2FLRL

Novel 5-azaindole factor viia inhibitors
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
96
structure length
96
Chain Sequence
GDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 5-azaindole factor VIIa inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
molecule keywords Coagulation factor VII
total genus 17
structure length 96
sequence length 96
ec nomenclature ec 3.4.21.21: Coagulation factor VIIa.
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00008 EGF EGF-like domain
L PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2flrL02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2flrL01
1ADXA 5IKQA 5F19A 5JBCE 3POYA 3HS5A 3LAQA 4E1GA 1G2MB 3KL6B 1GK5A 5JW1A 3RR3A 2WPKE 2Y80B 1KSNB 3NJPC 1G1RA 1DIYA 2VWOL 4G1MB 4COXA 1NQLB 4Z0LA 4BTIA 3OLTA 4NA9L 1ATBA 1MQ5L 2W3KB 4Y6DB 5JVYA 1MQ6L 4Y79B 3SOVA 4Y7AB 2BOKL 1CVUA 2Y81B 3OLUA 1XKBA 5EGMB 2J4IB 1ATEA 3N8ZA 4CSYA 3F6UL 1IQGL 4XBMA 5JBAE 1G2LB 3DEMA 3SOBB 1UZPA 4ZH8B 2RA0L 2VVVL 3CENL 1OB1C 1J9CL 1JBUL 2BQ6A 3N8YA 2VWNL 2XC4L 5COXA 1COUA 3HS6A 4YT7L 1HAEA 1DQBA 1XFEA 1EGFA 4Z0KB 2WFTA 1JV2B 2WPIE 2WG3C 2H9EL 3TK6B 5L30L 3FCSB 2WPLE 3KQCL 1L5GB 3HPTA 2RHPA 4JYVL 2G00L 5IKTA 1PTHA 2YGOA 3Q7DA 2PR3B 3QMOA 3TH3L 1EQGA 2BMGA 4CUFA 3CFWA 1UZKA 4D0EA 1Q4GA 3ZYGA 1APOA 4ISHL 1CCVA 1G1QA 4MMYB 4Z6AL 3TK5B 1HJ7A 1IGZA 2YGPA 4LORA 3MDLA 1HCGB 2BOHA 3LIWB 2UWLB 3IITB 3M37L 1Z6CA 5F1AA 4RRZA 2NPRA 2GD4A 1EMOA 1C5MF 1IVOC 2RNLA 1F7MA 1YUGA 2P26A 3KK6A 3N8WB 3IJEB 2MGPA 2VVUL 2PUQL 1Z6EL 1HT8A 1YUFA 4FM5A 1CQEA 3LC3B 3KQDL 1EBVA 1FAXL 2FD6A 2J2UB 5L2ZL 1IQNL 1JL9A 1N1IA 4YZUB 4BXWA 1EPGA 1EQHA 3ENSA 4X8SL 2Y5FL 4X8VL 3QCWA 1EPJA 2P93L 5IKRA 4ZXXL 3KQBL 1IQML 3V65B 1HT5A 1NPEB 2Y38A 1HAFA 2Y82B 4PH9A 5CKQA 1ATDA 2XBYL 2KL7A 1EAIC 2WPHE 3LTFB 1LMJA 2WPME 1NT0A 4RRWA 2ADXA 3R05A 4BDXA 5K0HB 1F0RB 2J95B 4MMZB 2BQ7A 1MOXC 5E8DA 4ZXYL 4C16A 1FF7A 4RRXA 2WYJB 1CVWL 2P3TA 1UZQA 5JB9E 3LTGD 1URKA 4ZHAB 1KLOA 1IOXA 1IGXA 2KV4A 2W2QE 2VWMK 3BT2A 2EI8B 1IQEL 2Y7ZB 1BF9A 3ELAL 1FFMA 2BZ6L 3P5BL 5I46L 1RFNB 3SW2A 3HO4A 2BO2A 1AUTL 4RRYA 1NFYB 2VVCK 1K37A 5CKMA 3H5CB 1APQA 1LQDA 1L3YA 4JYUL 1O5DL 1KLJL 2J34B 2VH6B 3KQEL 3N8XA 4XLWA 2FZZL 3N8WA 2WYGB 3TGFA 4OTYA 3KRKA 1IQLL 5KN5C 4ISIL 1SZBA 2W86A 3NTGA 5L2YL 3GCXE 4JZFL 4D90A 1P9JA 4O1ZA 3GISX 2MHPA 2W2OE 4BXSA 2WG4B 1KLIL 1IQKL 2W26B 3EGFA 1UZJA 3Q3KB 5CISA 2VH0B 2P95L 1FSBA 1IQIL 3CS7L 1HRFA 1EPIA 1U8CB 3FFGL 1M1XB 3QH0A 4XL1A 2B7DL 5JVZA 3C9AC 1XDTR 4RUTA 1K36A 1A3PA 3KCGL 4BTTA 1I0UA 2Q1JB 2XC0L 1PRHA 2OYUP 2P3UA 1YUKB 2BQWA 2WFXB 4BDWA 2K2SB 1G1SA 1PGEA 2TGFA 1XKAL 2P3FN 3M36L 3PGHA 2J38B 1EMNA 2VJ3A 3F1SB 2W2ME 1CX2A 4LMFA 3HO5A 4X8TL 1WHFA 1HZ8A 3MQEA 4BTUA 2F9BL 1CEJA 1DX5I 2P3FL 2XBWL 2JKHL 1EZQB 1FAKL 3ZYJB 2I9AA 1W7XL 2UWOB 1WU1B 5JB8E 2UWPB 5IKVA 4OTJA 1IQJL 1B9WA 1DDXA 4X8UL 2MGRA 1ATAA 3LN0A 1V3XB 2I9BA 1NFXB 3BT1A 1HREA 2EI7B 3V64C 3HS7A 2P94L 2W2NE 1WHEA 1NFWB 1IOEL 1QFKL 2AYLA 2Y5GL 2VWLL 4ZAEB 3NTBA 2W2PE 3N8VA 2Y5HL 5FDQA 4M10A 4NG9L 1YO8A 1TPGA 2EI6B 1TLEA 2M74A 1ZAQA 3K9XA 3HO3A 1IQHL 3CA7A 1LPGA 4CUDA 5JBBE 2PHBB 1PXXA 2DDUA 3FBYA 2XC5L 3ZYIB 2XBXL 4Y71B 3TZIA 1LPKA 4Y76B 1F7EA 3SOQA 4A7IA 3GCWE 2W3IB 1N7DA 1LPZA 2K2TA 1EPHA 2J94B 2KB9A 3TBDA 2XBVL 1DVAL 4O02B 4TGFA 2FLBL 3U73A 4AQTA 2FLGA 6COXA 4D0FA 1IJQA 1U67A 1HX2A 1NFUB 2P28B 2WPJE 3BPSE 3N8YB 1IP0A 2Y7XB 1W8BL 4NGAL 5KIRA 1IQFL 3U7UG 1PFXL 1NZIA 1P0SL 2P16L 1FJSL 2BOXA 5CKNA 1X7AL 4RS0A 1KIGL 4YT6L 2D1JB 3LC5B 1YGCL 4Y7BB 1G1TA 4JZEL 2OYEP 4MMXB 1F0SB 1CCFA 3NT1A 2FLRL 4JZDL 4M11A 3LN1A 3ASIA 2CJIB 4CUEA 2BOUA 1TOZA 1FE2A
chains in the Genus database with same CATH superfamily
1ADXA 5IKQA 5F19A 5JBCE 3POYA 3HS5A 3LAQA 4E1GA 1G2MB 3KL6B 1GK5A 5JW1A 3RR3A 2WPKE 2Y80B 1KSNB 3NJPC 1G1RA 1DIYA 2VWOL 2BT8A 4G1MB 4COXA 1NQLB 4Z0LA 4BTIA 3OLTA 4NA9L 1ATBA 1MQ5L 2W3KB 4Y6DB 5JVYA 1MQ6L 4Y79B 3SOVA 4Y7AB 2BOKL 1CVUA 2Y81B 4GU3A 3OLUA 1XKBA 5EGMB 2J4IB 1ATEA 3N8ZA 4CSYA 3F6UL 1IQGL 4XBMA 5JBAE 1V1IA 1G2LB 3DEMA 3SOBB 1UZPA 4ZH8B 2RA0L 2VVVL 3CENL 1OB1C 1J9CL 1JBUL 2BQ6A 3N8YA 2VWNL 2XC4L 5COXA 1COUA 3HS6A 4YT7L 1HAEA 1DQBA 1XFEA 1EGFA 4Z0KB 2WFTA 1JV2B 2WPIE 2WG3C 2H9EL 3TK6B 5L30L 3FCSB 2WPLE 3KQCL 1L5GB 3HPTA 2RHPA 4JYVL 2HORA 2G00L 5IKTA 1PTHA 2YGOA 3Q7DA 2PR3B 3QMOA 3TH3L 1EQGA 2WZPP 2BMGA 4CUFA 3CFWA 1UZKA 4D0EA 1Q4GA 3ZYGA 1APOA 4ISHL 1CCVA 1G1QA 4MMYB 4Z6AL 3TK5B 1HJ7A 1IGZA 2YGPA 4LORA 3MDLA 2H9EC 1HCGB 2BOHA 3LIWB 2UWLB 4GU4A 3IITB 3M37L 1Z6CA 5F1AA 4RRZA 2NPRA 2GD4A 1EMOA 1C5MF 1IVOC 2RNLA 1F7MA 1YUGA 2P26A 3KK6A 3N8WB 3IJEB 2MGPA 2VVUL 2PUQL 1Z6EL 1HT8A 1YUFA 4FM5A 1CQEA 3LC3B 3KQDL 1EBVA 1FAXL 2FD6A 2J2UB 5L2ZL 1IQNL 1JL9A 1N1IA 4YZUB 4BXWA 1EPGA 1EQHA 3ENSA 4X8SL 2Y5FL 4X8VL 3QCWA 1EPJA 2P93L 5IKRA 4ZXXL 3KQBL 1IQML 3V65B 1HT5A 1NPEB 2Y38A 1HAFA 2Y82B 4PH9A 5CKQA 1ATDA 2XBYL 3LTFB 2KL7A 1EAIC 2WPHE 1LMJA 2WPME 1NT0A 4RRWA 2ADXA 3R05A 4BDXA 5K0HB 1F0RB 2J95B 4MMZB 2BQ7A 1MOXC 5E8DA 4ZXYL 4C16A 1FF7A 4RRXA 2WYJB 1CVWL 2P3TA 1UZQA 5JB9E 3LTGD 1URKA 4ZHAB 1KLOA 1IOXA 1IGXA 2BT7A 2KV4A 2W2QE 2VWMK 3BT2A 2KNIA 2EI8B 1IQEL 2Y7ZB 1BF9A 3ELAL 1FFMA 2BZ6L 3P5BL 5I46L 1RFNB 3SW2A 1QIUA 3HO4A 2BO2A 2HOXA 1AUTL 4RRYA 1NFYB 2VVCK 1K37A 5CKMA 3H5CB 1APQA 1LQDA 1L3YA 4JYUL 1O5DL 1KLJL 2J34B 2VH6B 3N8XA 3KQEL 4XLWA 2FZZL 3N8WA 2WYGB 3TGFA 4OTYA 3KRKA 1IQLL 5KN5C 4ISIL 1SZBA 2W86A 3NTGA 5L2YL 3GCXE 4JZFL 4D90A 1P9JA 4O1ZA 3GISX 1LMMA 2MHPA 2W2OE 4BXSA 2WG4B 1KLIL 1IQKL 2W26B 3EGFA 1UZJA 3Q3KB 5CISA 2VH0B 2P95L 1FSBA 1IQIL 3CS7L 1HRFA 1EPIA 1U8CB 3FFGL 1M1XB 3QH0A 4XL1A 2B7DL 5JVZA 3C9AC 1XDTR 4RUTA 1K36A 1A3PA 3KCGL 4BTTA 1I0UA 2Q1JB 2XC0L 1PRHA 2OYUP 2P3UA 1YUKB 2BQWA 2WFXB 4BDWA 2K2SB 1G1SA 1PGEA 2TGFA 1XKAL 2P3FN 3M36L 1KKEA 3PGHA 2J38B 1EMNA 2VJ3A 3F1SB 2W2ME 1CX2A 4LMFA 3HO5A 4X8TL 1WHFA 1HZ8A 3MQEA 4BTUA 2F9BL 2JJLA 1DX5I 1CEJA 1V1HA 2P3FL 2XBWL 2JKHL 1EZQB 1FAKL 3ZYJB 2I9AA 1W7XL 2UWOB 1WU1B 5JB8E 2UWPB 5IKVA 4OTJA 1IQJL 1B9WA 1DDXA 2YGQA 4X8UL 2MGRA 1ATAA 3LN0A 1V3XB 2I9BA 1NFXB 3BT1A 1HREA 2EI7B 3V64C 3HS7A 2P94L 2W2NE 1WHEA 1NFWB 1IOEL 1QFKL 2AYLA 2Y5GL 2VWLL 4ZAEB 3NTBA 2W2PE 3N8VA 2Y5HL 5FDQA 4M10A 4NG9L 1YO8A 1TPGA 2EI6B 1LK9A 1TLEA 2M74A 1ZAQA 3K9XA 3HO3A 1IQHL 3CA7A 1LPGA 4CUDA 5JBBE 2PHBB 1PXXA 2DDUA 3FBYA 2XC5L 3ZYIB 2XBXL 3S6XA 4Y71B 3TZIA 1LPKA 4Y76B 1F7EA 3SOQA 4A7IA 3GCWE 2W3IB 1N7DA 1LPZA 2K2TA 1EPHA 2J94B 2KB9A 3TBDA 2XBVL 1DVAL 4O02B 4TGFA 2FLBL 3U73A 4AQTA 2FLGA 6COXA 4D0FA 1IJQA 1U67A 1HX2A 1NFUB 2P28B 2WPJE 3BPSE 3N8YB 1IP0A 2Y7XB 1W8BL 4NGAL 5KIRA 1IQFL 3U7UG 1PFXL 1NZIA 1P0SL 2P16L 1FJSL 2BOXA 5CKNA 1X7AL 4RS0A 1KIGL 4YT6L 2D1JB 3LC5B 1YGCL 4Y7BB 1G1TA 4JZEL 2OYEP 2BSFA 4MMXB 1F0SB 1CCFA 3NT1A 2FLRL 4JZDL 4M11A 2VRSA 3LN1A 3ASIA 2CJIB 4CUEA 2BOUA 1TOZA 4A94C 1FE2A
chains in the Genus database with same CATH topology
1ADXA 5IKQA 5F19A 5JBCE 3POYA 3HS5A 3LAQA 4E1GA 1G2MB 3KL6B 1GK5A 5JW1A 3RR3A 2WPKE 2Y80B 1KSNB 3NJPC 1G1RA 1DIYA 2VWOL 4G1MB 4COXA 1NQLB 4Z0LA 4BTIA 3OLTA 4NA9L 1ATBA 1MQ5L 2W3KB 4Y6DB 5JVYA 1MQ6L 4Y79B 3SOVA 4Y7AB 2BOKL 1CVUA 2Y81B 3OLUA 1XKBA 5EGMB 2J4IB 1ATEA 3N8ZA 4CSYA 3F6UL 1IQGL 4XBMA 5JBAE 1G2LB 3DEMA 3SOBB 1UZPA 4ZH8B 2RA0L 2VVVL 3CENL 1OB1C 1J9CL 1JBUL 2BQ6A 3N8YA 2VWNL 2XC4L 5COXA 1COUA 3HS6A 4YT7L 1HAEA 1DQBA 1XFEA 1EGFA 4Z0KB 2WFTA 1JV2B 2WPIE 2WG3C 2H9EL 3TK6B 5L30L 3FCSB 2WPLE 3KQCL 1L5GB 3HPTA 2RHPA 4JYVL 2G00L 5IKTA 1PTHA 2YGOA 3Q7DA 2PR3B 3QMOA 3TH3L 1EQGA 2WZPP 2BMGA 4CUFA 3CFWA 1UZKA 4D0EA 1Q4GA 3ZYGA 1APOA 4ISHL 1CCVA 1G1QA 4MMYB 4Z6AL 3TK5B 1HJ7A 1IGZA 2YGPA 4LORA 3MDLA 2H9EC 1HCGB 2BOHA 3LIWB 2UWLB 3IITB 3M37L 1Z6CA 5F1AA 4RRZA 2NPRA 2GD4A 1EMOA 1C5MF 1IVOC 2RNLA 1F7MA 1YUGA 2P26A 3KK6A 3N8WB 3IJEB 2MGPA 2VVUL 2PUQL 1Z6EL 1HT8A 1YUFA 4FM5A 1CQEA 3LC3B 3KQDL 1EBVA 1FAXL 2FD6A 2J2UB 5L2ZL 1IQNL 1JL9A 1N1IA 4YZUB 4BXWA 1EPGA 1EQHA 3ENSA 4X8SL 2Y5FL 4X8VL 3QCWA 1EPJA 2P93L 5IKRA 4ZXXL 3KQBL 1IQML 3V65B 1HT5A 1NPEB 2Y38A 1HAFA 2Y82B 4PH9A 5CKQA 1ATDA 2XBYL 2KL7A 1EAIC 2WPHE 3LTFB 1LMJA 2WPME 1NT0A 4RRWA 2ADXA 3R05A 4BDXA 5K0HB 1F0RB 2J95B 4MMZB 2BQ7A 1MOXC 5E8DA 4ZXYL 4C16A 1FF7A 4RRXA 2WYJB 1CVWL 2P3TA 1UZQA 5JB9E 3LTGD 1URKA 4ZHAB 1KLOA 1IOXA 1IGXA 2KV4A 2W2QE 2VWMK 3BT2A 2KNIA 2EI8B 1IQEL 2Y7ZB 1BF9A 3ELAL 1FFMA 2BZ6L 3P5BL 5I46L 1RFNB 3SW2A 3HO4A 2BO2A 1AUTL 4RRYA 1NFYB 2VVCK 1K37A 5CKMA 3H5CB 1APQA 1LQDA 1L3YA 4JYUL 1O5DL 1KLJL 2J34B 2VH6B 3KQEL 3N8XA 4XLWA 2FZZL 3N8WA 2WYGB 3TGFA 4OTYA 3KRKA 1IQLL 5KN5C 4ISIL 1SZBA 2W86A 3NTGA 5L2YL 3GCXE 4JZFL 4D90A 1P9JA 4O1ZA 3GISX 1LMMA 2MHPA 2W2OE 4BXSA 2WG4B 1KLIL 1IQKL 2W26B 3EGFA 1UZJA 3Q3KB 5CISA 2VH0B 2P95L 1FSBA 1IQIL 3CS7L 1HRFA 1EPIA 1U8CB 3FFGL 1M1XB 3QH0A 4XL1A 2B7DL 5JVZA 3C9AC 1XDTR 4RUTA 1K36A 1A3PA 3KCGL 4BTTA 1I0UA 2Q1JB 2XC0L 1PRHA 2OYUP 2P3UA 1YUKB 2BQWA 2WFXB 4BDWA 2K2SB 1G1SA 1PGEA 2TGFA 1XKAL 2P3FN 3M36L 3PGHA 2J38B 1EMNA 2VJ3A 3F1SB 2W2ME 1CX2A 4LMFA 3HO5A 4X8TL 1WHFA 1HZ8A 3MQEA 4BTUA 2F9BL 1CEJA 1DX5I 2P3FL 2XBWL 2JKHL 1EZQB 1FAKL 3ZYJB 2I9AA 1W7XL 2UWOB 1WU1B 5JB8E 2UWPB 5IKVA 4OTJA 1IQJL 1B9WA 1DDXA 2YGQA 4X8UL 2MGRA 1ATAA 3LN0A 1V3XB 2I9BA 1NFXB 3BT1A 1HREA 2EI7B 3V64C 3HS7A 2P94L 2W2NE 1WHEA 1NFWB 1IOEL 1QFKL 2AYLA 2Y5GL 2VWLL 4ZAEB 3NTBA 2W2PE 3N8VA 2Y5HL 5FDQA 4M10A 4NG9L 1YO8A 1TPGA 2EI6B 1TLEA 2M74A 1ZAQA 3K9XA 3HO3A 1IQHL 3CA7A 1LPGA 4CUDA 5JBBE 2PHBB 1PXXA 2DDUA 3FBYA 2XC5L 3ZYIB 2XBXL 3S6XA 4Y71B 3TZIA 1LPKA 4Y76B 1F7EA 3SOQA 4A7IA 3GCWE 2W3IB 1N7DA 1LPZA 2K2TA 1EPHA 2J94B 2KB9A 3TBDA 2XBVL 1DVAL 4O02B 4TGFA 2FLBL 3U73A 4AQTA 2FLGA 6COXA 4D0FA 1IJQA 1U67A 1HX2A 1NFUB 2P28B 2WPJE 3BPSE 3N8YB 1IP0A 2Y7XB 1W8BL 4NGAL 5KIRA 1IQFL 3U7UG 1PFXL 1NZIA 1P0SL 2P16L 1FJSL 2BOXA 5CKNA 1X7AL 4RS0A 1KIGL 4YT6L 2D1JB 3LC5B 1YGCL 4Y7BB 1G1TA 4JZEL 2OYEP 4MMXB 1F0SB 1CCFA 3NT1A 2FLRL 4JZDL 4M11A 3LN1A 3ASIA 2CJIB 4CUEA 2BOUA 1TOZA 4A94C 1FE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ADX A;  5IKQ A;  5F19 A;  5JBC E;  3POY A;  3HS5 A;  3LAQ A;  4E1G A;  1G2M B;  3KL6 B;  1GK5 A;  5JW1 A;  3RR3 A;  2WPK E;  2Y80 B;  1KSN B;  3NJP C;  1G1R A;  1DIY A;  2VWO L;  4G1M B;  4COX A;  1NQL B;  4Z0L A;  4BTI A;  3OLT A;  4NA9 L;  1ATB A;  1MQ5 L;  2W3K B;  4Y6D B;  5JVY A;  1MQ6 L;  4Y79 B;  3SOV A;  4Y7A B;  2BOK L;  1CVU A;  2Y81 B;  3OLU A;  1XKB A;  5EGM B;  2J4I B;  1ATE A;  3N8Z A;  4CSY A;  3F6U L;  1IQG L;  4XBM A;  5JBA E;  1G2L B;  3DEM A;  3SOB B;  1UZP A;  4ZH8 B;  2RA0 L;  2VVV L;  3CEN L;  1OB1 C;  1J9C L;  1JBU L;  2BQ6 A;  3N8Y A;  2VWN L;  2XC4 L;  5COX A;  1COU A;  3HS6 A;  4YT7 L;  1HAE A;  1DQB A;  1XFE A;  1EGF A;  4Z0K B;  2WFT A;  1JV2 B;  2WPI E;  2WG3 C;  2H9E L;  3TK6 B;  5L30 L;  3FCS B;  2WPL E;  3KQC L;  1L5G B;  3HPT A;  2RHP A;  4JYV L;  2G00 L;  5IKT A;  1PTH A;  2YGO A;  3Q7D A;  2PR3 B;  3QMO A;  3TH3 L;  1EQG A;  2BMG A;  4CUF A;  3CFW A;  1UZK A;  4D0E A;  1Q4G A;  3ZYG A;  1APO A;  4ISH L;  1CCV A;  1G1Q A;  4MMY B;  4Z6A L;  3TK5 B;  1HJ7 A;  1IGZ A;  2YGP A;  4LOR A;  3MDL A;  1HCG B;  2BOH A;  3LIW B;  2UWL B;  3IIT B;  3M37 L;  1Z6C A;  5F1A A;  4RRZ A;  2NPR A;  2GD4 A;  1EMO A;  1C5M F;  1IVO C;  2RNL A;  1F7M A;  1YUG A;  2P26 A;  3KK6 A;  3N8W B;  3IJE B;  2MGP A;  2VVU L;  2PUQ L;  1Z6E L;  1HT8 A;  1YUF A;  4FM5 A;  1CQE A;  3LC3 B;  3KQD L;  1EBV A;  1FAX L;  2FD6 A;  2J2U B;  5L2Z L;  1IQN L;  1JL9 A;  1N1I A;  4YZU B;  4BXW A;  1EPG A;  1EQH A;  3ENS A;  4X8S L;  2Y5F L;  4X8V L;  3QCW A;  1EPJ A;  2P93 L;  5IKR A;  4ZXX L;  3KQB L;  1IQM L;  3V65 B;  1HT5 A;  1NPE B;  2Y38 A;  1HAF A;  2Y82 B;  4PH9 A;  5CKQ A;  1ATD A;  2XBY L;  2KL7 A;  1EAI C;  2WPH E;  3LTF B;  1LMJ A;  2WPM E;  1NT0 A;  4RRW A;  2ADX A;  3R05 A;  4BDX A;  5K0H B;  1F0R B;  2J95 B;  4MMZ B;  2BQ7 A;  1MOX C;  5E8D A;  4ZXY L;  4C16 A;  1FF7 A;  4RRX A;  2WYJ B;  1CVW L;  2P3T A;  1UZQ A;  5JB9 E;  3LTG D;  1URK A;  4ZHA B;  1KLO A;  1IOX A;  1IGX A;  2KV4 A;  2W2Q E;  2VWM K;  3BT2 A;  2EI8 B;  1IQE L;  2Y7Z B;  1BF9 A;  3ELA L;  1FFM A;  2BZ6 L;  3P5B L;  5I46 L;  1RFN B;  3SW2 A;  3HO4 A;  2BO2 A;  1AUT L;  4RRY A;  1NFY B;  2VVC K;  1K37 A;  5CKM A;  3H5C B;  1APQ A;  1LQD A;  1L3Y A;  4JYU L;  1O5D L;  1KLJ L;  2J34 B;  2VH6 B;  3KQE L;  3N8X A;  4XLW A;  2FZZ L;  3N8W A;  2WYG B;  3TGF A;  4OTY A;  3KRK A;  1IQL L;  5KN5 C;  4ISI L;  1SZB A;  2W86 A;  3NTG A;  5L2Y L;  3GCX E;  4JZF L;  4D90 A;  1P9J A;  4O1Z A;  3GIS X;  2MHP A;  2W2O E;  4BXS A;  2WG4 B;  1KLI L;  1IQK L;  2W26 B;  3EGF A;  1UZJ A;  3Q3K B;  5CIS A;  2VH0 B;  2P95 L;  1FSB A;  1IQI L;  3CS7 L;  1HRF A;  1EPI A;  1U8C B;  3FFG L;  1M1X B;  3QH0 A;  4XL1 A;  2B7D L;  5JVZ A;  3C9A C;  1XDT R;  4RUT A;  1K36 A;  1A3P A;  3KCG L;  4BTT A;  1I0U A;  2Q1J B;  2XC0 L;  1PRH A;  2OYU P;  2P3U A;  1YUK B;  2BQW A;  2WFX B;  4BDW A;  2K2S B;  1G1S A;  1PGE A;  2TGF A;  1XKA L;  2P3F N;  3M36 L;  3PGH A;  2J38 B;  1EMN A;  2VJ3 A;  3F1S B;  2W2M E;  1CX2 A;  4LMF A;  3HO5 A;  4X8T L;  1WHF A;  1HZ8 A;  3MQE A;  4BTU A;  2F9B L;  1CEJ A;  1DX5 I;  2P3F L;  2XBW L;  2JKH L;  1EZQ B;  1FAK L;  3ZYJ B;  2I9A A;  1W7X L;  2UWO B;  1WU1 B;  5JB8 E;  2UWP B;  5IKV A;  4OTJ A;  1IQJ L;  1B9W A;  1DDX A;  4X8U L;  2MGR A;  1ATA A;  3LN0 A;  1V3X B;  2I9B A;  1NFX B;  3BT1 A;  1HRE A;  2EI7 B;  3V64 C;  3HS7 A;  2P94 L;  2W2N E;  1WHE A;  1NFW B;  1IOE L;  1QFK L;  2AYL A;  2Y5G L;  2VWL L;  4ZAE B;  3NTB A;  2W2P E;  3N8V A;  2Y5H L;  5FDQ A;  4M10 A;  4NG9 L;  1YO8 A;  1TPG A;  2EI6 B;  1TLE A;  2M74 A;  1ZAQ A;  3K9X A;  3HO3 A;  1IQH L;  3CA7 A;  1LPG A;  4CUD A;  5JBB E;  2PHB B;  1PXX A;  2DDU A;  3FBY A;  2XC5 L;  3ZYI B;  2XBX L;  4Y71 B;  3TZI A;  1LPK A;  4Y76 B;  1F7E A;  3SOQ A;  4A7I A;  3GCW E;  2W3I B;  1N7D A;  1LPZ A;  2K2T A;  1EPH A;  2J94 B;  2KB9 A;  3TBD A;  2XBV L;  1DVA L;  4O02 B;  4TGF A;  2FLB L;  3U73 A;  4AQT A;  2FLG A;  6COX A;  4D0F A;  1IJQ A;  1U67 A;  1HX2 A;  1NFU B;  2P28 B;  2WPJ E;  3BPS E;  3N8Y B;  1IP0 A;  2Y7X B;  1W8B L;  4NGA L;  5KIR A;  1IQF L;  3U7U G;  1PFX L;  1NZI A;  1P0S L;  2P16 L;  1FJS L;  2BOX A;  5CKN A;  1X7A L;  4RS0 A;  1KIG L;  4YT6 L;  2D1J B;  3LC5 B;  1YGC L;  4Y7B B;  1G1T A;  4JZE L;  2OYE P;  4MMX B;  1F0S B;  1CCF A;  3NT1 A;  2FLR L;  4JZD L;  4M11 A;  3LN1 A;  3ASI A;  2CJI B;  4CUE A;  2BOU A;  1TOZ A;  1FE2 A; 
#chains in the Genus database with same CATH topology
 1ADX A;  5IKQ A;  5F19 A;  5JBC E;  3POY A;  3HS5 A;  3LAQ A;  4E1G A;  1G2M B;  3KL6 B;  1GK5 A;  5JW1 A;  3RR3 A;  2WPK E;  2Y80 B;  1KSN B;  3NJP C;  1G1R A;  1DIY A;  2VWO L;  2BT8 A;  4G1M B;  4COX A;  1NQL B;  4Z0L A;  4BTI A;  3OLT A;  4NA9 L;  1ATB A;  1MQ5 L;  2W3K B;  4Y6D B;  5JVY A;  1MQ6 L;  4Y79 B;  3SOV A;  4Y7A B;  2BOK L;  1CVU A;  2Y81 B;  4GU3 A;  3OLU A;  1XKB A;  5EGM B;  2J4I B;  1ATE A;  3N8Z A;  4CSY A;  3F6U L;  1IQG L;  4XBM A;  5JBA E;  1V1I A;  1G2L B;  3DEM A;  3SOB B;  1UZP A;  4ZH8 B;  2RA0 L;  2VVV L;  3CEN L;  1OB1 C;  1J9C L;  1JBU L;  2BQ6 A;  3N8Y A;  2VWN L;  2XC4 L;  5COX A;  1COU A;  3HS6 A;  4YT7 L;  1HAE A;  1DQB A;  1XFE A;  1EGF A;  4Z0K B;  2WFT A;  1JV2 B;  2WPI E;  2WG3 C;  2H9E L;  3TK6 B;  5L30 L;  3FCS B;  2WPL E;  3KQC L;  1L5G B;  3HPT A;  2RHP A;  4JYV L;  2HOR A;  2G00 L;  5IKT A;  1PTH A;  2YGO A;  3Q7D A;  2PR3 B;  3QMO A;  3TH3 L;  1EQG A;  2WZP P;  2BMG A;  4CUF A;  3CFW A;  1UZK A;  4D0E A;  1Q4G A;  3ZYG A;  1APO A;  4ISH L;  1CCV A;  1G1Q A;  4MMY B;  4Z6A L;  3TK5 B;  1HJ7 A;  1IGZ A;  2YGP A;  4LOR A;  3MDL A;  2H9E C;  1HCG B;  2BOH A;  3LIW B;  2UWL B;  4GU4 A;  3IIT B;  3M37 L;  1Z6C A;  5F1A A;  4RRZ A;  2NPR A;  2GD4 A;  1EMO A;  1C5M F;  1IVO C;  2RNL A;  1F7M A;  1YUG A;  2P26 A;  3KK6 A;  3N8W B;  3IJE B;  2MGP A;  2VVU L;  2PUQ L;  1Z6E L;  1HT8 A;  1YUF A;  4FM5 A;  1CQE A;  3LC3 B;  3KQD L;  1EBV A;  1FAX L;  2FD6 A;  2J2U B;  5L2Z L;  1IQN L;  1JL9 A;  1N1I A;  4YZU B;  4BXW A;  1EPG A;  1EQH A;  3ENS A;  4X8S L;  2Y5F L;  4X8V L;  3QCW A;  1EPJ A;  2P93 L;  5IKR A;  4ZXX L;  3KQB L;  1IQM L;  3V65 B;  1HT5 A;  1NPE B;  2Y38 A;  1HAF A;  2Y82 B;  4PH9 A;  5CKQ A;  1ATD A;  2XBY L;  3LTF B;  2KL7 A;  1EAI C;  2WPH E;  1LMJ A;  2WPM E;  1NT0 A;  4RRW A;  2ADX A;  3R05 A;  4BDX A;  5K0H B;  1F0R B;  2J95 B;  4MMZ B;  2BQ7 A;  1MOX C;  5E8D A;  4ZXY L;  4C16 A;  1FF7 A;  4RRX A;  2WYJ B;  1CVW L;  2P3T A;  1UZQ A;  5JB9 E;  3LTG D;  1URK A;  4ZHA B;  1KLO A;  1IOX A;  1IGX A;  2BT7 A;  2KV4 A;  2W2Q E;  2VWM K;  3BT2 A;  2KNI A;  2EI8 B;  1IQE L;  2Y7Z B;  1BF9 A;  3ELA L;  1FFM A;  2BZ6 L;  3P5B L;  5I46 L;  1RFN B;  3SW2 A;  1QIU A;  3HO4 A;  2BO2 A;  2HOX A;  1AUT L;  4RRY A;  1NFY B;  2VVC K;  1K37 A;  5CKM A;  3H5C B;  1APQ A;  1LQD A;  1L3Y A;  4JYU L;  1O5D L;  1KLJ L;  2J34 B;  2VH6 B;  3N8X A;  3KQE L;  4XLW A;  2FZZ L;  3N8W A;  2WYG B;  3TGF A;  4OTY A;  3KRK A;  1IQL L;  5KN5 C;  4ISI L;  1SZB A;  2W86 A;  3NTG A;  5L2Y L;  3GCX E;  4JZF L;  4D90 A;  1P9J A;  4O1Z A;  3GIS X;  1LMM A;  2MHP A;  2W2O E;  4BXS A;  2WG4 B;  1KLI L;  1IQK L;  2W26 B;  3EGF A;  1UZJ A;  3Q3K B;  5CIS A;  2VH0 B;  2P95 L;  1FSB A;  1IQI L;  3CS7 L;  1HRF A;  1EPI A;  1U8C B;  3FFG L;  1M1X B;  3QH0 A;  4XL1 A;  2B7D L;  5JVZ A;  3C9A C;  1XDT R;  4RUT A;  1K36 A;  1A3P A;  3KCG L;  4BTT A;  1I0U A;  2Q1J B;  2XC0 L;  1PRH A;  2OYU P;  2P3U A;  1YUK B;  2BQW A;  2WFX B;  4BDW A;  2K2S B;  1G1S A;  1PGE A;  2TGF A;  1XKA L;  2P3F N;  3M36 L;  1KKE A;  3PGH A;  2J38 B;  1EMN A;  2VJ3 A;  3F1S B;  2W2M E;  1CX2 A;  4LMF A;  3HO5 A;  4X8T L;  1WHF A;  1HZ8 A;  3MQE A;  4BTU A;  2F9B L;  2JJL A;  1DX5 I;  1CEJ A;  1V1H A;  2P3F L;  2XBW L;  2JKH L;  1EZQ B;  1FAK L;  3ZYJ B;  2I9A A;  1W7X L;  2UWO B;  1WU1 B;  5JB8 E;  2UWP B;  5IKV A;  4OTJ A;  1IQJ L;  1B9W A;  1DDX A;  2YGQ A;  4X8U L;  2MGR A;  1ATA A;  3LN0 A;  1V3X B;  2I9B A;  1NFX B;  3BT1 A;  1HRE A;  2EI7 B;  3V64 C;  3HS7 A;  2P94 L;  2W2N E;  1WHE A;  1NFW B;  1IOE L;  1QFK L;  2AYL A;  2Y5G L;  2VWL L;  4ZAE B;  3NTB A;  2W2P E;  3N8V A;  2Y5H L;  5FDQ A;  4M10 A;  4NG9 L;  1YO8 A;  1TPG A;  2EI6 B;  1LK9 A;  1TLE A;  2M74 A;  1ZAQ A;  3K9X A;  3HO3 A;  1IQH L;  3CA7 A;  1LPG A;  4CUD A;  5JBB E;  2PHB B;  1PXX A;  2DDU A;  3FBY A;  2XC5 L;  3ZYI B;  2XBX L;  3S6X A;  4Y71 B;  3TZI A;  1LPK A;  4Y76 B;  1F7E A;  3SOQ A;  4A7I A;  3GCW E;  2W3I B;  1N7D A;  1LPZ A;  2K2T A;  1EPH A;  2J94 B;  2KB9 A;  3TBD A;  2XBV L;  1DVA L;  4O02 B;  4TGF A;  2FLB L;  3U73 A;  4AQT A;  2FLG A;  6COX A;  4D0F A;  1IJQ A;  1U67 A;  1HX2 A;  1NFU B;  2P28 B;  2WPJ E;  3BPS E;  3N8Y B;  1IP0 A;  2Y7X B;  1W8B L;  4NGA L;  5KIR A;  1IQF L;  3U7U G;  1PFX L;  1NZI A;  1P0S L;  2P16 L;  1FJS L;  2BOX A;  5CKN A;  1X7A L;  4RS0 A;  1KIG L;  4YT6 L;  2D1J B;  3LC5 B;  1YGC L;  4Y7B B;  1G1T A;  4JZE L;  2OYE P;  2BSF A;  4MMX B;  1F0S B;  1CCF A;  3NT1 A;  2FLR L;  4JZD L;  4M11 A;  2VRS A;  3LN1 A;  3ASI A;  2CJI B;  4CUE A;  2BOU A;  1TOZ A;  4A94 C;  1FE2 A; 
#chains in the Genus database with same CATH homology
 1ADX A;  5IKQ A;  5F19 A;  5JBC E;  3POY A;  3HS5 A;  3LAQ A;  4E1G A;  1G2M B;  3KL6 B;  1GK5 A;  5JW1 A;  3RR3 A;  2WPK E;  2Y80 B;  1KSN B;  3NJP C;  1G1R A;  1DIY A;  2VWO L;  4G1M B;  4COX A;  1NQL B;  4Z0L A;  4BTI A;  3OLT A;  4NA9 L;  1ATB A;  1MQ5 L;  2W3K B;  4Y6D B;  5JVY A;  1MQ6 L;  4Y79 B;  3SOV A;  4Y7A B;  2BOK L;  1CVU A;  2Y81 B;  3OLU A;  1XKB A;  5EGM B;  2J4I B;  1ATE A;  3N8Z A;  4CSY A;  3F6U L;  1IQG L;  4XBM A;  5JBA E;  1G2L B;  3DEM A;  3SOB B;  1UZP A;  4ZH8 B;  2RA0 L;  2VVV L;  3CEN L;  1OB1 C;  1J9C L;  1JBU L;  2BQ6 A;  3N8Y A;  2VWN L;  2XC4 L;  5COX A;  1COU A;  3HS6 A;  4YT7 L;  1HAE A;  1DQB A;  1XFE A;  1EGF A;  4Z0K B;  2WFT A;  1JV2 B;  2WPI E;  2WG3 C;  2H9E L;  3TK6 B;  5L30 L;  3FCS B;  2WPL E;  3KQC L;  1L5G B;  3HPT A;  2RHP A;  4JYV L;  2G00 L;  5IKT A;  1PTH A;  2YGO A;  3Q7D A;  2PR3 B;  3QMO A;  3TH3 L;  1EQG A;  2WZP P;  2BMG A;  4CUF A;  3CFW A;  1UZK A;  4D0E A;  1Q4G A;  3ZYG A;  1APO A;  4ISH L;  1CCV A;  1G1Q A;  4MMY B;  4Z6A L;  3TK5 B;  1HJ7 A;  1IGZ A;  2YGP A;  4LOR A;  3MDL A;  2H9E C;  1HCG B;  2BOH A;  3LIW B;  2UWL B;  3IIT B;  3M37 L;  1Z6C A;  5F1A A;  4RRZ A;  2NPR A;  2GD4 A;  1EMO A;  1C5M F;  1IVO C;  2RNL A;  1F7M A;  1YUG A;  2P26 A;  3KK6 A;  3N8W B;  3IJE B;  2MGP A;  2VVU L;  2PUQ L;  1Z6E L;  1HT8 A;  1YUF A;  4FM5 A;  1CQE A;  3LC3 B;  3KQD L;  1EBV A;  1FAX L;  2FD6 A;  2J2U B;  5L2Z L;  1IQN L;  1JL9 A;  1N1I A;  4YZU B;  4BXW A;  1EPG A;  1EQH A;  3ENS A;  4X8S L;  2Y5F L;  4X8V L;  3QCW A;  1EPJ A;  2P93 L;  5IKR A;  4ZXX L;  3KQB L;  1IQM L;  3V65 B;  1HT5 A;  1NPE B;  2Y38 A;  1HAF A;  2Y82 B;  4PH9 A;  5CKQ A;  1ATD A;  2XBY L;  2KL7 A;  1EAI C;  2WPH E;  3LTF B;  1LMJ A;  2WPM E;  1NT0 A;  4RRW A;  2ADX A;  3R05 A;  4BDX A;  5K0H B;  1F0R B;  2J95 B;  4MMZ B;  2BQ7 A;  1MOX C;  5E8D A;  4ZXY L;  4C16 A;  1FF7 A;  4RRX A;  2WYJ B;  1CVW L;  2P3T A;  1UZQ A;  5JB9 E;  3LTG D;  1URK A;  4ZHA B;  1KLO A;  1IOX A;  1IGX A;  2KV4 A;  2W2Q E;  2VWM K;  3BT2 A;  2KNI A;  2EI8 B;  1IQE L;  2Y7Z B;  1BF9 A;  3ELA L;  1FFM A;  2BZ6 L;  3P5B L;  5I46 L;  1RFN B;  3SW2 A;  3HO4 A;  2BO2 A;  1AUT L;  4RRY A;  1NFY B;  2VVC K;  1K37 A;  5CKM A;  3H5C B;  1APQ A;  1LQD A;  1L3Y A;  4JYU L;  1O5D L;  1KLJ L;  2J34 B;  2VH6 B;  3KQE L;  3N8X A;  4XLW A;  2FZZ L;  3N8W A;  2WYG B;  3TGF A;  4OTY A;  3KRK A;  1IQL L;  5KN5 C;  4ISI L;  1SZB A;  2W86 A;  3NTG A;  5L2Y L;  3GCX E;  4JZF L;  4D90 A;  1P9J A;  4O1Z A;  3GIS X;  1LMM A;  2MHP A;  2W2O E;  4BXS A;  2WG4 B;  1KLI L;  1IQK L;  2W26 B;  3EGF A;  1UZJ A;  3Q3K B;  5CIS A;  2VH0 B;  2P95 L;  1FSB A;  1IQI L;  3CS7 L;  1HRF A;  1EPI A;  1U8C B;  3FFG L;  1M1X B;  3QH0 A;  4XL1 A;  2B7D L;  5JVZ A;  3C9A C;  1XDT R;  4RUT A;  1K36 A;  1A3P A;  3KCG L;  4BTT A;  1I0U A;  2Q1J B;  2XC0 L;  1PRH A;  2OYU P;  2P3U A;  1YUK B;  2BQW A;  2WFX B;  4BDW A;  2K2S B;  1G1S A;  1PGE A;  2TGF A;  1XKA L;  2P3F N;  3M36 L;  3PGH A;  2J38 B;  1EMN A;  2VJ3 A;  3F1S B;  2W2M E;  1CX2 A;  4LMF A;  3HO5 A;  4X8T L;  1WHF A;  1HZ8 A;  3MQE A;  4BTU A;  2F9B L;  1CEJ A;  1DX5 I;  2P3F L;  2XBW L;  2JKH L;  1EZQ B;  1FAK L;  3ZYJ B;  2I9A A;  1W7X L;  2UWO B;  1WU1 B;  5JB8 E;  2UWP B;  5IKV A;  4OTJ A;  1IQJ L;  1B9W A;  1DDX A;  2YGQ A;  4X8U L;  2MGR A;  1ATA A;  3LN0 A;  1V3X B;  2I9B A;  1NFX B;  3BT1 A;  1HRE A;  2EI7 B;  3V64 C;  3HS7 A;  2P94 L;  2W2N E;  1WHE A;  1NFW B;  1IOE L;  1QFK L;  2AYL A;  2Y5G L;  2VWL L;  4ZAE B;  3NTB A;  2W2P E;  3N8V A;  2Y5H L;  5FDQ A;  4M10 A;  4NG9 L;  1YO8 A;  1TPG A;  2EI6 B;  1TLE A;  2M74 A;  1ZAQ A;  3K9X A;  3HO3 A;  1IQH L;  3CA7 A;  1LPG A;  4CUD A;  5JBB E;  2PHB B;  1PXX A;  2DDU A;  3FBY A;  2XC5 L;  3ZYI B;  2XBX L;  3S6X A;  4Y71 B;  3TZI A;  1LPK A;  4Y76 B;  1F7E A;  3SOQ A;  4A7I A;  3GCW E;  2W3I B;  1N7D A;  1LPZ A;  2K2T A;  1EPH A;  2J94 B;  2KB9 A;  3TBD A;  2XBV L;  1DVA L;  4O02 B;  4TGF A;  2FLB L;  3U73 A;  4AQT A;  2FLG A;  6COX A;  4D0F A;  1IJQ A;  1U67 A;  1HX2 A;  1NFU B;  2P28 B;  2WPJ E;  3BPS E;  3N8Y B;  1IP0 A;  2Y7X B;  1W8B L;  4NGA L;  5KIR A;  1IQF L;  3U7U G;  1PFX L;  1NZI A;  1P0S L;  2P16 L;  1FJS L;  2BOX A;  5CKN A;  1X7A L;  4RS0 A;  1KIG L;  4YT6 L;  2D1J B;  3LC5 B;  1YGC L;  4Y7B B;  1G1T A;  4JZE L;  2OYE P;  4MMX B;  1F0S B;  1CCF A;  3NT1 A;  2FLR L;  4JZD L;  4M11 A;  3LN1 A;  3ASI A;  2CJI B;  4CUE A;  2BOU A;  1TOZ A;  4A94 C;  1FE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...