 3G6EA 1HK9A 1WQWA 4OMLA 4XTZA 1KD1U 2K2VA 1UHFA 1QKWA 2KVQG 4JDSA 5KYXB 4C92G 1G3WA 2PQWA 3TSWA 3EFRA 4C0DB 3CPFA 2EGEA 4E6RA 3CCRQ 4X9CA 4LUDA 4IURA 2A28A 4FL6A 1YHQA 1YIJT 1PSFA 3QWYA 2L3RA 1M1KR 2R57A 2HKQB 1VQ7T 4KH0B 3A8OB 3M57A 3H41A 2DILA 4II1A 5KYNA 1WJQA 3EG1A 5LJ3h 1GBRA 1X43A 4IUTA 3SEMA 1U8RA 5FU7C 1ZSGA 3RMSA 3MEWA 3FDRA 3MCAB 1M90C 1G3YA 1I5OB 2RJDA 5IHKA 3QXEB 3CCUA 5IXBA 4XU0A 1VQ5T 3QUIA 1RL2A 1IREB 2VXEA 1D1BA 5KCOA 1BCMA 8ATCB 3TQ7P 1YCSB 1KG1A 1HSQA 1K1ZA 3FB9A 1EX4A 1SPKA 2HL3A 1PRMC 2E5QA 5D7UA 4PJLA 4M7DA 1NBEB 1GFCA 2V1RA 2DD4A 4QQ6A 1RAHB 1CKAA 4PLIA 3ZFJA 1SRMA 2DVJA 2DFUA 2IG0A 5LL6S 5HKCA 4JJCA 5CQXA 1Y96B 3RR6A 1J3TA 3VYHB 1OX8A 4FYYB 4A4EA 2ZCFB 4OF1A 3S3MA 4C92F 4WF2A 2RN8A 2EYXA 1QLYA 2DJQA 1GXIE 1R0BG 4RTUA 2K79A 5GANh 2C0OA 4C8QA 3SD4A 1GL5A 1KK7A 2EQKA 4C92C 3HKSA 1UFFA 5CQYA 2JS0A 1Z9ZA 4C5IA 2RHYA 4M7AB 2QEXQ 1DJ7B 5CIUA 3HRTA 1W2BP 2CGHA 4DBFA 3UA7A 1F1BB 5M9OA 4J6YA 4RTTA 3CMEQ 5FLXE 1BCOA 1YI2A 1TTHB 3HL8A 2E4HA 3C95A 3CCMA 2P4TA 4YTLA 1MMGA 5IAYA 2DXBA 1KQ2A 1TOVA 1OOTA 3JCMW 2KDSA 2QDYB 3MEAA 5FW9A 2L8DA 5LJ3d 4QT7A 3CCSA 4M75E 3H8ZA 4HXJA 2J05A 1ZBXA 1D1AA 1S1NA 2RNAA 3DB3A 3QKJA 3FC3A 2HKNA 1PNJA 3G6EQ 2EYYA 3G71A 3UA6A 5GAOp 2RQWA 3I56T 4CI0C 1VQKA 4XU1A 5GAMj 4C0DC 1K73C 1K76A 3VS2A 3L42A 2OTJA 4A4FA 2RI2A 3CCET 1WHMA 2RHXA 2BIVA 3H0HA 3LW5E 3SDZA 1VYTA 5IN1A 4ZTJA 2JTFA 3VV0A 4EIKA 2XU8A 3OS5A 4DEXA 2HSPA 3G4ST 1P92A 4PK4A 1UE9A 2I0NA 3H0FA 4DQ2A 5I2SA 2VB6A 4XAXB 3MP8A 1IXDA 2F69A 1BBZA 3QYGB 1B7TA 2CKKA 2LMJA 4M75A 3LH5A 3TREA 2KGTA 1PM3A 3NPFA 2PTKA 1UGSB 4CC2A 5KCHA 1YHQT 1K73R 2BE9B 1Q7YU 4F7UA 3ER0A 4M7DD 2QASA 1ZSZB 1MHNA 2QDLA 5GAOm 2A37A 1D1CA 4PFZA 3CXCS 3A8MB 5HCKA 1FMVA 2C0TA 2MIOA 1K9MC 3ZEHA 2E10A 3U23A 2FL7A 5GANd 1Q82U 2FYKA 1TWBA 2RH2A 5LJ3j 1K4US 3P8BB 3QWXX 3JCMX 2KEAA 2LX9A 2NUTB 1KD1R 3CCUT 2DTHA 3BDUA 2JM9A 3JCMP 2ZPEB 3OMGA 2FVUA 3L1AA 3QJ6A 1FMKA 2V8JA 4XK8E 1JXMA 1UJ0A 1PHTA 3PTAA 1VQ8A 1PCXA 2O4XB 4C8QD 2GBQA 3CBMA 2DL8A 2DYIA 3JB9J 2JM8A 5FWCA 1H8KA 1VQ4A 3VS7A 4DA4A 1QWFA 2QQRA 3CC4Q 2LDMA 1K9AA 3Q1JA 3EGXB 2EJ9A 1TS9A 5KYUA 2A7YA 2JOYA 2IIMA 2Y4YA 3SWNB 1VQOA 1QVFA 2GTJA 1PD0A 3OSVA 3VRZA 2JT4A 2RQUA 2D0NA 2CP3A 5GMKh 5FRNA 3PE0A 5GJWB 4OMFB 1I0CA 3OA6A 2VVKA 5HK0A 3QZ9B 2DEUA 2F2WA 4C5EA 2CREA 5HY6A 2FZGB 3OYNA 2V8IA 4JUVA 2DD5A 1QW1A 5LJ5j 3A1PA 5KYYA 4FSXA 1N9SA 4FW1A 4MDXA 3ZBDA 1S72A 5GMKl 3S6WA 4PJMA 3VS6A 2AKKA 2MYSA 5D6XA 3TEEA 2BKDN 4M7AE 2ROTA 1UHCA 4Z02A 1RACB 1I81A 1M5Q1 1ZA2B 2LZ6B 5GANj 4PJNA 4BE2A 1N9RA 3CCSQ 4KGXB 4OB3B 2L5QA 3CC2Q 2NWMA 1X01A 2EYZA 3VJPA 3G71Q 1GCPA 1YI2T 1Q95G 2ABLA 4QVDA 3CCMT 4LDWA 1WGSA 3S3NA 2A08A 4LXCA 2RHUA 3CCQA 1QCOA 2PVOB 5CR2A 2YUNA 4K11A 1AHJB 2CP2A 3LGFA 2QQAA 4M7DB 1OYXA 3A8HB 2AK5A 1Q86U 1YITA 3PIOA 2JJ9A 1WJRA 4M75D 3VS0A 3I55A 2CZ0B 2KYBA 2JW4A 3RIRA 3A8GB 5KYWA 4L6V5 2X51A 3OS1A 3BE3A 2EQJA 1WDXA 5EC7A 3MEVA 1VQKT 4XU3A 1G5VA 3VS1A 1M3AA 2PUOB 1WX6A 3NTHA 1GCQA 1PSEA 2OTJT 2CZ6B 3MKDA 1C6VX 1K8AC 3CCRA 3WXMB 4PL6A 1D3BB 1ACMB 3L2QA 3LX7A 1VIEA 2KXDA 2L89A 1WIEA 2DRMA 2AZVA 4KBMB 3JB9I 2HSEB 2OJ2A 1LOJA 2AIRB 1M90U 4C8QB 1X2KA 4AFSC 2KBTA 3J80E 1JXOA 1UGQB 2EFIA 1TUCA 1KC8C 4JLIA 4FM4B 2KYMA 2MWPA 2ED0A 1X69A 1I5LA 2YSQA 4C0ZA 4OMOA 3L2RA 1K8AR 3RUXA 3OB9A 4A53A 1AVZC 1OX9A 1VQ8Q 1VQPQ 1LJOA 3EAEA 4J7IA 3RKXA 1Y07A 1JRIA 4V2SA 1VQ4Q 4FW2A 1OU8A 3OYAA 1YWOA 2FEIA 4J9HA 3OYCA 1RI0A 3SWNC 1VQOQ 1WYXA 2M51A 4EMKA 1YJWQ 1QVFP 4Y28E 2J6OA 2K3YA 2E5KA 4R0KA 2LQKA 1WJSA 3E1SA 1N8RR 1UDLA 4JJBA 2VWFA 3QDRB 1VA7A 1WNLA 3FLGA 4LD6A 4M78A 1VQ6Q 3M4GA 4P5NA 2LVMA 1Q7YR 2CZ7B 3NFCA 2RQVA 4MMKA 1D09B 3JCMV 3OYIA 1SRLA 3JSCA 2CT3A 2EWNA 1M4ZA 1WZOA 2NLUA 2FB7A 4FT4A 1Q82R 3F70A 2EKHA 3LLRA 2XDBA 1AOJA 3PMIA 4DEYA 2ED1A 1VQMA 4M75B 3UF4A 4TVRA 2DTIA 5GMKj 3HFNA 3CMEA 5GAMg 5GAMe 4NL3A 4MZPA 5GAN6 2BZXA 2RPNA 4XTWA 5FU6B 2GQVA 1S72T 1AEYA 1I8FA 3RERA 3DLMA 1M1KC 3CPWS 3CBOA 3JAME 3OMCA 3I35A 4D6WA 4KUDK 2O9VA 2M0YA 4N0AA 3TU4K 1WHGA 2X4JA 3VKIA 1WI7A 3JCMg 3JCMe 1EIFA 2FHDA 3CC7Q 2LC4A 4B6MA 1I07A 2RHIA 4X9DA 2J7IA 4CC7A 2EKOA 4PJOE 3QHSA 3RBBB 2GFUA 3SB2A 2DBMA 4LUEA 1JB0E 1LCKA 4ZN1A 5FWBA 3CCQT 2MI6A 1IHVA 3HRUA 4M75G 2WACA 4J9GA 4M7DE 1M8VA 4DBRA 2ATCB 2HEQA 4E7SA 4J9FA 7AT1B 2HBPA 1YITT 3RKYA 3I55T 4HVWA 5KYUB 3JCMc 4Z88A 5CKBA 2YDLA 4BI4A 2EIFA 1A0NB 1T3LA 2IPOB 2JMCA 1GBQA 5LJ3e 4J6XA 4HVVA 2VYTA 3O8VA 4FIBA 2QAZA 2YRDA 3CCRT 3CEYA 3J7AF 3CCJQ 1K9MU 1E6GA 1MV3A 1AWJA 3INZA 1Y7XA 2FPFA 3GP8A 1ABQA 3I9QA 4PJOA 4B9XA 5KYYB 1C0MA 1O75A 3M58A 4OMMA 1SSHA 2DMOA 2K5IA 2QA4A 2LJ0A 2KI7A 4C8QE 1YJNQ 1NYGA 2KY9A 2MOXA 3EFSA 2PVGB 2EQMA 3A8LB 3CD6Q 2P0KA 3OYEA 3EG0A 4J9BA 1CKBA 4HVUA 2O31A 2VKNA 3M0UA 1Q86R 2EAYA 3EG3A 1OEBA 1NPRA 4M78D 2EYQA 4BI8B 4CC3A 1T0HA 2A36A 2V26A 3OYJA 5AYFA 4E7ZA 2MF2A 2GCXA 4AT1B 3L2WA 2LCCA 1LPLA 2CP6A 1LNXA 5LJ5g 5LJ5e 2NUPA 1NM7A 3PGGA 2P4RA 1JJ2S 1M3CA 3OYFA 3CC4A 4ORZA 3FRNA 1VQLA 1YBYA 2HD0A 3URGA 4M75F 1U3OA 1SKUB 4ZGJB 1NZ9A 4L5GA 1Y57A 4HCBA 1UUEA 2WSEE 3M0SA 4LE9A 2M02A 3WVDB 2VASA 2L3QA 1CSKA 2QTXA 3OYHA 3RESA 5GANe 5A0GA 1ZUYA 1VQMQ 2ZPHB 4RTZA 4ZNXA 4M75C 3V8JA 3OYMA 3M59A 4O6JA 1BI2A 4KH1B 2ENMA 5CKDA 4KUIA 1RAEB 2G6FX 1R0CB 2F1LA 2F2XA 1NJIR 3J81E 2JVVA 3A5ZB 1VQNA 4Z89A 1PWTA 2CDTA 5FU6C 1ZHIA 3GOXA 3KXTA 2CP0A 1Q81R 1EZZB 5L8RE 1SHFA 1M1FA 5DM7R 4OMNA 1RAIB 1QVGS 4D8DA 2QEXT 2COWA 5LJ5f 3EFOA 4RTWA 3V8KA 1MMAA 3CC2A 3H0IA 1BB9A 2C0IA 3V7CA 3CMET 4ME7A 4F7UE 2P84A 4RMOA 4BDYA 2RB6A 1MMDA 2D1XA 4M7AG 2QG9B 2C06A 4JRQA 1BU1A 4A54A 3CBPA 3E19A 3EHQA 3V8LA 2COYA 3P8DA 2D6FA 4GBQA 2ZGWA 2K3XA 4EPCA 6AT1B 4JS5A 1IHWA 3M54A 3REBB 3OY9A 3G6ET 3X25B 1BIBA 4EMKB 2XKOC 3HSBA 1UJYA 3EG9A 1KD1C 4RTVA 4PJOD 3OW2S 2E41A 4M78B 1OPLA 1WHLA 3KUFA 8AT1B 2ZZDA 2PZ1A 2HAXA 2RHZA 1FWZA 1U5SA 2Y4XA 4E47A 2QA4Q 1M27C 2OTLQ 1KC8U 1RAGB 2DK3A 3L2UA 2LNVA 1QCFA 4BACA 2FO0A 2VV5A 1UTIA 2DA9A 3S3OA 2DL3A 3E2UA 3OS0A 2YRCA 2KT1A 5I21A 1AZEA 1KQSS 1AD5A 1U1TA 2DVEA 1AZGB 4MDWA 1RLQC 2E6ZA 3CXCA 4EDUA 3KFVA 2CSQA 1ARKA 1T0JA 3VS5A 2DF6A 3EGDA 1VQPA 2RK1A 4M78G 2LQNA 4M7AF 3HFOA 3H9NA 2HL5C 1VQLQ
chains in the Genus database with same CATH topology
2ZPIB 5GAN2 2EFIA 3G6EA 5A0LA 1HK9A 1WQWA 4XTZA 1KD1U 2K2VA 4ZN3A 5GMKi 1R8OB 2M16A 4IUUA 2KVQG 3VU3C 1KC8C 4JDSA 4FM4B 4JLIA 4C92G 1YJWA 2V8KA 1G3WA 2PQWA 2MWPA 3EFRA 3META 4FT2A 4QQGA 1VQMT 4M7AC 4C0DB 3CPFA 1VUBA 4M77D 1I5LA 3V7RA 4C0ZA 3LGLA 4QVCA 3L2RA 2X4WA 4X9CA 4IURA 3RUXA 3OB9A 4FL6A 1VQ6A 3L2ZA 4A53A 1YHQA 2DZCA 2D9TA 2R5AA 3JRZA 1PSFA 4C92E 1YIJT 2L3RA 2I2LA 5GMKe 2VUBA 1LJOA 2R57A 3EAEA 2H3JA 4J7IA 3RKXA 1VQ7T 1Y07A 3A8OB 3M57A 4J5YA 3CC4T 1JRIA 3GF5A 5GANf 4R55A 4II1A 4IUPA 2A3LA 1QVGA 4V2SA 1WJQA 4A4KA 5LJ3h 4BI3A 5GAOn 2BUDA 3BY7A 3OYAA 3CMAA 2IVWA 4IUTA 3LH0A 4PKCC 3OYCA 1RI0A 1U8RA 4HA8A 5FU7C 3SWNC 3ME9A 4KULA 3KBGA 1WQ7A 3RMSA 3FIFA 2DIGA 4EMKA 5GAOr 5CKHA 5GMKm 4BDZA 3MEWA 1K8AU 5CK9A 2JN0A 2VC8A 3FDRA 2K3YA 3BFMA 3MCAB 4Y28E 2R58A 1G3YA 2LQKA 2RJDA 1WJSA 2XDPA 3E1SA 1M90C 3QXEB 2XIDA 3CCUA 1XOVA 4XU0A 1VQ5T 3QUIA 1X75C 2E6NA 1RL2A 5CO7A 3QDRB 1IREB 1WNLA 2CZ1B 3FLGA 4LD6A 2VXEA 4M78A 1M1KU 4OVAA 5KCOA 2RM4A 1BI3A 3QIIA 2VXFA 5FROA 3M4GA 4P5NA 2LVMA 1OZ3A 2P0PA 1KG1A 2CZ7B 1KHCA 3NFCA 1VIFA 4BB7A 3FB9A 4PJOB 4MMKA 4ELYC 1V29B 2M9UA 2X4XA 2DJZA 2E5QA 2K5LA 4M7DA 3JCMV 4A4GA 3OYIA 4C92A 2ZPGB 4VUBA 3HPWA 3JSCA 3M55A 5KH6A 2EWNA 5GAN8 3OYDA 1M4ZA 4LDUA 1NPPA 1QVPA 3PMTA 2DD4A 4QQ6A 1FX7A 3X24B 4PLIA 1Y71A 1N8RU 2NLUA 1YCYA 3ZFJA 2FB7A 4FT4A 3CCST 3F70A 3FJPA 3E9FA 4DOWA 4M78F 2IG0A 3QBYA 3MP6A 5LL6S 3LLRA 2XDBA 3OW2A 3PMIA 3CC2T 3GNGA 5CKFA 5HKCA 3CC7A 1VQMA 2XICA 5GAOl 4XQ3A 3CCVA 5LJ5d 5CQXA 4EMKC 5CCAA 4M75B 1Y96B 3G71T 2E70A 5GAN4 3T9NA 2QQ9A 4TVRA 3VYHB 4A4EA 3NTIA 2ZCFB 2DTIA 2JTMA 3MHXA 5GMKj 3HFNA 3CMEA 3NTKA 5GAMg 5GAMe 4OF1A 4M78C 3S3MA 4C92F 4WF2A 4NL3A 4MZPA 3OQ5A 5GAN6 2YHTA 1VQ7A 3N5BB 4XTWA 3H6ZA 5FU6B 4N4HA 2GQVA 1S72T 3JB9D 1I8FA 3RERA 1GXIE 1B34B 3DKMA 3DLMA 4BY6C 4GLKA 1M1KC 4L59A 2QA4T 5GANh 2RO0A 3X20B 2GFAA 2Y90A 3CBOA 4C8QA 5GAOq 3CPWS 3JAME 2OTLT 3SD4A 1UGPB 3OMCA 2EQKA 4C92C 5C6SA 3HKSA 4C0FA 4D6WA 4KUDK 3HP9A 4LDYA 1QP3A 2RK2A 4N0AA 3TU4K 4NS5A 5HK3A 5CQYA 2X4JA 4PJOG 4C5IA 2RHYA 2XI9A 4M7AB 1M9SA 3VKIA 1DJ7B 3JCMQ 5CVIA 3JCMg 1EIFA 3JCMe 2PU9B 2FHDA 2LT1A 4E7LA 5CIUA 2LC4A 3P8HA 2RHIA 3HRTA 4QW2A 4B9WA 2CGHA 4X9DA 4OB1B 1QVFS 2XD0A 1I4K1 2LCLA 4XTXA 2LQ8A 5M9OA 4M78E 4NOYA 2EKOA 4J6YA 4M7DG 4PJOE 1N8RC 3QHSA 1YJ9A 4OP0A 5FLXE 1HXDA 2E65A 3CCJA 2GFUA 4ZGDB 4ZGEB 1U1SA 5CKEA 3SB2A 1YI2A 1H641 4R56A 3DLLA 1JB0E 3HL8A 2DKGA 4ZN1A 3CCQT 5J3BA 2MI6A 3C95A 2GF7A 3CCMA 2P4TA 4M77B 3TCJA 4YTLA 3CCLT 3HRUA 4M75G 2WACA 5DLOA 3OYGA 5IAYA 1Q7YC 4M7DE 2DXBA 1M8VA 1OI1A 1KQ2A 5D6YA 2MAMA 5KE2A 3JCMW 2KDSA 1YJNA 2HBPA 4XU2A 1YITT 1NE8A 2QDYB 4JRKA 3MEAA 3RKYA 3I55T 4RCCA 1UEBA 3CD6A 2L8DA 5GAN5 2JUFA 5LJ3d 1VQLT 3CCSA 3JCMc 4M75E 5CKBA 3H8ZA 3L2VA 4BI4A 1ZBXA 4MMLA 2EIFA 3DB3A 3QKJA 4N0AC 5GAN3 3FC3A 3R6OA 2P0QA 4J83A 3OBWA 1Q82C 5DLQE 3G71A 4JRPA 5GAOp 2JZ2A 3I56T 5LJ3e 1VQ9T 5EG2A 4J6XA 2VYTA 4CI0C 3O8VA 4FIBA 1VQKA 4J7FA 4XU1A 5GAMj 3CCRT 3CEYA 3J7AF 4C0DC 1K73C 2HQEA 1K9MU 2DXUA 3L42A 2OTJA 5J26A 4C8QG 3OYKA 4JRIA 2R5MA 3INZA 2VGNA 1Y7XA 2YLBA 2RI2A 2DZ9A 4A4FA 3GP8A 3CCET 4PLLA 2LRQA 2RI5A 2RHXA 4XTVA 1VQ8T 2BIVA 3BDLA 1XNIA 4HCZA 4B9XA 4PJOA 3LW5E 2DPPB 2E1HA 1VQPT 4HT9A 1O75A 3M58A 3SDZA 3QG1A 2QXFA 5IN1A 1VQNT 2K5IA 3LWHA 2QA4A 4ZTJA 2JTFA 3VV0A 2KAFA 4C8QE 4GY5A 2XU8A 2F5TX 2KY9A 3EFSA 3OYYA 3GPLA 1VQ4T 3OS5A 2PVGB 2EQMA 2O01E 3A8LB 4JLGA 3G4ST 2P0KA 1P92A 3OYEA 1H3ZA 1W4SA 4DQ2A 5I2SA 1X6OA 4M77G 4XAXB 2QI2A 3MP8A 3OYBA 2F69A 2EAYA 2B8AA 3OS2A 1VQOT 4NL2A 3C4SA 3QYGB 2CKKA 1NPRA 4C5HA 1YJWT 4M78D 1KQ1A 3G7ZA 2EYQA 2YRVA 4J6WA 4BI8B 4M75A 1Y96A 1W2BS 3TREA 3UWNA 5C0MA 2X35A 4M77E 2CS7A 1UGSB 2VGMA 4PJOF 3PIPA 3HRSA 2E12A 4EMHA 3OYJA 3PT9A 4OB2B 1VQ6T 5KCHA 4MZTA 5AYFA 1YHQT 1G3SA 4E7HA 4ELZC 2MF2A 2GCXA 4XTYA 4OGEA 3L2WA 2AHJB 1Q7YU 3GIBA 4F7UA 3ER0A 4M7DD 1N27A 2LCCA 1MHNA 4HT8A 4C92D 5GAOm 1UGRB 1JBMA 4XTUA 4CRIA 4M7DF 1LNXA 3CXCS 4E7KA 1YIJA 1B34A 3A8MB 2F5KA 5LJ5g 5LJ5e 4PJOC 4F7UB 2K57A 1O9SA 1KQSA 1KHIA 2DXCA 1K9MC 5A0DA 3PGGA 3ZEHA 1JJ2S 2EJGA 2DAQA 2E10A 3OYFA 3CMAT 3CC4A 4RG8A 1BI1A 2FL7A 3FRNA 1MGQA 5GANd 1VQLA 4OGCA 4KT0E 1YBYA 2HD0A 5IT9E 3URGA 4M75F 4RKUE 1Q82U 4ZGJB 1NZ9A 4L5GA 2FYKA 4M7AA 4HCBA 4M7DC 2WSEE 2HNIA 2CYZB 3QO3A 3V7SA 3WVDB 2RH2A 5LJ3j 4QQDA 2QTXA 2MMPA 3P8BB 3RESA 3GLXA 2LX9A 3PNWC 5GANe 5A0GA 3JCMX 1K73U 3CCUT 5I2MA 2DTHA 3BDUA 4Y91A 2D0QB 5KE3A 3JCMP 2ZPEB 3OMGA 2FVUA 2O4XA 2ZPHB 4M75C 3V8JA 3OYMA 3M59A 4BD3A 4O6JA 3L1AA 1BI2A 2QQSA 1BIAA 2PUKB 3QYHB 1VQ5A 3QJ6A 5CKDA 3QZ5B 2V8JA 4KUIA 2KMTA 4XK8E 4LDVA 3PTAA 1VQ8A 3C94A 4M77A 2O4XB 4C5GA 4C8QD 3JCMb 3CBMA 3J81E 3CPWA 2JVVA 3A5ZB 1VQNA 3BW1A 3JB9J 3JB9H 1M1GA 2EJFA 3WVEB 2XK0A 5FU6C 4C8QF 1VQ4A 4HCCA 2K4YA 1ZHIA 3GOXA 3RKWA 2QQRA 4DA4A 3KXTA 4ZTFA 2LDMA 3X28B 4BE1A 3Q1JA 2RJFA 4OB0B 2EJ9A 2E64A 2A7YA 2HQXA 5DY9A 5L8RE 1M1FA 2JOYA 2Y4YA 5FU7B 3SWNB 4A4HA 5DM7R 5A2QE 1VQOA 4ATOA 1QVGS 4IKFA 2XDDA 1QVFA 2QEXT 2KSSA 2ZPFB 3MO8A 5GAMf 3E9GA 4F7UG 4C8QC 2M1HA 3CC7T 3OSVA 1Q86C 2EQUA 3M53A 5LJ5f 3QSUA 3CCVT 5GMKh 3X26B 4QVZA 3V8KA 5FRNA 4OMFB 3CC2A 2XG8D 4M77F 3OA6A 4BE0A 1XTDA 3QZ9B 5HK0A 1NJIU 2WSFE 3M9QA 4C5EA 3V7CA 3JB9G 3CMET 5HY6A 5LJ3g 4ME7A 3OYNA 4Q5WA 4F7UE 2V8IA 4RG2A 1BI0A 4RMOA 4BDYA 2RB6A 4JUVA 2KQWA 2DD5A 3C12A 1QW1A 4N4IA 5LJ5j 4M7AG 1Q81U 2XHCA 4FSXA 1FXXA 2C06A 4JRQA 4M77C 1BYMA 1N9SA 3MP1A 3JCMf 3M56A 4A54A 3CBPA 3E19A 4MDXA 3ZBDA 3LYIA 3VUBA 1S72A 3V8LA 1TH7A 2PVDB 3GNFB 5GMKl 3S6WA 2LT4A 3P8DA 4IUVA 2D6FA 2ZGWA 2DTOA 3AHUA 2OTLA 5D6XA 3TEEA 2BKDN 2K3XA 3FEOA 2DIQA 4Z02A 3SFMA 4C0GA 4LD9K 1N6AA 4M7AE 1I81A 1M5Q1 5GANj 2RJCA 4JJNK 4EPCA 3OYHA 4BE2A 1N9RA 1IZ6A 1SSFA 4DOVA 5D6WA 3HHTB 3M54A 4JS5A 4OB3B 3OY9A 2L5QA 2YLCA 3G6ET 3X25B 1BIBA 4EMKB 2RI3A 2XKOC 4N4GA 3HSBA 1X01A 2OAUA 3OYLA 3VJPA 1YJ9T 1KD1C 3CCJT 1YI2T 4PJOD 3OW2S 2E41A 3OBYA 2RJEA 4M78B 3LWIA 3KUFA 3QJYA 4O5VA 4QVDA 3CCMT 4LDWA 1WGSA 3S3NA 3PFSA 3QPHA 5GAN7 1WPYA 3RMQA 2RHUA 3VYGA 3CCQA 2PVOB 5CR2A 2ZZDA 4PNOA 2G3RA 4BY6B 1NJIC 2HAXA 1AHJB 2WSCE 3CCLA 2DEQA 2RHZA 1YJNT 1FWZA 3LGFA 2QQAA 2ZPBB 2Y4XA 4M7DB 4E47A 2DXTA 3CD6T 4E7JA 5LJ3f 4C92B 1KC8U 1OYXA 3A8HB 2LTOA 1QP2A 2DK3A 3VUZA 2KK4A 3L2UA 1Q86U 2LNVA 1YITA 3PIOA 4J8OA 2QEXA 4UC4A 2K5FA 1WJRA 4M75D 3I55A 1Q81C 2CZ0B 1BKBA 1W2BA 5GAMd 3RIRA 3A8GB 2MWOA 4BACA 4L6V5 3OS1A 2VV5A 2EQJA 3UDCA 5GAMh 3UT1A 3S3OA 1UB4A 5LJ5h 3MEVA 3OS0A 1VQKT 4XU3A 4EMGA 1G5VA 1XQHA 5CAIA 1G3TA 5I21A 2PUOB 4LDXA 3NTHA 1D3BA 1KQSS 3M4YA 1PSEA 5GANg 3I56A 2OTJT 1U1TA 1VQ9A 2CZ6B 3M5AA 4JS4A 1K8AC 2RD1A 4F7UF 2DVEA 3CCRA 3WXMB 4MDWA 2E6ZA 3CXCA 4PL6A 4E7IA 1D3BB 3MEUA 4EDUA 4X34A 3L2QA 1ZQ1A 4RCBA 3CCEA 1JJ2A 3LX7A 3JCMd 2DO3A 3JB9F 4FU6A 1VIEA 4HKEA 5FRMA 2L89A 3JCMh 1VQPA 2RK1A 3JB9I 2X4YA 4KBMB 2QQBA 2M0OA 4IUQA 3UPUA 4M7AD 2JNGA 2RA2A 4M78G 3OSSC 1LOJA 4BUGA 3JCMJ 1M90U 1OZ2A 4C8QB 3DB4A 4M7AF 3SWNA 3HFOA 5J39A 4MZMA 3ASKA 3G4SA 3J80E 1UGQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FVU A;  4FSX A;  4FT4 A;  4KUI A;  4DOW A;  4FT2 A;  2FL7 A;  3PTA A;  1ZBX A;  4BB7 A;  3PT9 A;  4KUD K;  4KUL A;  4LD9 K;  3TU4 K;  1ZHI A;  4DA4 A;  4JJN K;  1W4S A;  4DOV A;  1M4Z A; 
#chains in the Genus database with same CATH topology
 1JU5 C;  5GAN 2;  5I22 A;  4IIM A;  5A0L A;  4ZN3 A;  5GMK i;  1R8O B;  3VU3 C;  1YJW A;  2RQR A;  2V8K A;  4QQG A;  1VQ9 Q;  4M7A C;  1VUB A;  3V7R A;  3LGL A;  1H92 A;  1TSF A;  3RDV A;  1VQ6 A;  3L2Z A;  2DZC A;  1OQK A;  2D9T A;  1TG0 A;  1W70 A;  4FSS A;  5GMK e;  1ZUU A;  2VUB A;  1VQN Q;  3CC4 T;  4IUP A;  2A3L A;  1YNZ A;  4BI3 A;  3BY7 A;  4J9C A;  1WHJ A;  2IVW A;  4PKC C;  4J9E A;  4FYW B;  1YWP A;  4HA8 A;  5I11 A;  3FIF A;  5CKH A;  5GMK m;  4BDZ A;  1MMN A;  5CK9 A;  3LWI A;  4ANJ A;  1ZX6 A;  2L3P A;  2R58 A;  2D8J A;  2XDP A;  3NHN A;  1W6X A;  2X3X D;  1X75 C;  1M1K U;  2V1Q A;  2RM4 A;  1BI3 A;  2AT1 B;  3QII A;  2VXF A;  4JZ4 A;  1KJW A;  1SG5 A;  5FRO A;  1M8M A;  2P0P A;  4RUG A;  4OMP A;  1KHC A;  1VIF A;  4PJO B;  4ELY C;  2M9U A;  2K5L A;  4A4G A;  2ZPG B;  4VUB A;  1M2V A;  3HPW A;  3M55 A;  3OYD A;  3CMA Q;  4LDU A;  4AMC A;  3PMT A;  2LX7 A;  1X6G A;  1PD1 A;  1U06 A;  1YCY A;  3CCS T;  4WCI A;  3FJP A;  3E9F A;  2CP7 A;  4M78 F;  1Y0M A;  3QBY A;  2DRK A;  3CC2 T;  2W0Z A;  3GBQ A;  3CC7 A;  4XQ3 A;  4EMK C;  3G71 T;  5GAN 4;  2QQ9 A;  1WLP B;  2BTT A;  3UAT A;  2OAW A;  2JTM A;  3JV3 A;  4M78 C;  2L3S A;  2YHT A;  2CSI A;  1VQ7 A;  3N5B B;  3H6Z A;  2LQW A;  3JB9 D;  1AWW A;  3DKM A;  1ZSZ C;  2NUP B;  1V76 A;  4L59 A;  3MPU B;  2RO0 A;  3X20 B;  2Y90 A;  3D7S B;  4C0F A;  1M2O A;  2PNI A;  3HP9 A;  4LDY A;  1QP3 A;  4NS5 A;  5HK3 A;  2DNU A;  2CT4 A;  4PJO G;  2O88 A;  2XI9 A;  3C0C A;  1WHK A;  4E7L A;  1MV0 B;  1IO6 A;  3CCV Q;  4OB1 B;  1I4K 1;  1RAB B;  2LCL A;  4XTX A;  2LQ8 A;  4M78 E;  4NOY A;  4M7D G;  1QKX A;  1XJW B;  1H3H A;  1N8R C;  3M0Q A;  4OP0 A;  2QGF B;  2E65 A;  3CCJ A;  4ZGE B;  2O9S A;  1H64 1;  4R56 A;  2DKG A;  5J3B A;  1ZUK A;  3CXC P;  1Q7Y C;  5DLO A;  3ULR B;  5D6Y A;  2MAM A;  1YJN A;  3PVQ A;  4JRK A;  3CD6 A;  1UEB A;  4E2F B;  5GAN 5;  2JUF A;  1PG5 B;  2EW3 A;  1EFN A;  4MML A;  4N0A C;  3QDF A;  4J83 A;  1Q82 C;  5DLQ E;  3EFO B;  2JZ2 A;  5EG2 A;  4J7F A;  1WXB A;  2DL5 A;  2QGG A;  1YJ9 Q;  4KGV B;  1V1C A;  2DXU A;  3I5R A;  2H3E B;  4C8Q G;  3OYK A;  2ESW A;  2KRS A;  4RTY A;  1VYU A;  2VGN A;  2YLB A;  2DZ9 A;  1YN8 A;  2LRQ A;  1VQ8 T;  2DX1 A;  3BDL A;  3M0R A;  1PRL C;  2A0F B;  2DPP B;  2E1H A;  4WTO B;  1VQP T;  1AWX A;  3LWH A;  2BE7 D;  2KAF A;  4GY5 A;  3GPL A;  9ATC B;  1VQ4 T;  1PC0 A;  1WXT A;  1W4S A;  1X6O A;  1TUG B;  3OYB A;  2B8A A;  1VQO T;  4NL2 A;  1UEC A;  2O2O A;  4C5H A;  1YJW T;  1M30 A;  2DL7 A;  3O5Z A;  3G7Z A;  2YRV A;  1NEG A;  1W2B S;  5C0M A;  4Z8A A;  2X35 A;  4M77 E;  4PJO F;  3PIP A;  3HRS A;  2E12 A;  4A63 B;  4DBH A;  4EMH A;  4OB2 B;  3EG9 B;  2BZY A;  1VQ6 T;  1KIK A;  4AFU C;  4E7H A;  4ELZ C;  1X6B A;  4XTY A;  4F04 B;  1RUW A;  1AWO A;  2H8H A;  1JBM A;  3VRY A;  4M7D F;  4E7K A;  1B34 A;  2F5K A;  2K3B A;  4F7U B;  4PJO C;  1O9S A;  4FCY A;  2DXC A;  5A0D A;  2DAQ A;  2K7A A;  4RG8 A;  2LJ1 A;  1MGQ A;  4RKU E;  2GTO A;  4M7D C;  2HNI A;  2CYZ B;  3SHW A;  2EPD A;  1K0S A;  5IHI A;  1NG2 A;  2MMP A;  3GLX A;  1K73 U;  2F2V A;  2D0Q B;  2O4X A;  5AT1 B;  2L2P A;  4BD3 A;  2KRN A;  2ZAE A;  2QQS A;  1BIA A;  2PUK B;  4FYX B;  3QZ5 B;  2KMT A;  4LDV A;  3C94 A;  4M77 A;  4C5G A;  1YIJ Q;  3CPW A;  3JB9 H;  1M1G A;  3EGX A;  2EJF A;  3WVE B;  4C8Q F;  1VQ7 Q;  4HCC A;  2K4Y A;  3EGD B;  4ZTF A;  2HQX A;  5DY9 A;  5A2Q E;  1UGV A;  2DER A;  4IKF A;  4JZ3 A;  2ZPF B;  5GAM f;  2OI3 A;  4F7U G;  4C8Q C;  3CC7 T;  1Q86 C;  1K0X A;  1E6H A;  3X26 B;  4QVZ A;  2DET A;  3AT1 B;  2KRO A;  1QQJ A;  3M0P A;  1VQ5 Q;  3JB9 G;  5LJ3 g;  4Q5W A;  4RG2 A;  1BI0 A;  3C12 A;  4N4I A;  1VOM A;  2LNH B;  1FXX A;  3MP1 A;  3JCM f;  3LYI A;  3VUB A;  2FZK B;  3GNF B;  2J6K A;  2LT4 A;  1ABO A;  2DTO A;  2HZY A;  3AHU A;  2OTL A;  2KNB B;  1M3B A;  4C0G A;  3FEO A;  4LD9 K;  1SSF A;  5D6W A;  3HHT B;  2YLC A;  3CQT A;  1PKT A;  2RI3 A;  4N4G A;  2OAU A;  4GLM A;  2ECZ A;  3CCJ T;  2DE0 X;  3PVL A;  3QJY A;  4O5V A;  3PFS A;  4JJD A;  2YT6 A;  4PNO A;  4PFO A;  1D0Y A;  4BY6 B;  1NJI C;  3G1J A;  2Z0W A;  2WSC E;  3CCL A;  1YJN T;  2ZPB B;  2JTE A;  3CD6 T;  4E7J A;  5LJ3 f;  2LTO A;  1M2V B;  2K5F A;  1Q81 C;  1BKB A;  5GAM d;  2MWO A;  3NGP A;  3UDC A;  1M90 R;  1UB4 A;  1JQQ A;  1WA7 A;  1YFN A;  5LJ5 h;  1X27 A;  1G3T A;  1D3B A;  5KYW B;  3M4Y A;  5GAN g;  1VQ9 A;  2RD1 A;  4F7U F;  1RI9 A;  3HTR A;  4E7I A;  4RTX A;  1NLP C;  3VS4 A;  4PFP A;  4RCB A;  1FYN A;  1JJ2 A;  2ROL A;  3JCM d;  3JB9 F;  4FU6 A;  4HKE A;  4AG2 C;  5FRM A;  2X4Y A;  2J6F A;  3UPU A;  1RAD B;  1D0Z A;  2RA2 A;  2AZS A;  3OSS C;  4BUG A;  3JCM J;  1OZ2 A;  3DB4 A;  3R6N A;  1SEM A;  2CP5 A;  3RNJ A;  2K2M A;  1I1J A;  1SHG A;  2COZ A;  4IIO A;  2M16 A;  4IUU A;  4FT2 A;  3MET A;  3I56 Q;  1VQM T;  4M77 D;  4QVC A;  2X4W A;  3CCE Q;  2R5A A;  3JRZ A;  4C92 E;  2I2L A;  2H3J A;  1GRI A;  4J5Y A;  3GF5 A;  5GAN f;  4R55 A;  3CPW P;  1QVG A;  1B07 A;  2NUZ A;  4A4K A;  3G4S Q;  5GAO n;  2BUD A;  3EHR A;  5GJV B;  2EGA A;  2QTV A;  3CMA A;  3LH0 A;  2DYB A;  2B86 A;  1HJD A;  2QYZ A;  3ME9 A;  4KUL A;  3KBG A;  1WQ7 A;  4X1V A;  2DIG A;  5GAO r;  1K8A U;  2JN0 A;  2VC8 A;  3BFM A;  1E7O A;  2XID A;  1XOV A;  2JS2 A;  1FMW A;  2E6N A;  5CO7 A;  2CZ1 B;  1NYF A;  2AKL A;  4OVA A;  1YHQ Q;  1HD3 A;  3I5S A;  2EVR A;  1OZ3 A;  2E3H A;  4BB7 A;  4AFZ C;  3M0T A;  1V29 B;  2X4X A;  2DJZ A;  4C92 A;  1OU9 A;  2W10 A;  1G8X A;  1LVK A;  1JO8 A;  4OMQ A;  5KH6 A;  5GAN 8;  1NPP A;  1NLO C;  1QVP A;  3A98 A;  1FX7 A;  3X24 B;  1Y71 A;  1N8R U;  2NYS A;  1OUL A;  4AG1 C;  2CH4 A;  4DOW A;  1KFZ A;  3MP6 A;  3OW2 A;  4PJJ A;  3GNG A;  5CKF A;  1T3S A;  2XIC A;  5GAO l;  3CCU Q;  3CCV A;  5LJ5 d;  5CCA A;  2HCK A;  2E70 A;  3T9N A;  1HYO A;  3NTI A;  2HDA A;  1SF9 A;  3MHX A;  2EYW A;  3NTK A;  4AFQ C;  3OQ5 A;  1X2Q A;  5IXF A;  4N4H A;  3TVT A;  1B34 B;  4BY6 C;  4GLK A;  2KT8 A;  1WHH A;  2QA4 T;  2OTL T;  2GFA A;  5GAO q;  3CCL Q;  1UGP B;  5C6S A;  2RK2 A;  3JCM Q;  1M9S A;  1KQS A;  5CVI A;  2PU9 B;  2LT1 A;  2L0A A;  3P8H A;  5KYX A;  4QW2 A;  4B9W A;  2KRM A;  1QVF S;  2XD0 A;  1KSW A;  2FPE A;  1ZA1 B;  2FRY A;  2SRC A;  1YJ9 A;  1HXD A;  1C1A A;  4ZGD B;  2BZ8 A;  1U1S A;  5CKE A;  3DLL A;  1QWE A;  2GF7 A;  4M77 B;  3TCJ A;  1GCQ C;  3CCL T;  1K9M R;  3OYG A;  1OI1 A;  1JJ2 P;  5KE2 A;  2YWW A;  2CH4 W;  1IRX A;  1G2B A;  4XU2 A;  1NE8 A;  5ECA A;  4RCC A;  2RMO A;  2GGR A;  1VQL T;  1GFD A;  3L2V A;  4LN2 A;  2FZC B;  5GAN 3;  2FRW A;  3R6O A;  2P0Q A;  1MND A;  1MUZ A;  3OBW A;  3THK A;  4JRP A;  1VQ9 T;  1WFW A;  1QCN A;  4M4Z A;  1YI2 Q;  2HQE A;  2SEM A;  5J26 A;  4JRI A;  2R5M A;  1RLP C;  2YUQ A;  3CCM Q;  4PLL A;  3TSZ A;  2RI5 A;  2GNC A;  2HQH A;  4XTV A;  1XNI A;  4HCZ A;  2YUO A;  4HT9 A;  4CC4 B;  3QG1 A;  2QXF A;  4J9I A;  1VQN T;  4Y92 A;  3ZL7 C;  3EGU A;  2F5T X;  3OYY A;  4JLG A;  2O01 E;  3MJX A;  1H3Z A;  2FG0 A;  1QVG P;  4M77 G;  2QI2 A;  3OS2 A;  2DBK A;  3C4S A;  1KQ1 A;  4ESR A;  4J6W A;  1VQK Q;  1Y96 A;  1TUD A;  3UWN A;  1YP5 A;  2CS7 A;  2VGM A;  2OTJ Q;  3PT9 A;  2LJ3 A;  2X3W D;  4MZT A;  1G3S A;  4HCK A;  4OGE A;  2AHJ B;  2DLP A;  1VYV A;  3GIB A;  1N27 A;  4HT8 A;  4C92 D;  2FPD A;  5IHN A;  1UGR B;  1IB8 A;  4DBQ A;  4XTU A;  4CRI A;  1YIJ A;  1OPK A;  2K57 A;  2K6D A;  1KHI A;  1IGU A;  2EJG A;  4F17 A;  3CMA T;  1BI1 A;  1N5Z A;  4OGC A;  2EGC A;  4KT0 E;  1RAA B;  5IT9 E;  4D8K A;  4M7A A;  2OX7 A;  2X9H A;  3QO3 A;  3V7S A;  1JEG A;  1PKS A;  4QQD A;  2EQI A;  3PNW C;  1R77 A;  5I2M A;  4Y91 A;  2YXY A;  5KE3 A;  1UG1 A;  3OW2 P;  1VQ5 A;  3QYH B;  2QK0 A;  2K9G A;  3JCM b;  3BW1 A;  2DL4 A;  2J06 A;  2XK0 A;  2JMA A;  1NEB A;  3RKW A;  4KRT A;  1WXU A;  3X28 B;  4BE1 A;  1TXQ A;  2RJF A;  4OB0 B;  1ZLM A;  2E64 A;  4A4H A;  5FU7 B;  4ATO A;  2XDD A;  2KSS A;  1Z9Q A;  3MO8 A;  3E9G A;  2MCN A;  2M1H A;  2EQU A;  3M53 A;  3QSU A;  3CCV T;  1BK2 A;  2XG8 D;  1KQS P;  2MK5 A;  4M77 F;  4LNP A;  4BE0 A;  1XTD A;  1NJI U;  2WSF E;  3M9Q A;  1TU0 B;  5IH2 A;  2KQW A;  2LP5 A;  2EBP A;  3REA B;  2DM1 A;  1Q81 U;  2XHC A;  1BYM A;  4M77 C;  3M56 A;  5L23 A;  2CUB A;  4KGZ B;  1TH7 A;  2PVD B;  4IUV A;  4JPB W;  1IGQ A;  3EG2 A;  3SFM A;  2E3I A;  2DIQ A;  1N6A A;  2CUD A;  2RJC A;  4JJN K;  2HMA A;  4DOV A;  1IZ6 A;  1KC8 R;  3EH2 A;  1OV3 A;  1QMC A;  4J9D A;  2RQT A;  2XMF A;  3OYL A;  3IQL A;  1YJ9 T;  2D8H A;  3OBY A;  2RJE A;  1ZSZ A;  3QPH A;  2LCS A;  5GAN 7;  1WPY A;  3RMQ A;  1AT1 B;  3VYG A;  3EH1 A;  2G3R A;  1S72 Q;  4F14 A;  2DEQ A;  1MNE A;  2DXT A;  4C92 B;  2GQI A;  1QP2 A;  1D0X A;  3VUZ A;  2KK4 A;  4J8O A;  2QEX A;  4UC4 A;  2HBW A;  3VS3 A;  1W2B A;  1B3Q A;  1W1F A;  5GAM h;  2KE9 A;  3UT1 A;  2NUT A;  3NMZ C;  1G83 A;  4EMG A;  1XQH A;  3FJ5 A;  5CAI A;  1ZBJ A;  4LDX A;  4F16 A;  3I56 A;  3M5A A;  4JS4 A;  2MPX C;  4QKU A;  3MEU A;  2YUP A;  4X34 A;  3CCQ Q;  1ZQ1 A;  3CCE A;  2DO3 A;  2KR3 A;  2JXB A;  2RF0 A;  3JCM h;  2QQB A;  2M0O A;  4IUQ A;  4M7A D;  2JNG A;  1YIT Q;  3SWN A;  1RAF B;  5J39 A;  4MZM A;  2KXC A;  3I55 Q;  3ASK A;  3G4S A;  2ZPI B;  4FYV B;  3G6E A;  1HK9 A;  1WQW A;  4OML A;  4XTZ A;  1KD1 U;  2K2V A;  1UHF A;  1QKW A;  2KVQ G;  4JDS A;  5KYX B;  4C92 G;  1G3W A;  2PQW A;  3TSW A;  3EFR A;  4C0D B;  3CPF A;  2EGE A;  4E6R A;  3CCR Q;  4X9C A;  4LUD A;  4IUR A;  2A28 A;  4FL6 A;  1YHQ A;  1YIJ T;  1PSF A;  3QWY A;  2L3R A;  1M1K R;  2R57 A;  2HKQ B;  1VQ7 T;  4KH0 B;  3A8O B;  3M57 A;  3H41 A;  2DIL A;  4II1 A;  5KYN A;  1WJQ A;  3EG1 A;  5LJ3 h;  1GBR A;  1X43 A;  4IUT A;  3SEM A;  1U8R A;  5FU7 C;  1ZSG A;  3RMS A;  3MEW A;  3FDR A;  3MCA B;  1M90 C;  1G3Y A;  1I5O B;  2RJD A;  5IHK A;  3QXE B;  3CCU A;  5IXB A;  4XU0 A;  1VQ5 T;  3QUI A;  1RL2 A;  1IRE B;  2VXE A;  1D1B A;  5KCO A;  1BCM A;  8ATC B;  3TQ7 P;  1YCS B;  1KG1 A;  1HSQ A;  1K1Z A;  3FB9 A;  1EX4 A;  1SPK A;  2HL3 A;  1PRM C;  2E5Q A;  5D7U A;  4PJL A;  4M7D A;  1NBE B;  1GFC A;  2V1R A;  2DD4 A;  4QQ6 A;  1RAH B;  1CKA A;  4PLI A;  3ZFJ A;  1SRM A;  2DVJ A;  2DFU A;  2IG0 A;  5LL6 S;  5HKC A;  4JJC A;  5CQX A;  1Y96 B;  3RR6 A;  1J3T A;  3VYH B;  1OX8 A;  4FYY B;  4A4E A;  2ZCF B;  4OF1 A;  3S3M A;  4C92 F;  4WF2 A;  2RN8 A;  2EYX A;  1QLY A;  2DJQ A;  1GXI E;  1R0B G;  4RTU A;  2K79 A;  5GAN h;  2C0O A;  4C8Q A;  3SD4 A;  1GL5 A;  1KK7 A;  2EQK A;  4C92 C;  3HKS A;  1UFF A;  5CQY A;  2JS0 A;  1Z9Z A;  4C5I A;  2RHY A;  4M7A B;  2QEX Q;  1DJ7 B;  5CIU A;  3HRT A;  1W2B P;  2CGH A;  4DBF A;  3UA7 A;  1F1B B;  5M9O A;  4J6Y A;  4RTT A;  3CME Q;  5FLX E;  1BCO A;  1YI2 A;  1TTH B;  3HL8 A;  2E4H A;  3C95 A;  3CCM A;  2P4T A;  4YTL A;  1MMG A;  5IAY A;  2DXB A;  1KQ2 A;  1TOV A;  1OOT A;  3JCM W;  2KDS A;  2QDY B;  3MEA A;  5FW9 A;  2L8D A;  5LJ3 d;  4QT7 A;  3CCS A;  4M75 E;  3H8Z A;  4HXJ A;  2J05 A;  1ZBX A;  1D1A A;  1S1N A;  2RNA A;  3DB3 A;  3QKJ A;  3FC3 A;  2HKN A;  1PNJ A;  3G6E Q;  2EYY A;  3G71 A;  3UA6 A;  5GAO p;  2RQW A;  3I56 T;  4CI0 C;  1VQK A;  4XU1 A;  5GAM j;  4C0D C;  1K73 C;  1K76 A;  3VS2 A;  3L42 A;  2OTJ A;  4A4F A;  2RI2 A;  3CCE T;  1WHM A;  2RHX A;  2BIV A;  3H0H A;  3LW5 E;  3SDZ A;  1VYT A;  5IN1 A;  4ZTJ A;  2JTF A;  3VV0 A;  4EIK A;  2XU8 A;  3OS5 A;  4DEX A;  2HSP A;  3G4S T;  1P92 A;  4PK4 A;  1UE9 A;  2I0N A;  3H0F A;  4DQ2 A;  5I2S A;  2VB6 A;  4XAX B;  3MP8 A;  1IXD A;  2F69 A;  1BBZ A;  3QYG B;  1B7T A;  2CKK A;  2LMJ A;  4M75 A;  3LH5 A;  3TRE A;  2KGT A;  1PM3 A;  3NPF A;  2PTK A;  1UGS B;  4CC2 A;  5KCH A;  1YHQ T;  1K73 R;  2BE9 B;  1Q7Y U;  4F7U A;  3ER0 A;  4M7D D;  2QAS A;  1ZSZ B;  1MHN A;  2QDL A;  5GAO m;  2A37 A;  1D1C A;  4PFZ A;  3CXC S;  3A8M B;  5HCK A;  1FMV A;  2C0T A;  2MIO A;  1K9M C;  3ZEH A;  2E10 A;  3U23 A;  2FL7 A;  5GAN d;  1Q82 U;  2FYK A;  1TWB A;  2RH2 A;  5LJ3 j;  1K4U S;  3P8B B;  3QWX X;  3JCM X;  2KEA A;  2LX9 A;  2NUT B;  1KD1 R;  3CCU T;  2DTH A;  3BDU A;  2JM9 A;  3JCM P;  2ZPE B;  3OMG A;  2FVU A;  3L1A A;  3QJ6 A;  1FMK A;  2V8J A;  4XK8 E;  1JXM A;  1UJ0 A;  1PHT A;  3PTA A;  1VQ8 A;  1PCX A;  2O4X B;  4C8Q D;  2GBQ A;  3CBM A;  2DL8 A;  2DYI A;  3JB9 J;  2JM8 A;  5FWC A;  1H8K A;  1VQ4 A;  3VS7 A;  4DA4 A;  1QWF A;  2QQR A;  3CC4 Q;  2LDM A;  1K9A A;  3Q1J A;  3EGX B;  2EJ9 A;  1TS9 A;  5KYU A;  2A7Y A;  2JOY A;  2IIM A;  2Y4Y A;  3SWN B;  1VQO A;  1QVF A;  2GTJ A;  1PD0 A;  3OSV A;  3VRZ A;  2JT4 A;  2RQU A;  2D0N A;  2CP3 A;  5GMK h;  5FRN A;  3PE0 A;  5GJW B;  4OMF B;  1I0C A;  3OA6 A;  2VVK A;  5HK0 A;  3QZ9 B;  2DEU A;  2F2W A;  4C5E A;  2CRE A;  5HY6 A;  2FZG B;  3OYN A;  2V8I A;  4JUV A;  2DD5 A;  1QW1 A;  5LJ5 j;  3A1P A;  5KYY A;  4FSX A;  1N9S A;  4FW1 A;  4MDX A;  3ZBD A;  1S72 A;  5GMK l;  3S6W A;  4PJM A;  3VS6 A;  2AKK A;  2MYS A;  5D6X A;  3TEE A;  2BKD N;  4M7A E;  2ROT A;  1UHC A;  4Z02 A;  1RAC B;  1I81 A;  1M5Q 1;  1ZA2 B;  2LZ6 B;  5GAN j;  4PJN A;  4BE2 A;  1N9R A;  3CCS Q;  4KGX B;  4OB3 B;  2L5Q A;  3CC2 Q;  2NWM A;  1X01 A;  2EYZ A;  3VJP A;  3G71 Q;  1GCP A;  1YI2 T;  1Q95 G;  2ABL A;  4QVD A;  3CCM T;  4LDW A;  1WGS A;  3S3N A;  2A08 A;  4LXC A;  2RHU A;  3CCQ A;  1QCO A;  2PVO B;  5CR2 A;  2YUN A;  4K11 A;  1AHJ B;  2CP2 A;  3LGF A;  2QQA A;  4M7D B;  1OYX A;  3A8H B;  2AK5 A;  1Q86 U;  1YIT A;  3PIO A;  2JJ9 A;  1WJR A;  4M75 D;  3VS0 A;  3I55 A;  2CZ0 B;  2KYB A;  2JW4 A;  3RIR A;  3A8G B;  5KYW A;  4L6V 5;  2X51 A;  3OS1 A;  3BE3 A;  2EQJ A;  1WDX A;  5EC7 A;  3MEV A;  1VQK T;  4XU3 A;  1G5V A;  3VS1 A;  1M3A A;  2PUO B;  1WX6 A;  3NTH A;  1GCQ A;  1PSE A;  2OTJ T;  2CZ6 B;  3MKD A;  1C6V X;  1K8A C;  3CCR A;  3WXM B;  4PL6 A;  1D3B B;  1ACM B;  3L2Q A;  3LX7 A;  1VIE A;  2KXD A;  2L89 A;  1WIE A;  2DRM A;  2AZV A;  4KBM B;  3JB9 I;  2HSE B;  2OJ2 A;  1LOJ A;  2AIR B;  1M90 U;  4C8Q B;  1X2K A;  4AFS C;  2KBT A;  3J80 E;  1JXO A;  1UGQ B;  2EFI A;  1TUC A;  1KC8 C;  4JLI A;  4FM4 B;  2KYM A;  2MWP A;  2ED0 A;  1X69 A;  1I5L A;  2YSQ A;  4C0Z A;  4OMO A;  3L2R A;  1K8A R;  3RUX A;  3OB9 A;  4A53 A;  1AVZ C;  1OX9 A;  1VQ8 Q;  1VQP Q;  1LJO A;  3EAE A;  4J7I A;  3RKX A;  1Y07 A;  1JRI A;  4V2S A;  1VQ4 Q;  4FW2 A;  1OU8 A;  3OYA A;  1YWO A;  2FEI A;  4J9H A;  3OYC A;  1RI0 A;  3SWN C;  1VQO Q;  1WYX A;  2M51 A;  4EMK A;  1YJW Q;  1QVF P;  4Y28 E;  2J6O A;  2K3Y A;  2E5K A;  4R0K A;  2LQK A;  1WJS A;  3E1S A;  1N8R R;  1UDL A;  4JJB A;  2VWF A;  3QDR B;  1VA7 A;  1WNL A;  3FLG A;  4LD6 A;  4M78 A;  1VQ6 Q;  3M4G A;  4P5N A;  2LVM A;  1Q7Y R;  2CZ7 B;  3NFC A;  2RQV A;  4MMK A;  1D09 B;  3JCM V;  3OYI A;  1SRL A;  3JSC A;  2CT3 A;  2EWN A;  1M4Z A;  1WZO A;  2NLU A;  2FB7 A;  4FT4 A;  1Q82 R;  3F70 A;  2EKH A;  3LLR A;  2XDB A;  1AOJ A;  3PMI A;  4DEY A;  2ED1 A;  1VQM A;  4M75 B;  3UF4 A;  4TVR A;  2DTI A;  5GMK j;  3HFN A;  3CME A;  5GAM g;  5GAM e;  4NL3 A;  4MZP A;  5GAN 6;  2BZX A;  2RPN A;  4XTW A;  5FU6 B;  2GQV A;  1S72 T;  1AEY A;  1I8F A;  3RER A;  3DLM A;  1M1K C;  3CPW S;  3CBO A;  3JAM E;  3OMC A;  3I35 A;  4D6W A;  4KUD K;  2O9V A;  2M0Y A;  4N0A A;  3TU4 K;  1WHG A;  2X4J A;  3VKI A;  1WI7 A;  3JCM g;  3JCM e;  1EIF A;  2FHD A;  3CC7 Q;  2LC4 A;  4B6M A;  1I07 A;  2RHI A;  4X9D A;  2J7I A;  4CC7 A;  2EKO A;  4PJO E;  3QHS A;  3RBB B;  2GFU A;  3SB2 A;  2DBM A;  4LUE A;  1JB0 E;  1LCK A;  4ZN1 A;  5FWB A;  3CCQ T;  2MI6 A;  1IHV A;  3HRU A;  4M75 G;  2WAC A;  4J9G A;  4M7D E;  1M8V A;  4DBR A;  2ATC B;  2HEQ A;  4E7S A;  4J9F A;  7AT1 B;  2HBP A;  1YIT T;  3RKY A;  3I55 T;  4HVW A;  5KYU B;  3JCM c;  4Z88 A;  5CKB A;  2YDL A;  4BI4 A;  2EIF A;  1A0N B;  1T3L A;  2IPO B;  2JMC A;  1GBQ A;  5LJ3 e;  4J6X A;  4HVV A;  2VYT A;  3O8V A;  4FIB A;  2QAZ A;  2YRD A;  3CCR T;  3CEY A;  3J7A F;  3CCJ Q;  1K9M U;  1E6G A;  1MV3 A;  1AWJ A;  3INZ A;  1Y7X A;  2FPF A;  3GP8 A;  1ABQ A;  3I9Q A;  4PJO A;  4B9X A;  5KYY B;  1C0M A;  1O75 A;  3M58 A;  4OMM A;  1SSH A;  2DMO A;  2K5I A;  2QA4 A;  2LJ0 A;  2KI7 A;  4C8Q E;  1YJN Q;  1NYG A;  2KY9 A;  2MOX A;  3EFS A;  2PVG B;  2EQM A;  3A8L B;  3CD6 Q;  2P0K A;  3OYE A;  3EG0 A;  4J9B A;  1CKB A;  4HVU A;  2O31 A;  2VKN A;  3M0U A;  1Q86 R;  2EAY A;  3EG3 A;  1OEB A;  1NPR A;  4M78 D;  2EYQ A;  4BI8 B;  4CC3 A;  1T0H A;  2A36 A;  2V26 A;  3OYJ A;  5AYF A;  4E7Z A;  2MF2 A;  2GCX A;  4AT1 B;  3L2W A;  2LCC A;  1LPL A;  2CP6 A;  1LNX A;  5LJ5 g;  5LJ5 e;  2NUP A;  1NM7 A;  3PGG A;  2P4R A;  1JJ2 S;  1M3C A;  3OYF A;  3CC4 A;  4ORZ A;  3FRN A;  1VQL A;  1YBY A;  2HD0 A;  3URG A;  4M75 F;  1U3O A;  1SKU B;  4ZGJ B;  1NZ9 A;  4L5G A;  1Y57 A;  4HCB A;  1UUE A;  2WSE E;  3M0S A;  4LE9 A;  2M02 A;  3WVD B;  2VAS A;  2L3Q A;  1CSK A;  2QTX A;  3OYH A;  3RES A;  5GAN e;  5A0G A;  1ZUY A;  1VQM Q;  2ZPH B;  4RTZ A;  4ZNX A;  4M75 C;  3V8J A;  3OYM A;  3M59 A;  4O6J A;  1BI2 A;  4KH1 B;  2ENM A;  5CKD A;  4KUI A;  1RAE B;  2G6F X;  1R0C B;  2F1L A;  2F2X A;  1NJI R;  3J81 E;  2JVV A;  3A5Z B;  1VQN A;  4Z89 A;  1PWT A;  2CDT A;  5FU6 C;  1ZHI A;  3GOX A;  3KXT A;  2CP0 A;  1Q81 R;  1EZZ B;  5L8R E;  1SHF A;  1M1F A;  5DM7 R;  4OMN A;  1RAI B;  1QVG S;  4D8D A;  2QEX T;  2COW A;  5LJ5 f;  3EFO A;  4RTW A;  3V8K A;  1MMA A;  3CC2 A;  3H0I A;  1BB9 A;  2C0I A;  3V7C A;  3CME T;  4ME7 A;  4F7U E;  2P84 A;  4RMO A;  4BDY A;  2RB6 A;  1MMD A;  2D1X A;  4M7A G;  2QG9 B;  2C06 A;  4JRQ A;  1BU1 A;  4A54 A;  3CBP A;  3E19 A;  3EHQ A;  3V8L A;  2COY A;  3P8D A;  2D6F A;  4GBQ A;  2ZGW A;  2K3X A;  4EPC A;  6AT1 B;  4JS5 A;  1IHW A;  3M54 A;  3REB B;  3OY9 A;  3G6E T;  3X25 B;  1BIB A;  4EMK B;  2XKO C;  3HSB A;  1UJY A;  3EG9 A;  1KD1 C;  4RTV A;  4PJO D;  3OW2 S;  2E41 A;  4M78 B;  1OPL A;  1WHL A;  3KUF A;  8AT1 B;  2ZZD A;  2PZ1 A;  2HAX A;  2RHZ A;  1FWZ A;  1U5S A;  2Y4X A;  4E47 A;  2QA4 Q;  1M27 C;  2OTL Q;  1KC8 U;  1RAG B;  2DK3 A;  3L2U A;  2LNV A;  1QCF A;  4BAC A;  2FO0 A;  2VV5 A;  1UTI A;  2DA9 A;  3S3O A;  2DL3 A;  3E2U A;  3OS0 A;  2YRC A;  2KT1 A;  5I21 A;  1AZE A;  1KQS S;  1AD5 A;  1U1T A;  2DVE A;  1AZG B;  4MDW A;  1RLQ C;  2E6Z A;  3CXC A;  4EDU A;  3KFV A;  2CSQ A;  1ARK A;  1T0J A;  3VS5 A;  2DF6 A;  3EGD A;  1VQP A;  2RK1 A;  4M78 G;  2LQN A;  4M7A F;  3HFO A;  3H9N A;  2HL5 C;  1VQL Q; 
#chains in the Genus database with same CATH homology
 2ZPI B;  5GAN 2;  2EFI A;  3G6E A;  5A0L A;  1HK9 A;  1WQW A;  4XTZ A;  1KD1 U;  2K2V A;  4ZN3 A;  5GMK i;  1R8O B;  2M16 A;  4IUU A;  2KVQ G;  3VU3 C;  1KC8 C;  4JDS A;  4FM4 B;  4JLI A;  4C92 G;  1YJW A;  2V8K A;  1G3W A;  2PQW A;  2MWP A;  3EFR A;  3MET A;  4FT2 A;  4QQG A;  1VQM T;  4M7A C;  4C0D B;  3CPF A;  1VUB A;  4M77 D;  1I5L A;  3V7R A;  4C0Z A;  3LGL A;  4QVC A;  3L2R A;  2X4W A;  4X9C A;  4IUR A;  3RUX A;  3OB9 A;  4FL6 A;  1VQ6 A;  3L2Z A;  4A53 A;  1YHQ A;  2DZC A;  2D9T A;  2R5A A;  3JRZ A;  1PSF A;  4C92 E;  1YIJ T;  2L3R A;  2I2L A;  5GMK e;  2VUB A;  1LJO A;  2R57 A;  3EAE A;  2H3J A;  4J7I A;  3RKX A;  1VQ7 T;  1Y07 A;  3A8O B;  3M57 A;  4J5Y A;  3CC4 T;  1JRI A;  3GF5 A;  5GAN f;  4R55 A;  4II1 A;  4IUP A;  2A3L A;  1QVG A;  4V2S A;  1WJQ A;  4A4K A;  5LJ3 h;  4BI3 A;  5GAO n;  2BUD A;  3BY7 A;  3OYA A;  3CMA A;  2IVW A;  4IUT A;  3LH0 A;  4PKC C;  3OYC A;  1RI0 A;  1U8R A;  4HA8 A;  5FU7 C;  3SWN C;  3ME9 A;  4KUL A;  3KBG A;  1WQ7 A;  3RMS A;  3FIF A;  2DIG A;  4EMK A;  5GAO r;  5CKH A;  5GMK m;  4BDZ A;  3MEW A;  1K8A U;  5CK9 A;  2JN0 A;  2VC8 A;  3FDR A;  2K3Y A;  3BFM A;  3MCA B;  4Y28 E;  2R58 A;  1G3Y A;  2LQK A;  2RJD A;  1WJS A;  2XDP A;  3E1S A;  1M90 C;  3QXE B;  2XID A;  3CCU A;  1XOV A;  4XU0 A;  1VQ5 T;  3QUI A;  1X75 C;  2E6N A;  1RL2 A;  5CO7 A;  3QDR B;  1IRE B;  1WNL A;  2CZ1 B;  3FLG A;  4LD6 A;  2VXE A;  4M78 A;  1M1K U;  4OVA A;  5KCO A;  2RM4 A;  1BI3 A;  3QII A;  2VXF A;  5FRO A;  3M4G A;  4P5N A;  2LVM A;  1OZ3 A;  2P0P A;  1KG1 A;  2CZ7 B;  1KHC A;  3NFC A;  1VIF A;  4BB7 A;  3FB9 A;  4PJO B;  4MMK A;  4ELY C;  1V29 B;  2M9U A;  2X4X A;  2DJZ A;  2E5Q A;  2K5L A;  4M7D A;  3JCM V;  4A4G A;  3OYI A;  4C92 A;  2ZPG B;  4VUB A;  3HPW A;  3JSC A;  3M55 A;  5KH6 A;  2EWN A;  5GAN 8;  3OYD A;  1M4Z A;  4LDU A;  1NPP A;  1QVP A;  3PMT A;  2DD4 A;  4QQ6 A;  1FX7 A;  3X24 B;  4PLI A;  1Y71 A;  1N8R U;  2NLU A;  1YCY A;  3ZFJ A;  2FB7 A;  4FT4 A;  3CCS T;  3F70 A;  3FJP A;  3E9F A;  4DOW A;  4M78 F;  2IG0 A;  3QBY A;  3MP6 A;  5LL6 S;  3LLR A;  2XDB A;  3OW2 A;  3PMI A;  3CC2 T;  3GNG A;  5CKF A;  5HKC A;  3CC7 A;  1VQM A;  2XIC A;  5GAO l;  4XQ3 A;  3CCV A;  5LJ5 d;  5CQX A;  4EMK C;  5CCA A;  4M75 B;  1Y96 B;  3G71 T;  2E70 A;  5GAN 4;  3T9N A;  2QQ9 A;  4TVR A;  3VYH B;  4A4E A;  3NTI A;  2ZCF B;  2DTI A;  2JTM A;  3MHX A;  5GMK j;  3HFN A;  3CME A;  3NTK A;  5GAM g;  5GAM e;  4OF1 A;  4M78 C;  3S3M A;  4C92 F;  4WF2 A;  4NL3 A;  4MZP A;  3OQ5 A;  5GAN 6;  2YHT A;  1VQ7 A;  3N5B B;  4XTW A;  3H6Z A;  5FU6 B;  4N4H A;  2GQV A;  1S72 T;  3JB9 D;  1I8F A;  3RER A;  1GXI E;  1B34 B;  3DKM A;  3DLM A;  4BY6 C;  4GLK A;  1M1K C;  4L59 A;  2QA4 T;  5GAN h;  2RO0 A;  3X20 B;  2GFA A;  2Y90 A;  3CBO A;  4C8Q A;  5GAO q;  3CPW S;  3JAM E;  2OTL T;  3SD4 A;  1UGP B;  3OMC A;  2EQK A;  4C92 C;  5C6S A;  3HKS A;  4C0F A;  4D6W A;  4KUD K;  3HP9 A;  4LDY A;  1QP3 A;  2RK2 A;  4N0A A;  3TU4 K;  4NS5 A;  5HK3 A;  5CQY A;  2X4J A;  4PJO G;  4C5I A;  2RHY A;  2XI9 A;  4M7A B;  1M9S A;  3VKI A;  1DJ7 B;  3JCM Q;  5CVI A;  3JCM g;  1EIF A;  3JCM e;  2PU9 B;  2FHD A;  2LT1 A;  4E7L A;  5CIU A;  2LC4 A;  3P8H A;  2RHI A;  3HRT A;  4QW2 A;  4B9W A;  2CGH A;  4X9D A;  4OB1 B;  1QVF S;  2XD0 A;  1I4K 1;  2LCL A;  4XTX A;  2LQ8 A;  5M9O A;  4M78 E;  4NOY A;  2EKO A;  4J6Y A;  4M7D G;  4PJO E;  1N8R C;  3QHS A;  1YJ9 A;  4OP0 A;  5FLX E;  1HXD A;  2E65 A;  3CCJ A;  2GFU A;  4ZGD B;  4ZGE B;  1U1S A;  5CKE A;  3SB2 A;  1YI2 A;  1H64 1;  4R56 A;  3DLL A;  1JB0 E;  3HL8 A;  2DKG A;  4ZN1 A;  3CCQ T;  5J3B A;  2MI6 A;  3C95 A;  2GF7 A;  3CCM A;  2P4T A;  4M77 B;  3TCJ A;  4YTL A;  3CCL T;  3HRU A;  4M75 G;  2WAC A;  5DLO A;  3OYG A;  5IAY A;  1Q7Y C;  4M7D E;  2DXB A;  1M8V A;  1OI1 A;  1KQ2 A;  5D6Y A;  2MAM A;  5KE2 A;  3JCM W;  2KDS A;  1YJN A;  2HBP A;  4XU2 A;  1YIT T;  1NE8 A;  2QDY B;  4JRK A;  3MEA A;  3RKY A;  3I55 T;  4RCC A;  1UEB A;  3CD6 A;  2L8D A;  5GAN 5;  2JUF A;  5LJ3 d;  1VQL T;  3CCS A;  3JCM c;  4M75 E;  5CKB A;  3H8Z A;  3L2V A;  4BI4 A;  1ZBX A;  4MML A;  2EIF A;  3DB3 A;  3QKJ A;  4N0A C;  5GAN 3;  3FC3 A;  3R6O A;  2P0Q A;  4J83 A;  3OBW A;  1Q82 C;  5DLQ E;  3G71 A;  4JRP A;  5GAO p;  2JZ2 A;  3I56 T;  5LJ3 e;  1VQ9 T;  5EG2 A;  4J6X A;  2VYT A;  4CI0 C;  3O8V A;  4FIB A;  1VQK A;  4J7F A;  4XU1 A;  5GAM j;  3CCR T;  3CEY A;  3J7A F;  4C0D C;  1K73 C;  2HQE A;  1K9M U;  2DXU A;  3L42 A;  2OTJ A;  5J26 A;  4C8Q G;  3OYK A;  4JRI A;  2R5M A;  3INZ A;  2VGN A;  1Y7X A;  2YLB A;  2RI2 A;  2DZ9 A;  4A4F A;  3GP8 A;  3CCE T;  4PLL A;  2LRQ A;  2RI5 A;  2RHX A;  4XTV A;  1VQ8 T;  2BIV A;  3BDL A;  1XNI A;  4HCZ A;  4B9X A;  4PJO A;  3LW5 E;  2DPP B;  2E1H A;  1VQP T;  4HT9 A;  1O75 A;  3M58 A;  3SDZ A;  3QG1 A;  2QXF A;  5IN1 A;  1VQN T;  2K5I A;  3LWH A;  2QA4 A;  4ZTJ A;  2JTF A;  3VV0 A;  2KAF A;  4C8Q E;  4GY5 A;  2XU8 A;  2F5T X;  2KY9 A;  3EFS A;  3OYY A;  3GPL A;  1VQ4 T;  3OS5 A;  2PVG B;  2EQM A;  2O01 E;  3A8L B;  4JLG A;  3G4S T;  2P0K A;  1P92 A;  3OYE A;  1H3Z A;  1W4S A;  4DQ2 A;  5I2S A;  1X6O A;  4M77 G;  4XAX B;  2QI2 A;  3MP8 A;  3OYB A;  2F69 A;  2EAY A;  2B8A A;  3OS2 A;  1VQO T;  4NL2 A;  3C4S A;  3QYG B;  2CKK A;  1NPR A;  4C5H A;  1YJW T;  4M78 D;  1KQ1 A;  3G7Z A;  2EYQ A;  2YRV A;  4J6W A;  4BI8 B;  4M75 A;  1Y96 A;  1W2B S;  3TRE A;  3UWN A;  5C0M A;  2X35 A;  4M77 E;  2CS7 A;  1UGS B;  2VGM A;  4PJO F;  3PIP A;  3HRS A;  2E12 A;  4EMH A;  3OYJ A;  3PT9 A;  4OB2 B;  1VQ6 T;  5KCH A;  4MZT A;  5AYF A;  1YHQ T;  1G3S A;  4E7H A;  4ELZ C;  2MF2 A;  2GCX A;  4XTY A;  4OGE A;  3L2W A;  2AHJ B;  1Q7Y U;  3GIB A;  4F7U A;  3ER0 A;  4M7D D;  1N27 A;  2LCC A;  1MHN A;  4HT8 A;  4C92 D;  5GAO m;  1UGR B;  1JBM A;  4XTU A;  4CRI A;  4M7D F;  1LNX A;  3CXC S;  4E7K A;  1YIJ A;  1B34 A;  3A8M B;  2F5K A;  5LJ5 g;  5LJ5 e;  4PJO C;  4F7U B;  2K57 A;  1O9S A;  1KQS A;  1KHI A;  2DXC A;  1K9M C;  5A0D A;  3PGG A;  3ZEH A;  1JJ2 S;  2EJG A;  2DAQ A;  2E10 A;  3OYF A;  3CMA T;  3CC4 A;  4RG8 A;  1BI1 A;  2FL7 A;  3FRN A;  1MGQ A;  5GAN d;  1VQL A;  4OGC A;  4KT0 E;  1YBY A;  2HD0 A;  5IT9 E;  3URG A;  4M75 F;  4RKU E;  1Q82 U;  4ZGJ B;  1NZ9 A;  4L5G A;  2FYK A;  4M7A A;  4HCB A;  4M7D C;  2WSE E;  2HNI A;  2CYZ B;  3QO3 A;  3V7S A;  3WVD B;  2RH2 A;  5LJ3 j;  4QQD A;  2QTX A;  2MMP A;  3P8B B;  3RES A;  3GLX A;  2LX9 A;  3PNW C;  5GAN e;  5A0G A;  3JCM X;  1K73 U;  3CCU T;  5I2M A;  2DTH A;  3BDU A;  4Y91 A;  2D0Q B;  5KE3 A;  3JCM P;  2ZPE B;  3OMG A;  2FVU A;  2O4X A;  2ZPH B;  4M75 C;  3V8J A;  3OYM A;  3M59 A;  4BD3 A;  4O6J A;  3L1A A;  1BI2 A;  2QQS A;  1BIA A;  2PUK B;  3QYH B;  1VQ5 A;  3QJ6 A;  5CKD A;  3QZ5 B;  2V8J A;  4KUI A;  2KMT A;  4XK8 E;  4LDV A;  3PTA A;  1VQ8 A;  3C94 A;  4M77 A;  2O4X B;  4C5G A;  4C8Q D;  3JCM b;  3CBM A;  3J81 E;  3CPW A;  2JVV A;  3A5Z B;  1VQN A;  3BW1 A;  3JB9 J;  3JB9 H;  1M1G A;  2EJF A;  3WVE B;  2XK0 A;  5FU6 C;  4C8Q F;  1VQ4 A;  4HCC A;  2K4Y A;  1ZHI A;  3GOX A;  3RKW A;  2QQR A;  4DA4 A;  3KXT A;  4ZTF A;  2LDM A;  3X28 B;  4BE1 A;  3Q1J A;  2RJF A;  4OB0 B;  2EJ9 A;  2E64 A;  2A7Y A;  2HQX A;  5DY9 A;  5L8R E;  1M1F A;  2JOY A;  2Y4Y A;  5FU7 B;  3SWN B;  4A4H A;  5DM7 R;  5A2Q E;  1VQO A;  4ATO A;  1QVG S;  4IKF A;  2XDD A;  1QVF A;  2QEX T;  2KSS A;  2ZPF B;  3MO8 A;  5GAM f;  3E9G A;  4F7U G;  4C8Q C;  2M1H A;  3CC7 T;  3OSV A;  1Q86 C;  2EQU A;  3M53 A;  5LJ5 f;  3QSU A;  3CCV T;  5GMK h;  3X26 B;  4QVZ A;  3V8K A;  5FRN A;  4OMF B;  3CC2 A;  2XG8 D;  4M77 F;  3OA6 A;  4BE0 A;  1XTD A;  3QZ9 B;  5HK0 A;  1NJI U;  2WSF E;  3M9Q A;  4C5E A;  3V7C A;  3JB9 G;  3CME T;  5HY6 A;  5LJ3 g;  4ME7 A;  3OYN A;  4Q5W A;  4F7U E;  2V8I A;  4RG2 A;  1BI0 A;  4RMO A;  4BDY A;  2RB6 A;  4JUV A;  2KQW A;  2DD5 A;  3C12 A;  1QW1 A;  4N4I A;  5LJ5 j;  4M7A G;  1Q81 U;  2XHC A;  4FSX A;  1FXX A;  2C06 A;  4JRQ A;  4M77 C;  1BYM A;  1N9S A;  3MP1 A;  3JCM f;  3M56 A;  4A54 A;  3CBP A;  3E19 A;  4MDX A;  3ZBD A;  3LYI A;  3VUB A;  1S72 A;  3V8L A;  1TH7 A;  2PVD B;  3GNF B;  5GMK l;  3S6W A;  2LT4 A;  3P8D A;  4IUV A;  2D6F A;  2ZGW A;  2DTO A;  3AHU A;  2OTL A;  5D6X A;  3TEE A;  2BKD N;  2K3X A;  3FEO A;  2DIQ A;  4Z02 A;  3SFM A;  4C0G A;  4LD9 K;  1N6A A;  4M7A E;  1I81 A;  1M5Q 1;  5GAN j;  2RJC A;  4JJN K;  4EPC A;  3OYH A;  4BE2 A;  1N9R A;  1IZ6 A;  1SSF A;  4DOV A;  5D6W A;  3HHT B;  3M54 A;  4JS5 A;  4OB3 B;  3OY9 A;  2L5Q A;  2YLC A;  3G6E T;  3X25 B;  1BIB A;  4EMK B;  2RI3 A;  2XKO C;  4N4G A;  3HSB A;  1X01 A;  2OAU A;  3OYL A;  3VJP A;  1YJ9 T;  1KD1 C;  3CCJ T;  1YI2 T;  4PJO D;  3OW2 S;  2E41 A;  3OBY A;  2RJE A;  4M78 B;  3LWI A;  3KUF A;  3QJY A;  4O5V A;  4QVD A;  3CCM T;  4LDW A;  1WGS A;  3S3N A;  3PFS A;  3QPH A;  5GAN 7;  1WPY A;  3RMQ A;  2RHU A;  3VYG A;  3CCQ A;  2PVO B;  5CR2 A;  2ZZD A;  4PNO A;  2G3R A;  4BY6 B;  1NJI C;  2HAX A;  1AHJ B;  2WSC E;  3CCL A;  2DEQ A;  2RHZ A;  1YJN T;  1FWZ A;  3LGF A;  2QQA A;  2ZPB B;  2Y4X A;  4M7D B;  4E47 A;  2DXT A;  3CD6 T;  4E7J A;  5LJ3 f;  4C92 B;  1KC8 U;  1OYX A;  3A8H B;  2LTO A;  1QP2 A;  2DK3 A;  3VUZ A;  2KK4 A;  3L2U A;  1Q86 U;  2LNV A;  1YIT A;  3PIO A;  4J8O A;  2QEX A;  4UC4 A;  2K5F A;  1WJR A;  4M75 D;  3I55 A;  1Q81 C;  2CZ0 B;  1BKB A;  1W2B A;  5GAM d;  3RIR A;  3A8G B;  2MWO A;  4BAC A;  4L6V 5;  3OS1 A;  2VV5 A;  2EQJ A;  3UDC A;  5GAM h;  3UT1 A;  3S3O A;  1UB4 A;  5LJ5 h;  3MEV A;  3OS0 A;  1VQK T;  4XU3 A;  4EMG A;  1G5V A;  1XQH A;  5CAI A;  1G3T A;  5I21 A;  2PUO B;  4LDX A;  3NTH A;  1D3B A;  1KQS S;  3M4Y A;  1PSE A;  5GAN g;  3I56 A;  2OTJ T;  1U1T A;  1VQ9 A;  2CZ6 B;  3M5A A;  4JS4 A;  1K8A C;  2RD1 A;  4F7U F;  2DVE A;  3CCR A;  3WXM B;  4MDW A;  2E6Z A;  3CXC A;  4PL6 A;  4E7I A;  1D3B B;  3MEU A;  4EDU A;  4X34 A;  3L2Q A;  1ZQ1 A;  4RCB A;  3CCE A;  1JJ2 A;  3LX7 A;  3JCM d;  2DO3 A;  3JB9 F;  4FU6 A;  1VIE A;  4HKE A;  5FRM A;  2L89 A;  3JCM h;  1VQP A;  2RK1 A;  3JB9 I;  2X4Y A;  4KBM B;  2QQB A;  2M0O A;  4IUQ A;  3UPU A;  4M7A D;  2JNG A;  2RA2 A;  4M78 G;  3OSS C;  1LOJ A;  4BUG A;  3JCM J;  1M90 U;  1OZ2 A;  4C8Q B;  3DB4 A;  4M7A F;  3SWN A;  3HFO A;  5J39 A;  4MZM A;  3ASK A;  3G4S A;  3J80 E;  1UGQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...