2FLVA

Clostridium beijerinckii flavodoxin mutant: g57t reduced (150k)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
138
structure length
138
Chain Sequence
MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMTDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Electron transport
total genus 48
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2flvA00
1XYYA 2FLVA 4PTYA 1D03A 4HEQA 2A5LA 3F6RA 2QX6A 3ESXA 4ICIA 1RLIA 2OYSA 3KAQA 4M0CA 1FLNA 1AKTA 2KLBA 4C76A 4R81A 5NLLA 2R97A 1F4PA 3F6SA 1KBOA 1BVYF 3NHYA 4ZVNA 1FVXA 4YAOA 1JA0A 3NFRA 4OXXA 4CF6A 2BZSA 3OX3A 3LT5A 2HNAA 4J8PA 2M6RA 5ULLA 5LBUA 3W79A 1FLDA 5B3LA 3L9WA 2FVXA 1CZNA 4QOGA 1T5BA 4CETA 5FA6A 1TLLA 3QFCA 2HNBA 4GI5A 2OHIA 3G5MA 1GG5A 3HA2A 1OBVA 1YDGA 4DILA 2HPVA 4H6PA 3OJXA 1AKWA 4DIKA 2X2PA 5FUQA 1FLAA 2Z9CA 3TEMA 3TZBA 1J9EA 3LCMA 4ZVMA 2FAXA 1WSBA 2FZ5A 1WSWA 2Q9UA 2GSWA 1AKRA 3ZHOA 1I1OA 2FX2A 2BN4A 3O73A 4XDHA 5LJLA 3ESYA 3OWXA 1XYVA 1RLJA 4Y9RA 4QOEA 1J9GA 3OVMA 4D02A 1V4BA 1T0IA 3EDOA 1ZX1A 3NLLA 5BUCA 4FX2A 5LVAA 5FX2A 2RG1A 4HS4A 2MOKA 3GFQA 3OWHA 3QE2A 4YAWA 3KAPA 2MWMA 2FOXA 2XOEA 1D04A 3ESZA 1CZUA 3FVWA 4N65A 3U7IA 1YCFA 1YCHA 5EAIA 1OBOA 3F2VA 4U7GA 2N1MA 5JROA 5EA2A 2BMVA 1J8QA 3K1YA 1FTGA 3F90A 3OX1A 2QR2A 1FLVA 1BU5A 3N3BC 4C0WA 4NULA 1NNI1 1AKQA 3W7AA 2BPOA 5F4BA 2FCRA 1JA1A 1H66A 3P0RA 3NHWA 3JSXA 3ES9A 1YOBA 3S2YA 4PTZA 3RPEA 3NHRA 2XODA 2M6SA 3UXEA 2V5VA 2OHHA 4LAFA 3HLYA 1QBGA 1C7EA 4U7HA 3L9XA 3GAMA 2Z9BA 2ZKIA 4Y9UA 4LTMA 4U7FA 3W78A 3GFSA 3W77A 5B3KA 2V9CA 3HR4A 3FJOA 3FX2A 1YRHA 1ZWKA 1TIKA 1CZOA 4N82A 2QX4A 1CZHA 3KLBA 1QHEA 1C7FA 5EMNA 3FW1A 2Z9DA 1AKUA 1QR2A 4Y7CA 2B3DA 4NLLA 1VMEA 2D5IA 5LMCA 1FX1A 2QWXA 2FZVA 3NHFA 4FGKA 4BMPB 5LJIA 4QOJA 4GR9A 3NHPA 5F12A 1KBQA 1OFVA 1D4AA 2MTBA 4XDGA 3U7RA 5F51A 3B6JA 3B6KA 1AKVA 4QOHA 2AMJA 4QOFA 1E5DA 4ZVLA 2QX9A 2QX8A 1DX9A 5A4KA 4C14A 2QMYA 4F8YA 3NHUA 4GQIA 4BMOB 1X77A 2QMZA 3OJWA 4YAUA 4ZVKA 6NULA 1SG0A 1RTTA 1QRDA 5LBTA 1J9ZA 1CZLA 3KEGA 3SVLA 5NULA 1AZLA 2MT9A 5LLDA 3B6MA 3D7NA 3FNIA 4C0XA 4FGLA 1AG9A 1YKGA 1B1CA 2ARKA 1CZKA 4FGJA 3NHKA 3R6WA 3TE7A 2BF4A 2Z98A 3NHSA 3K20A 4DY4A 4YAFA 1CZRA 1AHNA 3GFRA 1XI2A 4QOIA 1H69A 1DXQA 2X2OA 1ZWLA 3N39C 3OX2A 4YALA 1SQSA 1YCGA 2R96A 4ESEA 3O2NA 3QFRA 4LTDA 1FUEA 4N9QA 3UXHA 2OHJA 4LTNA 2V5UA 4H2DA 2WC1A 4YQEA 5TGZA 3NHLA 1XT6A 4S24A 3EYWA 3NHJA 4LA4A 1RCFA 2FDXA 3N3AC 2F1OA 4PU0A 4QODA 3B6IA 2KQUA 2W5UA 1DXOA 2Q62A 1AMOA
chains in the Genus database with same CATH superfamily
2X0RA 2UUBB 2FLVA 1OC4A 3DOUA 3FCUB 3HZOA 1FPMA 2JI4A 3UMJA 4EOGA 1W4CA 3LPCA 1G19A 3B70A 2F9LA 1EHYA 5CCDA 3TQOA 1SVNA 2W2MA 3KKMA 1O6FA 3LUFA 3PEYA 1RHKA 1T36B 2GJKA 1QBKC 2PKYX 4L27A 2DPYA 3FCSB 4Q9NA 5ERYA 1D5CA 1SUWA 1JFVA 1RLIA 2OYSA 4H7FA 4ZDKA 1Z5PA 4KN8A 4R7ZA 3FYUB 4TMKA 2AA3A 2XYHA 4F2DA 1AY0A 4EYGA 2PXAA 3E05A 2IRWA 4EGQA 1RWPA 5AWFC 5C8YA 4BNGA 1KJYA 1VBKA 1YA4A 3BHNA 4R81A 4BVKA 2QRJA 2GJSA 2LDXA 3Q85A 4ZT4A 5IH3A 3UMVA 1JX6A 4CM1A 3PEWA 4FM9A 4EG0A 2R6AA 1VLJA 3IVXA 3T5DA 2A5DA 2OVBA 5JZOA 3OTIA 4WBNA 2VRBA 3INTA 2G88A 1Q11A 3OLVA 1KOLA 3U7QA 4ZIRB 4I50F 1Y4UA 2DQKA 1WXWA 2A88A 3Q12A 4YAOA 5AKYA 4DGQA 1RZVA 5AVVA 4OJTA 2XQJA 1P7PA 3WLJA 3CE9A 2XH8A 3FWYA 4YDSA 5G4KB 1NOIA 2W8ZA 3DEAA 3H19A 2JFYA 3HRIA 4I0WB 3U1TA 1RMTA 1XSEA 2D1TA 4N3NA 2IYVA 4WX2B 3K6KA 2KW5A 4F8EA 3I2GA 1G3IA 5K01A 1ZJWA 5J43A 5CCXA 4HC4A 2BM9A 2ZRLA 2MSNA 4P36A 4UQPA 4BMZA 2I1QA 4KVFA 5BNIA 2CSUA 4QECA 2B94A 2JLVA 4MIKA 5ULLA 2PUGA 4L0DA 1KETA 3T4XA 3Q98A 2WIJA 3R3JA 2HWWA 4E94A 3HJGA 3WDMA 4HB4A 4JBLA 4OLHA 3AK4A 1I1NA 3WHIA 4Q18A 2QI9F 2ZYWX 5IJZA 2HCJB 1T2EA 3RH0A 3EZGA 5KQGA 4R6WA 1H2WA 1C4XA 4N6GA 5DBHX 3EPPA 4JQZA 4BP8A 1XF9A 4DCTA 4EUNA 1SKMA 1E94E 5KNBA 3HUTA 1JEQA 1V35A 1XK6A 5M2QA 3RVMA 3TECE 1YU9A 1KSFX 3SYMA 5EMHA 2W11A 2VQEB 5CD9A 4JWTA 1X42A 1NI4A 4MI1A 4C2AA 2OFWA 2AW5A 2ZCJA 4PLGA 3P2IA 2VSNA 2FRDA 4ER7A 4Q5IA 3HA2A 4YJDA 3RK4A 2VHYA 1DFHA 4UEQA 3L43A 3V2IA 4HO1X 5A5FA 4KBGA 1JKIA 5DHAA 3T3OA 1YNOA 4H6PA 2VWPA 3H1GA 1YOVA 3DGEC 1X7YA 1AZWA 3KR9A 3NAZA 4YWJA 1PJBA 3ZZ1A 1Y6GA 1K5HA 3UA3A 4PC3A 4NCKA 4E30A 1QO7A 3TXYA 2OQIA 4JI1B 4GW3A 1SO8A 5LFAA 3OJEA 3R24A 4N0QA 1B6SA 3RHFA 5IS2A 4ATNA 2WP8J 4MV5A 3VYRB 1ZY2A 5LM3A 3RYCA 1JFRA 4FT2A 4H1HA 1Z3IX 3GDHA 4AS2A 2FPGA 1QGOA 2HRCA 5AW2A 2XJ4A 4D8XA 4UU8A 4E7PA 2R84A 3BD8A 4XE5A 5JFGA 3CKMA 4HDMB 4GLFA 4C3OB 4JSTA 3OM1A 1T9BA 2CUZA 1OTYA 3DZGA 2W2QA 4ETWA 2B8WA 2BCGY 2Y0PA 1TC2A 4CCYA 3EARA 4K6MA 1JALA 2CDNA 1IN5A 5FV7A 4UTZA 1GQFA 2AZMA 3ORHA 3EW7A 4HH3C 3VPFA 4Z49A 4HR7A 4RJKA 3PPYA 5C81A 1CBUA 2CNBA 4TT3A 3LHSA 2BHNA 4M88A 4JYZA 1SHKA 1V3TA 2NZ8A 3K72B 4EHJA 5M29A 1OB2A 3H5NA 4LJ4A 3QMPA 2J3KA 4J9UE 2P2LA 5CPFA 4JB2A 3NQ41 3EIHA 2NV0A 3ZJYA 1P6QA 4X90A 4I08A 4P4TA 2CNDA 2F7SA 3AY6A 4RVHA 4CMKA 3BBLA 2Q8NA 1K7YA 1ONPA 3QRWA 4OI1A 3CGWA 2G9VA 3D6TB 5A4IS 1DJQA 1RM5A 1L7OA 4OLJA 1RNLA 1C0IA 3PCRB 2I7TA 3L6BA 2PCJA 3U19A 2J0SA 1GGHA 4PX2A 4YFVA 2JAWA 4QE3A 4ZYTA 4MUJA 5FX2A 4EAAA 2QRVB 3IRUA 2BP7B 3QEOA 2O14A 2NSYA 4HS4A 3QBVA 4E14A 2ST1A 4MH0R 2J0UA 3OWHA 2AC4A 3DAOA 3VDRA 4B3BA 1Y3BE 4CQLA 2IPLA 4AQYB 2ZSBA 3VNQA 2V55B 2EJTA 3H86A 3CEMA 2JHGA 1XHLA 2B34A 2BWJA 1E7YA 3VR3D 1QAOA 1EYZA 5T4FA 2ADMA 2YQ5A 3EIEA 4JLJA 4DMCA 4HAIA 3LBFA 4GKAA 2FWAA 4Z8XA 5KX5B 2Q3FA 5JJLA 1OAOA 1ZMXA 1WCV1 3K3PA 3I04A 5FCDA 3SC3A 3SLGA 1DJOA 1LFAA 4LXUA 4MCJA 2HLHA 1M1YA 1QK3A 3EIWA 3QOXA 4XSGA 2Q3HA 1FUUA 3L4BA 2B35A 4JX9A 1FP6A 1P17A 1STOA 1XLUA 2O0LA 1BEZA 1OBOA 2PXCA 1WG8A 4K2AA 3PLAE 1IZ9A 9ATCA 1TYCA 4G0QA 3ZQ6A 3STYA 4KIWA 1GVHA 4PYIA 1SC6A 1P80A 3TIGA 5FUVA 1DQPA 1CS0B 1J25A 3U13A 1IONA 3A9UA 3JRXA 3MB8A 4FE7A 4UASA 4PGGA 4MRRA 3R9IA 4FGZA 4E5KA 3BE4A 3SR0A 3N2KB 2WSMA 3AR6A 2HHHB 3RSOA 4ER3A 5IF3A 4Z54A 1H2AS 5ALRA 3AQ4A 3F3MA 3IOYA 4Q3EA 3C3AA 1C1DA 2HMSA 2NU7B 1NW8A 3ROFA 3V7YA 4CIBA 4KQHA 5JRJA 4RHCA 1GLGA 3T3IA 4BWFB 2OHOA 3GLTA 4LVCA 5IKXA 2XDQA 3KPWA 4XIFA 1Z73A 3DFZA 1P4GA 4MA4A 1N32B 3BGWA 1QORA 4ZICA 1OLXB 1UQTA 3L0ZA 1F1JA 3ZR4B 1FBTA 1Z4IA 2F1KA 3TN7A 1P44A 3AF3A 1KPIA 3VAZA 3EY9A 1XVUA 3HR8A 3ZYZA 4F91B 1O97D 3AM1A 2RCNA 1YOBA 3K0FA 4PTZA 4B43A 1EEHA 1J2YA 2GDZA 3MAJA 4I1PA 4NSNA 2NU6A 2EZ8A 3OFSA 3VU3A 2KE5A 3B38A 1ESDA 3LT2A 4XIJA 5HK8A 2RGWA 4RGQA 2A1TS 1G1MA 3EZXA 4Z0NA 4M55A 2R44A 2I9KA 3EG9A 1UWCA 4MRMB 1U81A 2P9HA 3GP5A 4PYQA 4WZAE 4PPYA 3W5CA 1ZU5A 1CF9A 3PC6A 4Z9BA 5KTKA 1X3LA 3RSGA 2RG7A 1N5MA 1P2BA 4OP2A 1Z17A 4L28A 2R6ZA 2HA6A 4TWAA 4A82A 3NJRA 1YQEA 1NP3A 1SUEA 4OHBA 3ORRA 4N0EA 2RBGA 2W8BB 4LYYA 4WCDA 3R3UA 1V3QE 1ESMA 1Z6PA 5B12A 4XPIA 1ISMA 1T0PA 2PQMA 3BCRA 2DHCA 1M73E 4U0JA 4D80A 1WZEA 3RRNA 3GLIE 5K8UA 3P97A 4EY3A 4EQ6A 1E2GA 4BHTA 1T2FA 2WBLC 1RAAA 3HUFA 1DG1G 5EHGA 4A8HA 5REQA 5CH8A 2ZANA 3W78A 1JKJA 2BRUC 5IM5A 1V9SA 1R7RA 3VHRA 1BN6A 1M6WA 1I13A 2V97A 3Q8WA 5HW0A 2XY4A 1KEKA 1TZBA 3F4LA 4X6UA 1REQA 1BD4A 2YQZA 2Q1UA 3WYBA 4CKBA 4B3SB 3ZVRA 2RHDA 4O08A 4G1UC 1LV8A 3PUWA 4I4CA 3LGAA 3D0OA 3MGBA 2PGJA 4LK2A 1JJ7A 1ZM7A 3VHXB 5I7HA 1YSCA 1P7WA 2F6RA 1D07A 2FX5A 3KJIA 4J0CA 3R7SA 2YMLA 1HURA 2XUPA 3BVPA 2O0HA 1JLHA 3K8OE 4R01A 4RIIA 1ZZGA 4BNDB 4MP8A 2H1CA 3OIUA 1O94A 2P8SA 4N0PA 4RIFA 3RG2A 3P32A 4YCSA 4YRBA 3QE9Y 4Q24A 1UM9A 2ACVA 2C82A 2HGZA 1KI8A 3F49S 4TLAA 3I73A 2RAVA 4TWBA 2X0FA 3S1LA 3X44A 2G7ZA 4OXQA 4E33A 1KKLA 4F4UA 1YMVA 2P2SA 5C8VA 3WJAA 1C7JA 1KMHB 3MOSA 1NP6A 4CIAA 2X8LA 3DBLA 4IIVA 3ONWA 2GPWA 5AUOB 4XLZA 1D1PA 1GPYA 3R3SA 1EZ4A 5TMPA 1LW6E 2K2WA 1KQPA 5LJIA 3N2YA 1JI3A 1KEZA 4MHOA 4BJ5A 2ASEA 2ID7A 4M7RA 1UK8A 2VHQA 4QG3A 3EVGA 4GR9A 4OU4A 3NHPA 1SKYB 1DKQA 3LVQE 4J7XA 4NYIR 5JS7A 5HRUA 1NXPA 1Y5NA 1DUSA 1XRMA 3COSA 1ML3A 1USGA 2GLTA 2F43A 2C9CA 3CSDA 3EAGA 3O2JA 1CUDA 3W5SA 3ZIUA 5BOSA 4OU5A 3EQ8A 4CMJA 5K0GA 1OFHA 4HAZA 3L6CA 2XUHA 1D7OA 3OQIB 1XRQA 1SUSA 1H0HA 3DQPA 1U1EA 4QQ8A 1I7PA 3SIXA 3X2SA 2WJIA 4GKJB 5FNZA 4KDCA 3TX6A 4YBRA 2VYVD 3VSCA 1C30B 1P2SA 1II0A 4BVJA 1QVWA 4JH0A 2H0AA 3CR8A 3ANTA 3LBIA 3N2EA 4GGMX 3LX4A 5FLKA 4B74A 3TTYA 2GTIA 5K3OA 1WXIA 3BRWA 2QQGA 2Z95A 3NIDB 2YFKA 4NKRA 4M1EA 4QYIB 2MYTA 1QM5A 4YCDA 3S4YA 1JFTA 4JAVC 3QW4B 2AOUB 5TQ2B 1FXUA 3R5SA 2XT9A 2VPZA 2HJVA 4JUDX 4A6PA 3KE9A 4BNFA 2E4WA 2QMZA 2JFNA 2ZB4A 3G5UA 3TLJA 2LXNA 2YXNA 5AOAA 4ZN6A 5K20A 1ZRMA 2FPRA 2PLRA 4KUEA 2SKCA 2HH9A 1GPNA 3TEFA 4BRWA 1Q50A 3A25A 4CKZA 1O4WA 1T4CB 3PICA 5EYPB 4O8ZA 3KE8A 4RAQA 1V1RB 3B6EA 3EZ6A 2AH5A 4WZBE 1DIRA 4NAUA 1D9XA 2RAFA 5G0VA 3WLMA 1U9ZA 3AX6A 1O0CA 3B5EA 3GWZA 4G4SO 2HLDD 1FTWA 4GLBA 1USIA 5AK0A 3TOXA 4OLAA 3OCUA 1U63A 3RQSA 3IT1A 3D7KA 5NULA 5D5HA 3LY5A 5IDWA 1E7RA 4LZLA 2NZVG 4N9WA 4OXIA 1CX9B 2Y68A 4KR2A 1Z5UA 3PF9A 3JYLA 1G18A 3LP6A 1UAGA 1I0LA 1ULZA 1TVEA 1IXYA 2Z6QA 1AK9A 2REQA 1U8UA 5AM4A 5EPUA 5JMTA 1B26A 1XD2B 4LF4B 2OWEA 3MWEA 2QPTA 2YJNA 3LWBA 1SHJA 2ARKA 1NVVQ 4CF7A 2Q6VA 3PITA 4LDNA 3A1VA 4B6OA 2FP4A 5AQEA 5FPPA 1YR7A 4MWSA 3CLUC 3MCAA 4HGPA 5J2TB 3T8YA 3UMYA 3ZXUB 4AUNA 2FSFA 5BVHA 3MD0A 3IEKA 3AILA 2G3YA 3E1GA 4F8JA 1H3NA 3UQZA 1X1AA 2C42A 4HB3A 1GWNA 1IQPA 3AVWA 4URZR 4UVDA 5BPHA 5LLTA 1QCDA 1TT5A 3JAWA 4DR4B 3KLNA 3MXTA 4P53A 2RH5A 3NKFA 1GRQA 4Q7MB 4MWTA 2QDXA 2B0JA 3E7WA 4GOOD 3C6YA 3L7NA 4MYDA 2VDWB 4JNCA 4LDAA 2H1IA 3BGVA 1ZVKA 3G6WA 1PO7A 2J3DA 4IV8A 3UHJA 3ZGXA 4AJKA 4D4HA 4GXNA 2GESA 3AI2A 5D86A 9LDBA 2HMVA 2GM9A 4R3WA 2LGJA 1UXHA 1KERA 4NV1A 2ACKA 2JGLA 4EB0A 1DQSA 1CRWG 2PNFA 4D4JA 3GCDA 1LLQA 1GG9A 2LZ0A 2V96A 3H2IA 3MERA 1RVV1 3PSAA 1KMQA 4HF7A 4K6CA 3SD7A 4BQEA 3AFIA 4TPKA 3PGJA 1EUDA 3KKEA 4S1PA 3V8EA 3L0DA 3DE5X 2DKNA 2OV8A 3VUEA 3HVHA 4BB9A 3ZWCA 2O2JA 3BH7A 4J91A 4P22A 5DI9A 3WY9A 3DEIA 1HL3A 3ND5A 1FMLA 1NZDA 5AJVB 3H0KA 5E1MA 5A03A 4B31A 1IJFA 1M6VA 1YZQA 1SFRA 3G5AA 1CUZA 3ONNA 5CDFE 4LF5B 3THYA 4O4JF 4GBED 2OK7A 3AGPA 5DRTA 4DM3A 2CB0A 1UFVA 1XQYA 5CUQA 3FPEA 3ZHXA 1NE7A 3M81A 3OBIA 3R3VA 1P3DA 4G23A 4M1TA 4N7JA 1AJEA 4G1MB 1LTKA 4GE3A 3AHFA 4HDSA 3ZCXA 4RANA 2VDRB 3CRMA 3OKFA 2PKQO 3JWHA 3AU8A 5FIUA 2OPHA 4MAAA 1K0UA 3UXYA 2QIPA 3EDRA 2FGKA 4OXNA 3FWZA 3OQHA 1U7UA 4NFYA 1RI5A 2A1UA 2FFJA 3FFWA 4L8WB 2XZPA 2G36A 3FMOB 4MKRA 3QBTA 4XQCA 1KY5A 3SFTA 4BASA 3A9WA 1RTKA 2RHGB 1G7RA 2EX1A 3BERA 3D6HA 2YWBA 3QX9A 3QX8A 4LZZA 4B87A 1ISJA 1X1CA 4QARA 5KHAA 1QHGA 3EASA 2AFIA 3COWA 1F5SA 3SGLA 1ADYA 1TEHA 2OFFA 1HZZA 4A26A 2O1SA 4AQ7A 2AJCA 2E3JA 4HPJB 1GTL1 2HOQA 5C0OE 1EXMA 2QTCA 4D46A 1DC5A 2ZITA 1QGYA 5ALOA 3URMA 3WGKA 4DC9A 4R9VA 2X4LA 1JE0A 4YXWA 3GCXA 3NI2A 2MHCA 4CN9A 2P2NA 2LPMA 3HKBB 4IDAA 1D4FA 2QORA 1ZNXA 1R0LA 1ZQ1A 2X3UA 3UJDA 2QX6A 4R1LA 3KHTA 1JU4A 2HWKA 5EWMA 3JS5A 4HI0E 4KNVA 3TQCA 4D25A 1RZ3A 3PWTA 1GAWA 2F9MA 4PQYA 3RVRA 1FLNA 4ZPXA 3TQFA 3V46A 3R20A 2XTZA 5J59A 4PBTA 2FTKE 2QZPA 5NLLA 2R97A 5KMGA 1N75A 5ARCA 3ZU6A 1C7ZA 3OKAA 3U37A 5JYCA 2R7AA 5HS6A 1KQFA 3PVSA 2C4NA 5HF6A 2H4FA 4P86A 4MUIA 1XAJA 2YFYA 2WKPA 3IQFA 1MB0A 1HOTA 3OT1A 2OV6A 4OXXA 1TB4A 4MS1A 1J2TA 3OX3A 4IICA 3TS1A 1C9YA 3VH4A 4HZIA 3KQQA 4V2IA 3AUTA 4G01B 4PINA 4JEUA 4PG5A 2CLKB 3FOZA 1VJDA 2VZ9A 3HFRA 3Q2OA 4KH1A 1YJCA 3PJEA 3HA3A 1RU3A 1PDVA 4HN2A 1K7CA 4JA2A 1QQ5A 3F7TA 4QXOA 3ZZ0A 2PD3A 3U4QA 5MGBA 4YI3A 1YR2A 4ITUA 3ROKA 3GYBA 2GK3A 3MUFA 3RBZA 4DA6A 3Q2KA 1R4NA 1W5FA 1G59A 5BT8A 3TRFA 4HLQB 5ALSA 3DDCA 1NWHA 4RIHA 1F0NA 1UJNA 4TUYF 1C9MA 2FVXA 1OLOA 1Z07A 3HVIA 2GN8A 5KYNA 3P0EA 4XDZA 1PF7E 1DWUA 2CLMB 3AHHA 2WWTA 2DUMA 4LX0A 4MV7A 5LBIA 4CUJA 5HOQA 3ECSA 3HKCA 5CDYA 3M82A 4JL6A 4WBXC 2HNBA 4QU0A 1WUJS 1W4LA 5AVUA 4U6NA 1TAQA 1R50A 4QXMA 2JHPA 5A6SB 5IEBA 1P18A 1BFDA 1E7QA 1UJ5A 4LYEA 1NJ1A 2CMGA 4RPIA 5HG0A 1YDGA 1CETA 4IHQA 1QHFA 3HY4A 1RQGA 3MYYA 4KO3S 3T06B 1QHHA 1WOMA 1BCSB 4TKMA 5L7YA 3FN4A 1OREA 2VZ8A 4BCCA 2C04A 5JSKA 4EGJA 4HRVA 2VP0A 1J9EA 3WWPA 2EKBA 3U0BA 3HSYA 2ZWOA 4TLBA 4CKCA 2ZB3A 2YWXA 5TSDA 4P7JA 2XZDA 3K8ZA 4OYLA 4JSYA 1EUYA 4W5JA 3V3KA 4F5WA 4PY2A 2YVLA 4H7IA 2A0FA 2PUFA 1G5FA 4REQA 1U7DA 1DFIA 3HCBA 2F8SA 2HYIC 2IX9A 1A2OA 3ICCA 1BJKA 1CUHA 4C6RA 1TJPB 4QA9A 1AUVA 5F76A 1AMUA 5J5CA 5E0KB 3SBDA 4O59O 5A4DA 3UMRA 3TNLA 4CV3A 3IUJA 3MT7A 4Q7LA 3N2ZB 3R7LA 2NO0A 3MOIA 4R9RA 4F5YA 3HC7A 2GEKA 4C03A 1LV7A 1O03A 3AF5A 1HWYA 1X0VA 1ZH4A 2QW0X 4AWAA 3AMVA 4XFKA 3H2ZA 5DCWA 4BECA 4JCCA 3VO1A 1CNMA 2PQ0A 3JYHA 4G0OA 5SV2A 1ESCA 4OP1A 4P34A 4WXPA 5CK4A 4MLZA 4YHBA 2V9ZA 2FEMA 3IB6A 2ISSD 3JQAD 4I66A 3MEQA 4NECA 4PVDA 3EG5A 3HQ4O 4GZ5A 3W5VA 4IOMA 2VKTA 4MB0A 3UAVA 3EC2A 2D0IA 3T5TA 5KDDA 3O4JA 4YFYA 4XGRA 2AOTA 3ENNA 3A2NA 3EJWA 4KO2S 3HDHA 2P77A 1VSUA 3MB5A 4PZDA 2JBAA 3GFTA 2R7NA 3KKKA 3QKIA 3JAMA 3QNUA 2AI2A 3GGSA 3EUWA 3TOSA 3VRHA 3KYCB 4ZQFA 2C94A 2D7DA 2FXIA 4ZGWA 1G8MA 1KEVA 2HKIA 4MVJA 2DH6A 2HO4A 5B3AA 4AVYA 3WISA 1KIFA 3W3AA 4EG8A 3A6PC 5L45A 4QPZA 4D0SA 3PQ5A 5HEKA 4FW9A 1Q0QA 4DPKA 3NAGA 2BGKA 2ZRJA 2RMKA 1C1YA 5I9BA 2O9JA 1SC4A 1SD2A 3NGMA 4X1YA 1Z83A 2BC9A 5GPBA 4YAWA 5CX1A 1A8QA 4XDYA 5D5QA 1RM4A 2BFBA 3R7AA 4XVUA 1GUFA 2I4TA 3NYQA 3WWZA 2DECA 1BZYA 3L1UA 2ZJ2A 3RRZA 2V7PA 1CZUA 4ALKA 3R8XA 4ID9A 4OOFA 1Z25A 4KJXA 1NONA 7GPBA 2XUDA 1CE8B 2C9MA 3U7IA 3ONVA 5T4EA 2R6R1 2IBMA 1QAMA 2GDJA 1CP3A 3QPAA 3RTAA 1CUBA 2ODNA 2IW1A 4B09A 1MDBA 2DWUA 2MDTA 2NPIA 3O84A 4U7GA 4M83A 1LPNA 3X1WA 3PUKA 4KO4S 3TUJC 4BEVA 2IODA 1ZGJA 3AF1A 4R7GA 2XLCA 4FR2A 3EJ6A 1EFHA 1V39A 4JP2A 4KWHA 1PYDA 5DYTA 1W9MA 2VAMA 1NZFA 1ONOA 1AUPA 1YDMA 1KIAA 2IQ5A 5JTTA 2WWHA 1WUIS 4IDQA 4A4DA 5JXJA 3HBMA 3K1YA 5C8YF 4AZ3B 2IYXA 3OZWA 1VG0B 4RDCA 1AOXA 2P27A 3NHAA 4YRMA 2Z6UA 1CUXA 1QF7A 2FWMX 3QY9A 4MYTA 4WBNF 1M2OB 3BD7A 3L7OA 3ROZA 1UJBA 4GLLA 5HMLA 1AK1A 1KAEA 3OMLA 4KRYA 2ZJ6A 5BN4A 2QAGC 5A62A 4F04A 2UYQA 3PEVA 1WULS 4DJDC 1ZR2A 2O5EA 2OD7A 4PX5A 3O4IA 4DWWA 2ZUDA 5H82A 3D6AA 3NOQA 4EP1A 3IOEA 1DUIA 4INAA 2C78A 1CJCA 4V1CA 3CF6R 5BN3A 1MJ5A 3CH5A 3JSXA 1JLKA 1VL0A 4INPA 4FEAA 1VPTA 2QTWB 2R6FA 1YS1X 5FV4A 1E0SA 5K8VA 1G3QA 3KYBA 3K5HA 2FVYA 3EQ2A 3ZDQA 1EA5A 3MWJA 1LQUA 2EKLA 3L06A 1ZLXA 4GUAA 3KM0A 3OY7A 5KTOA 2HBRA 2XF8A 1W47A 5K4GA 5C52B 4ND4A 2G8NA 5BQOA 5T6MA 5IJ9A 2C7VA 4EHHA 4G56A 1APBA 4Z6KA 4HWTA 1CQJA 1FNSA 4QPNA 1XLVA 4L4SA 1OROA 4UOZA 4TTQA 1MIOA 1R9GA 3F97A 3IP8A 3SYNA 1UM8A 4KRXA 2IXFA 4YV7A 1KR2A 4OP3A 1QBGA 1JDPA 4RLQA 4UAGA 3T9EA 4XRGA 5BR8B 4KDFA 1M72A 1IB0A 1JYEA 1WV1A 3L7JA 4OGKA 2C7RA 3AF4A 5EL0A 1YHYA 1GL3A 1Q5PA 2JCBA 3ZDBA 1A9OA 2Q1SA 4YJHA 1VYUA 4U2EA 3C7TA 4BE4A 5LSAA 2XKJE 3SR4A 2Y0DA 1XAHA 1TGYA 3B7WA 3WP0A 1MHTA 4JB8A 2H3HA 5DBOA 2J4CA 3PDWA 2DC1A 3RRBA 1AA6A 4AO8A 4FEYA 2EC5A 1NLMA 1SBQA 1U02A 2YUIA 3AWDA 3P0JA 3PZRA 2IU3A 5EJEA 4NY1A 1EXDA 2PZLA 3FBGA 4JR0A 5AW9A 2Q7OE 4C7VA 1TIKA 3TGLA 3KJQA 3AP1A 4N82A 3SKXA 5GWXA 1W88B 3T5BA 4MRNA 1Z08A 4ER5A 4X8OA 2UZ4A 4JL8A 2ZIGA 1CKEA 2ZSJA 2DQSA 3HDQA 1IEQA 3ETNA 3UICA 2LD4A 1MEOA 1T91A 1NBAA 2GS9A 5BNZA 1ZGCA 4K5QA 5LB2A 1SUIA 2NUBA 1DWQA 1PG5A 4JZYA 1KI6B 5KNDA 2OPBA 2YXBA 5I4IA 3SFVA 1VQ1A 1JFLA 2NADA 2YHIA 3ICWA 5AKZA 3IH5A 4HP8A 4MQEA 2XITA 3A32A 2FN3A 4PO3X 1DC8A 1EH5A 3ECCA 3RVKA 1H8HA 3VGPA 5LMCA 2WWXA 2XXAA 1NC3A 3U3DA 1H5NA 1ZM3A 4G5YA 1CYDA 1VMIA 2EGHA 3B89A 3ZE1B 3WAJA 4JU8A 4K1XA 4W9RA 1P9RA 4TV8B 1CUAA 4EYSA 3E3OA 4NIMA 5HUJA 2FI1A 3COJA 4JFRA 4NYIQ 2O6HA 1KU6A 2H4HA 3CS3A 1EGVB 4ZVPA 2GHQA 1DIOB 1PT8A 1CUWA 2UYYA 2ZBDA 3LBNA 3MJSA 4PBRA 5EE1A 3SS7X 4DDHA 2DH5A 3IDOA 1DTSA 4FK8A 4FLFA 1UFQA 2G9RA 1NVXQ 2WPDD 4CLRA 5LKAA 2NP6A 1Y37A 1E8MA 4XWOA 5LDHA 1KF0A 2Q5QA 3U7RA 2W2KA 5A4MS 4G85A 2I3ZA 1QC5A 4DVJA 2DT5A 4FDVA 3MTGA 1PS8A 4GG1A 2WF8A 3SF8B 3RE1A 5KSPA 1JECA 5EP3A 4RTMA 4L22A 2XYVA 2A4MA 1Z45A 4LOAA 4HNTA 1E1CB 3LA6A 4CM5A 5F7XA 4G1CA 1SHTX 1JV2B 1QVZA 5BWNA 1H4SA 1CRPA 3K0AA 1E98A 4H9GA 3DQZA 1MX3A 1NOJA 3QE3A 4A0GA 3DZBA 4MR7A 2IK8A 3CJQA 2G5PA 3DMPA 4F8YA 3FUTA 5JXGA 2OC9A 2PS9A 2Z8ZA 3GQBA 4JV5B 3TPCA 1VPDA 4I55B 5JU6A 3ZWDA 1U8ZA 3M6XA 4PFJA 1EFVA 4BQOA 1E61A 2ISCA 3CNHA 4NMXB 3KSMA 2JZOA 3G89A 4OHYA 3EWNA 4DXDA 4CLEA 3A6LA 1P2VA 3ILYA 1UKZA 2PQ6A 2BMDA 4JWKA 5DM1A 5F77A 2ZSKA 5A5DA 2EAUA 5KNBH 1EGQA 2GJ9A 1YS9A 3IVGA 4BV9A 2HO5A 5A9RA 4NF2A 4RY8A 4EJSB 3IVMA 2HK6A 3PQCA 3CC8A 4RYLA 1BQ4A 4UULA 4LDRA 1XEFA 1PV4A 2V3VA 2BI4A 3FNIA 2D4AA 2ZR8A 1RAFA 2DP4E 3RHTA 3TIXB 2C54A 4MV8A 4QKQA 4Z4EA 2ECFA 1C0EA 1INLA 3NKVA 2A0UA 4KAAA 1QH8B 4NICA 5ARDA 3MTAA 5DM2A 3RAJA 1XNJA 3RT9A 5BQ3A 4KR6A 4ODIA 1HO3A 4EG3A 2QZJA 3AUJB 3HB4X 3HWSA 2XNKA 3SFZA 5HX7A 1CG6A 4FOTA 4X6YA 3KB8A 4WFQA 1WSDA 2JGMA 4QYTA 1XEXA 4B7UA 4K26A 4BB0A 4DQLA 3T4UA 4IDHA 3UG6A 4YV2A 1JL3A 1ZESA 1Z6YA 2R7LA 2YJGA 1O1YA 2RB4A 1NP7A 4GFDA 4LKRA 1CQIA 1H1DA 1RRVA 3NRCA 4P2GA 2AC7A 4IHAA 4AW9A 4F4IA 4ZVOA 1PKEA 1VYTA 1I6LA 2JAPA 5E9WA 5K05A 4BX3A 1KQ3A 1ZC3A 4KMRA 1XA3A 2JEYA 1GKYA 1XALA 1E2QA 3SNKA 4FFWA 1KXJA 1MW9X 3B8HA 3OE1A 5DN6A 2VUUA 1K8QA 4WINA 4BTLA 4CYMA 3SF0A 4OIMA 3WQBA 4RZ3A 1UWVA 3A10A 1KEEB 1F4LA 3FM9A 1VJCA 2YW2A 4BIMA 2LCQA 4OYHA 3M33A 2IWHA 5B64A 5JD3A 1KGDA 4JUAA 4Y3UA 4RU1A 4ALIA 2WHRA 3H17A 5KQMA 3TF5A 1JR3E 1JT2A 2C9DA 4EYEA 4KAFA 4JJ4A 2D6FA 1S3IA 4UE6A 2DCMA 1IBKB 1EZ1A 1XHEA 1L7QA 1H42A 3ML1A 3DLIA 1HTWA 5LMUB 3K70C 3FRHA 5A6VA 5ELXA 2IEIA 1RJGA 4AJLA 4FYIA 4ZJZA 3V3TA 5BSKA 3BL6A 1DKUA 1Z4KA 4PF1A 4BS9A 3ABIA 5J63A 2BONA 3R6TA 1F1BA 3C8UA 1RBMA 3DOFA 3D8UA 5EY5B 2NX2A 2WLTA 1G8YA 1TZ2A 1XTZA 3K9CA 4MA5A 1KTIA 5K0SA 3I2FA 2J9FA 4FNGA 1EK0A 4RD2A 4BRSA 1AV7A 5I7FA 1Y3HA 1JEAA 2N9UA 2ZR9A 4R40A 4XGQA 5I7AA 3K31A 4LRXA 3EIOA 4URYR 1RJ9B 4R98A 4ZVUA 1QB7A 3B48A 3GEHA 2HF7A 1FDRA 2C4MA 2RGUA 4FYKA 3N3AC 3S3TA 5LQRA 3S2GA 4NX2A 4IWYA 1TAUA 5JFTA 5JNVA 1EG7A 1K5DA 3ZTTA 2G4VA 1YZFA 3P5SA 1M2FA 1KSGA 4F6LA 5EG5A 2G1PA 1KI9A 1N0UA 4U2DA 5ILQA 3L79A 1J0CA 4IZHA 1EHIA 2ET6A 3ZCSA 3RIXA 3HPQA 5F1KA 2XUZA 3ZWNA 5IVDA 1AGNA 1WXFA 4UVHA 4JP8A 1L5HB 1TMOA 5SZJA 3WB0A 5U9CA 1O3YA 2R4TA 1DXOA 4DV4B 1GPMA 2JFHA 5EP1A 1XYYA 4JLWA 2YIMA 1W581 1ODCA 3AEYA 3FUWA 3ORYA 3PC8A 2DBVO 2PLFA 4FFDA 2HY7A 4EZEA 2WF9A 4MZXA 1YH3A 1XZCA 2IUYA 4MDHA 3M6VA 2HIAA 5IYZF 2YWFA 2DKOA 5MN5A 2EYUA 3GOQA 4PO1A 2A5LA 3IAFA 3MJTA 6ADHA 3SSMA 3PEFA 1IQRA 3T7DA 3D4IA 3C8DA 2Y1LA 4KRGA 1DELA 2I3BA 3L2OB 4JEHA 4CPDA 3H11B 3PQEA 2JGKA 1WMSA 4HB0A 5HQJA 2WA2A 5THXA 2KMLA 3MRSA 1W5EA 3EVTA 2AXPA 1DC7A 2WTXA 4QDKA 5HDQA 3RCBA 4QJIA 5DNYB 1TRHA 2VHEA 4IJUA 4C76A 1HDZA 2H16A 5AI9A 5LCXA 2AE2A 4KV7A 3Q0TA 1TLFA 1FEZA 2PV7A 4Z0PA 3RBXA 3UK2A 3JCZA 1M5TA 2HA3A 1EBUA 5KWEA 1J2JA 1N5OX 4U7PB 2C61A 2Y76A 4ZVNA 5FI1B 3DEJA 3V6LA 4TLEA 3TLCA 2HI0A 1FRNA 1SR8A 2IYWA 2OMKA 2CL5A 4X54A 2JKYA 1Z35A 2C59A 3SVTA 4GF5A 4QATA 4W1QA 3C4QA 3ISVA 1GU1A 3M8KA 2CEKA 3OUTA 1VYHA 1I4OA 4DRZA 1VLZA 3UB4A 1VA5A 3F67A 4UUBA 5C8YB 5I9NA 1U9IC 5T8KA 1PJZA 3SIPA 1QFZA 5EZYA 3STTA 2ZAGA 4NPHA 1DAGA 1S7GA 2JATA 1CR1A 4DR2B 1CIJA 2I5PO 3FPFA 4YMSA 4W5NA 5F35A 5THQA 2IHVA 3UWDA 3W5HA 5EWLA 5C8DA 3D2CA 4ED9A 3G1UA 3TZQA 8AT1A 3ENVA 4DY6A 2VHWA 3FPLA 2A9KA 2VR1A 3IILA 4MUAA 1NSTA 3NBQA 5EIBC 2C2BA 3ZE7A 3O6VA 2FUEA 3GEMA 3NWEA 1I33A 4QRHA 1KARA 1TZKA 2PBLA 1W19A 4H4DA 5LA6B 1YE5A 3EBLA 3PNPA 3KELA 1V16B 2VNKA 1NLZA 4NYJR 3QYFA 1C7IA 2XEXA 5F1PA 2C4KA 2QZ4A 1PEAA 4C43A 1LBHA 4Q16A 1N2JA 2QA5A 3U6KA 2NV2B 1DIGA 3K1TA 5FOWA 2R25B 3IEMA 3ZIDA 3E9ZA 4OBEA 4ASUD 1RP7A 1Z36A 3ZU5A 5FBVB 4C4YA 3HXKA 3B51X 1K7EB 5C32A 1MXFA 1JEQB 4OB8A 3R0XA 1KSJA 1MPTA 5DXFA 3WJ7A 5JAUA 2XMBA 4JXZA 2ZS8A 3QV2A 2FFAA 1ILWA 4MGYR 1NI4B 3GLKA 3ZEAA 2OGSA 1W96A 5B1HA 2V9PA 1CERA 2YS6A 3I72A 1YUBA 1ZVQA 2JKVA 4M2LA 1JBEA 1V8PA 2PUJA 5EN4A 4Y7DA 3NCHA 3N2GB 5ALGA 2C3UA 4HWRA 1W34A 2IU4A 2GF0A 3TLZA 1HC7A 4GPIB 5C1OA 2ZYTX 1PBTA 1YOVB 3JTMA 1SH7A 1KDTA 3VR0A 4CEJA 4KIGA 4Q1BA 4XLTA 4TS3A 2VRWA 3E7DA 1MRNA 4NU0A 3A9VA 4HGZA 2ES4A 1OXMA 2VF5X 3CZRA 5ALJA 3ZKWA 1HDOA 1JXOA 1YBFA 1ZL2A 2W2OA 2Y2UA 3NBZC 1TADA 5T3YA 3BWYA 2O4CA 2BR4A 2QW8A 1XYVA 2EW8A 3GP8A 2A1IA 2F4VB 1ACJA 1AHIA 1M7BA 2BH9A 2QXUA 3PUXA 4L76A 1RACA 4LGVA 1PSZA 3F6YA 3PD7A 4UM9D 3W04A 1BOOA 1CRQA 3B1ZA 1TYEB 1TKBA 4GM0A 3V4FA 2G9UA 4B34A 3AHCA 1ZYUA 3H99A 4IJWA 1Z2EA 1OU0A 1A4UA 2MR5A 1N7JA 2QXYA 3EPJA 4F7WA 4OJMX 1SG9A 4Q4AA 3OU6A 4LI3X 3NW9A 2P9TA 1Q92A 4H7DA 4UM8B 1N4AA 4RFSB 2WFMA 2ZI3A 2WOJA 4B4UA 3D2AA 5EJFA 2JEZA 1MG5A 1OIWA 1U5BA 4MUNA 5DIZA 2BIFA 1P19A 1ZNYA 3PDIA 3AFHA 3UT0A 2OUKA 4Z4GA 1YRQA 2VHXA 3NYWA 5JVDA 3I2IA 3V1MA 4BKUA 4YP6A 2Y0BA 3HS3A 4BVBA 4B3TB 5UKDA 3EHDA 5BMOA 2OBLA 4I6GA 5G41A 4Q4HB 1F3OA 1T6XA 5C9ZA 3H5AA 5M5BA 1VPVA 3C3PA 2C57A 1XOIA 2PY6A 5TY0A 3BWDD 2PKQP 3WGQA 5KTSA 1KY2A 1Y81A 3I9FA 1P60A 1EWTA 1S4QA 2UZIR 4TTRA 4CF4A 2CF5A 3M6UA 3SC2A 1MRZA 2NAFA 2ZSIA 1AGPA 3IAXA 4YRPA 4V24A 2J0UB 4CQLB 2WB4A 2Q8QA 1PK7A 1LH0A 1X80A 4EA8A 4ND6A 1LBEA 2P4QA 4JJ6A 3MCTA 4PFSA 4QFBA 1QP8A 1HH4A 1ZMTA 2HA7A 2POQX 4PN7A 4DRXA 3PJFA 1USWA 3I6ZA 3BJMA 3H65A 1QFSA 3EUAA 2EFCB 2J7PD 5EEHA 4EHIA 3RV3A 4D4GA 5KJFA 1UC5B 4X85A 2GETA 2BMFA 3OPMA 3ZC3A 4UAVA 2V8BA 2X77A 3RI3A 5K8TA 1XMSA 4LYFA 5TGTA 1DV2A 1K5PA 3R1IA 3KXIA 4PGMA 4A0RA 1Z0UA 3WJ1A 4NPCA 1A27A 1CQPA 1EM8A 1WSAA 3NEPX 3X1DA 3I39X 1LC0A 3P2KA 1F9EA 3MGKA 4IOKA 1TM7E 3M3HA 3AXSA 4GHWA 3MWDA 1PLJA 3VAAA 4BO3A 1JQKA 4JXXA 2VWGA 3IKJA 1ZGAA 3TLGA 1L5WA 4OQDA 1NYQA 1CJKC 2O3TA 1K86A 5G0UA 1UIMA 3QOYA 4JBHA 1H66A 1NRWA 1K6JA 1YRLA 2R8RA 1U1IA 1X7DA 1EE9A 3BCUA 3DMFA 5EZQA 5JDCC 3ZOKA 2CVFA 1IIRA 2YN0A 1NE2A 1RRMA 1S2LA 3NKLA 4LJLA 3J81A 4KL8S 3IAM6 2FPXA 2ABWA 1JFFB 3FIJA 3Q6NA 2DQ4A 4JNKA 5TE9A 4B3IA 3FOEC 4Z4FA 1Q6ZA 1BRMA 4ALMA 3GLGB 4RXTA 1YB6A 4ITRC 3JV7A 1UQUA 5EXXA 4CMHA 2X8BA 5IXJA 3WL7A 1F3LA 3UWKA 3N0TA 5D8DA 5CB0A 4OKIA 5BWBA 2O06A 1WZ2A 1KYTA 2OHHA 5CW1A 1ZH2A 5JD6A 1XDSA 2BMJA 1E4VA 1UBGA 5FP0A 9ABPA 2VDPB 1X1SA 4MV1A 3OEYA 3PB3A 3D81A 3K0FB 4Q34A 3V9AA 5TIIA 2QTZA 3WTBA 4GX2A 4UPEA 1B3BA 1C50A 1TTHA 2NU6B 2VXCA 3E81A 4EBFA 2XYPA 4H6WA 4MNTA 2R1ZA 1LBSA 3C1TA 3L8YA 1RWVA 3BULA 4G8BA 4LTMA 4O33A 1NYTA 3UJNA 2CY0A 1L7EA 2WHPA 4PO9A 4WNAA 2H31A 5E8RA 1NU6A 1AUQA 5DHRA 4UNNA 2GRAA 2WQZA 1ZUNA 1SCJA 4E22A 1EFRD 4J4BA 4CIVA 3C14C 1MX1A 1VM6A 2FR8C 2C4UA 3D6NB 3KOUA 2WIAA 3VZDA 4B6FA 2ZEJA 2VDJA 2ZI5A 2ZS7A 1GGFA 1A7JA 4UNSA 4E2XA 2J5RA 4FR0A 3FTQA 3RC3A 4GBMA 1WA5A 3I32A 3ZDEA 4C7MA 3UUEA 2JLWA 2DB3A 4YV1A 1MX9A 2QRPA 4BZPA 2QPOA 3JD0A 2LIVA 3IHTA 3IPYA 4D4MA 2JIDA 1E3QA 2LIPA 2OORC 5HZKA 4BKRA 4F86A 1XDDA 1QIMA 3RS4A 2EW2A 4NESA 4EUFA 2D5IA 2CJPA 1Y9DA 4IVRA 2ZBGA 4EW6A 2CWWA 4EI7A 1FX1A 3AG6A 3O4GA 3EXFA 2QWXA 2P6MA 4YLEA 2E2WA 1UL1X 3BHMA 2Y6UA 3Q3GE 2QKYA 1V7CA 3MIZA 3NYIA 4LQ4A 4DRYA 2JLBA 2EL7A 2Q2WA 2ZGVA 2ZUCA 4FGKA 5HZHA 2H7XA 2QM0A 2PZAA 3TI9A 2GN2A 1Q2XA 3I9LA 1NF8A 3WXMA 5AW4A 4TM8A 5H68A 1E1DA 4BUCA 3FDIA 5AESA 3GI1A 2RI6A 4MHTA 1UM9B 1H22A 2IIQA 3F3SA 3HU2A 2WILA 2H11A 3FLBA 4OK3A 2YL2A 4RZUA 3UCEA 4YDQA 1V9LA 3MS7A 4XGIA 4BYGA 3S99A 4E51A 4FHGA 1QLJA 1Y6JA 1ULBA 2H9AA 2O07A 4MYCA 3R5KA 4TS4A 4M38A 4CTMA 4F5EA 2DF8A 1VYVA 3WIOA 2ZI7A 4M9ZA 5TVKA 3IAUA 4YMIA 3HWRA 3QKSA 3ZX4A 4I46A 2ZIEA 3AVOA 3M49A 2QBYB 2J9ZB 4MVJF 1NDUA 2XTMA 3HCEA 3OIVA 4POAA 2F43B 4M8NE 3EEBA 1YIOA 1DE0A 2EFDB 4MROA 4CJXA 1Y8RA 4FVTA 1E3TA 1E4EA 4TTJA 4DMLA 2QMYA 5F4ZA 3FVRA 3RVBA 3KL2A 3OUUA 5AVZA 1Y3DE 4BNUA 2HN9A 1H0SA 3DAYA 4O4LB 1TZMA 4J7AA 4KP7A 3NGLA 5B6PA 5A0FA 2FMTA 4WLEA 4OKSA 3GCZA 3U44A 1AQ6A 2ADOA 3R5XA 2YZGA 1DFGA 5HKOA 3FUCA 4JQSA 3CIOA 4ZCTA 1PGQA 1ZN7A 1K9SA 3EFOA 1OV4A 1IHUA 1XGKA 1NVGA 1C3EA 2V7WA 3F9CA 3PQ6A 2NM0A 3SHVA 3KEGA 4CL0A 1MD9A 1QMGA 3RU2A 1L8OA 4NFLA 1IOLA 1ZJJA 5CT8A 3X0DA 1Z9BA 1MAHA 1GA1A 2Z83A 3AV0B 3DCYA 4F46A 4C0XA 1JHYA 4NFSA 3CRNA 5LXTA 4DYVA 1SXQA 1ZCJA 1XRRA 2XT0A 1B8VA 4XWYA 1IBRA 1NBEA 1NJFA 2X5OA 3DMRA 3EC7A 5COAA 4P7KA 3WLHA 4QT4A 1MT3A 1IY0A 2DKFA 1U28A 1L7MA 2IEDA 3PNMA 4I1OA 5AKEA 3BGOS 2BKEA 2Z3WA 3FUVA 1GN8A 1KRWA 4MGHA 2IUUA 4IRXA 5B57C 2GO1A 4AROA 1SOWA 4RMGA 3G2NA 4AMVA 4B2LA 1Q0UA 4DDUA 1VB5A 1R0BA 3RWMB 2IF2A 2REQB 3TXAA 3O8CA 4MEAA 3B13B 1G8GA 1MTZA 5LYJB 2BISA 2YIDA 4NNJA 2Q9CA 3RM3A 2F67A 3HKEA 2CFOA 1D3AA 4FSDA 3DOOA 5DNAA 4B80A 2CNWA 3K20A 1I30A 4YUWA 4HEA1 2NUTB 4NNOA 3HR7A 5JG7A 2XMSA 2PUHA 3MSCA 3E3AA 4F4FA 1BQEA 2EERA 3TCXB 3QU7A 3GMTA 1ZW6A 3UMFA 4LFCB 2X5KO 1BE0A 3JYPA 4J1TA 4AN0A 3PRHA 4FGSA 1VI6A 4PGHA 1W35A 4ZHSA 3WWCA 2RIPA 1TT5B 2G1KA 5EIEA 3SKYA 3KSAC 3UAWA 2V7VA 4MINA 1RPTA 2PLAA 5AHXA 3S7ZA 4ZRDA 3T1VA 2P6NA 3NHZA 4L4RA 4LYJA 4YK7A 1RQNA 3I1JA 1WQ1R 3B1KA 4WBSA 2R11A 5F2NA 4HADA 3IQZA 2QSJA 4F3RA 4L57A 3EGDA 3UT5B 3H0EA 3O1LA 4L0QA 1M1YE 2CK3D 1N2CA 1TUIA 1U80A 4FBLA 2NYUA 3ZDXB 4WXYB 4MUGA 4WKBA 5IW8A 3UBTA 3P27A 1DKOA 3U48A 1EUDB 1V2HE 3DL4A 1VRCA 1OBCA 4II7A 5ABPA 1BFKA 2V6JA 1U0EA 3JU3A 2LWIA 4LCEA 3EAFA 4BWYA 4MVJH 4CDMA 3GVHA 3OCXA 4DQKA 4IWXA 3W3AH 2AD5A 4XH9B 2X4DA 1U4OA 1U8CB 2CLHB 2NUAA 2QRQA 4FYXA 3VH2A 4DLAA 1M6VB 5JJIA 1WDKA 3WIBA 1L5VA 2R5NA 4BVEA 1L4HA 4L85A 1CNFA 1PWZA 2HAEA 5D7BA 5FL7D 3KU1A 3WGLA 1TIBA 4J16A 4KO8A 3BWCA 3C7CB 2CMKA 4LWPA 2ZWAA 3S6JA 5CFPA 3LBAA 3MVEA 4CMBA 4HQNA 4HDSB 3DC2A 3TCNA 5CFMA 4ISBA 4ZMRA 1X14A 2A9JA 4WCFC 3UAGA 1BH6A 4GRDA 2IBTA 3OOJA 3WLFA 3W8DA 1FMJA 3KUUA 1DOAA 2A1UB 5T67A 1AK2A 3HGQA 1P0CA 2GPTA 3CF2A 4IKOA 1SUDA 1UP4A 5FWYB 5IFLA 4KHPB 1FXWA 1C3LA 1D0VA 1SB9A 1M7HA 1ZJ4A 2J87A 3JQCA 2Z4TA 5H02A 5CDUA 2BY4A 3LG2A 3RK1A 3HGMA 3L8DA 2YDYA 3GOHA 3IEPA 5FAKA 2VYNA 4D79A 1PYOA 2D1RA 1EFAA 3DFIA 1LW7A 4D3XA 4DGSA 4KTTE 3SEAA 3ANSA 2C1ZA 4GQBA 1IY8A 4CFSA 1T5IA 2V4ZA 2WU3A 2Y77A 1K89A 3BMCB 1RABA 1XJ0A 3KVYA 5CR9A 3LV8A 2X1MA 4KJZA 1JQBA 4M0CA 5KS2A 4QXRA 4CQMA 2H4XA 2RGXA 4KWTA 1UAYA 1HDYA 1NLUA 3M1YA 3MTJA 2O5VA 4MVYA 4NZPA 5CLIA 3ZWQA 4BZWA 5T7BA 3ASZA 3K16A 2HIGA 2HA0A 2QNIA 5CD1A 4D74A 2HCBA 1C4WA 3GBSA 4EB6A 1ZXLA 2PTGA 2XVYA 1CK4A 1R88A 4L15A 5EQTA 2ZIVB 3FGPA 3FGZA 1ZONA 2OZEA 2GOYA 3LK7A 4HX2A 2GTHA 1IWBB 1ZISA 2DUNA 4N4AA 3EVFA 2UZ1A 1ECBA 2O2XA 3KTOA 3PWZA 4LRUA 5CVDA 3WIEA 2CHVA 4B4OA 2GARA 2WWRA 3FOBA 1J7JA 3BTOA 2Q4TA 3MWYW 1JQ5A 2WJJA 1VL5A 4Y6LA 2DR3A 1JEYA 1Z74A 5FEMA 4YHHB 4E6PA 1UIRA 3GJRA 3I0NA 4LV5B 2YCBA 3WMFA 4HAVA 4A1FA 1UBLS 1HT1E 1RCUA 1S3FA 4Y1RB 4X41A 3WAKA 4QAQA 4PR0A 1I2MA 1XCBA 1ZNZA 1GPDG 2GCOA 1TUBA 1G16A 3H04A 4NR0A 1WP9A 3KVVA 1NULA 3D4LA 4MS1B 2GAAA 3HV2A 4G63A 1F38A 3E8XA 1QKKA 2QLBA 3OIGA 4FHFA 4F9FA 1XXLA 3CB2A 5J58A 4I4NA 1KFKB 1R4MA 3D1JA 5AVJA 1KWGA 1W49A 3N8NA 4NYJQ 2QP4A 3EEYA 1BKDR 3AL3A 3BORA 1Q1AA 2P6OA 5EGNA 2YNMA 2VNAA 1BX1A 2NO6A 3ORQA 3IIMA 3VTZA 1KZ4A 7MDHA 3I53A 3G79A 4CMGA 3S68A 5CEEA 4BZXA 1SJ9A 2F1RA 1AM4D 4M9UA 4ITVA 2QJWA 1C80A 1B15A 3OTWA 4RCVA 2JFWA 3V5NA 1TEVA 2BBSA 2VAWA 5DXJA 2IBSA 3C5EA 2ATVA 3FDJA 1WMBA 2Q3BA 3NG1A 3R0IA 4LZWA 5IANA 4QQNA 1NW6A 3FETA 3DG9A 3DO5A 3W2HA 1MIHA 1I1QB 2EP5A 2ZZKA 1PJLA 3HKCB 3ITKA 3T5GA 2FR1A 3EB9A 3JQFC 4L5BA 4CV1A 2FSVA 5HZGA 5K3CA 1SBIA 1NW5A 1V8BA 1GTRA 1GP2A 3AHEA 1QWSA 1ID1A 1ATZA 3M1IA 3ENZA 3EULA 1AKRA 1R8XA 3L7YA 3TQHA 3WRXC 4OMFG 3DWEX 2JIOA 1NJ6A 2WSLA 1R3UA 5AVSA 1KI2A 4L4ZA 4MV6A 1BVHA 3RADC 2PRZA 4GSYA 4IDPA 3IR6A 3SDZA 5FPYA 3SICE 1LUAA 1N6OA 4J7CA 2ZUSA 4X63A 2YMMA 5CJPA 2GBPA 1RHUA 1T9AA 1XJCA 5CFLA 2HSGA 5DBFA 4O8CA 3AUUA 1JDNA 2UYOA 3H9QA 5EXPA 1Q1QA 1FVHA 1IN7A 1E59A 2B20A 1DIAA 4IM7A 3T12A 4UAJA 5JZMA 3QYJA 4PHHA 3L8GA 3GIWA 5MDHA 2YY5A 4XGNA 5EHZA 1T9KA 3NZEA 2OECA 1GAXA 3LHDA 3PEEA 4TSKA 3BB4A 1NWCA 4B85A 3EIXA 4PCVA 1O96A 2VBGA 4L0CA 4YAGA 3VR5D 2XT6A 3RFVA 2O23A 4P6VF 2GAIA 3B1FA 3F7MA 5J1TB 3IP5A 4FDUA 1WHSB 4DMUB 1S2MA 2P1RA 5BSGA 4X95A 3THOA 2NT4A 2ZWIA 5GQSA 2HCTA 3VSBA 2VDQB 4N6NA 1PBNA 1KAGA 1XA0A 4IINA 1RMQA 1ZK2A 1BG6A 1UKEA 2EIXA 1PP4A 4ZT6A 3OTOB 4U39A 3GCGA 5IAEA 1QR6A 2WG1A 4OL9A 1K06A 1FJGB 4DW8A 2ILVA 4EZBA 4D8YA 3G9UA 1E6UA 3N0VA 1SXHA 2X86A 2RBKA 3AB7A 2QW1A 1N7GA 2HFKA 5A7HA 1JTFA 3U4IA 2W6CX 3PT5A 5ESRA 3TTSA 3VZCA 4LJ5A 1EWRA 1Q0HA 1LK5A 5KAMA 1NTOA 1TAGA 2ACWA 1DQZA 2CCGA 3PFHA 2VJCA 4OK6A 1CR0A 3IMEA 4FSHA 4GVLA 5CXUA 5EXSA 2HX1A 1ILEA 4BO1A 2JB9A 2E49A 5BRJA 1PGJA 3D7MA 2HEIA 3C3XA 3GD5A 1N0IA 5B7PA 1FDWA 2KWIA 1DBSA 4XTRA 3PC3A 2GGSA 1W1IA 2IHZA 1ZNQO 2A9PA 4EA6A 4LJAA 4EF6A 3O90A 1JG4A 4JJGA 3JZDA 4RSRA 1Z38A 4X1YB 2IT1A 1W73A 2ZT5A 4IHJA 4ZAFA 1E1NA 2BL4A 4B3HA 5LUAA 3ZHVA 2WJ6A 2ZJZA 2YWGA 1JYSA 2JJ2D 5DNWA 3SE0A 3FROA 2Q1XA 1YRWA 4GECA 4NHEA 2Q7XA 1F6DA 4TRJA 1XXHA 2WT9A 3P9QA 4O1MA 3NXSA 4TQAA 5BMVB 2FUG6 1Y4SA 5JDIC 2D5BA 1U1DA 1XVTA 4M9SA 4Z1OA 4RA9A 4BNNA 4FCWA 4JVMA 4R1MA 1VZ3A 2PUBA 3GVPA 3IOCA 2XR1A 3HRKA 2PZKA 1K88A 2HSZA 3BAZA 3PWKA 5CPBA 3LT0A 4C5BA 4FDLA 3ODGA 5B2EA 4M8IA 5K6AA 1ESZA 2FZLA 3H05A 2AHRA 1WLYA 3AONB 1P9OA 3IV7A 1JDBC 1GPJA 1OFGA 4JGIA 4JC4A 1BXZA 2BFNA 2CLOB 1J5PA 2VP6A 1UQRA 3E48A 3LX6A 5FBZA 1SVWA 4P0QB 2O8EA 2A0WA 3KVRA 4NEHB 4Y8VA 5DEIA 2GXAA 5EZYF 5T64A 1O87A 3NATA 1KYIA 3LKVA 4D8TA 1F2DA 3PIRA 2O54A 3EQ9A 3W05A 2FZGA 5JJCA 2H4ZA 3TPZA 4UOQA 3ZHYA 1UJ6A 4B79A 2B99A 5BN4B 3AIIA 1NJSA 4JT2A 3FZEA 1E5VA 2TRSB 4ENTA 4RJTA 1G63A 2BELA 5F7OA 3QENA 1SURA 3UXEA 4E11A 1O4VA 1USKA 3L0IB 4NNPA 4KYUA 3MCUA 1ZI9A 4U7TB 3NCTA 4WFJA 4X1IA 2PKWA 4IUCS 4KMMA 2CGEA 4ZYWA 4V1CB 4TQ9A 3AKZA 5BN3B 2XQIA 3KIPA 3HLYA 2AFIE 4U3JA 3HUUA 3CUEF 3PUJA 3OPQA 3WA7A 4B3GA 2JASA 1J49A 1VJ5A 2HMUA 2J09A 3WICA 1KC1A 1M75A 2OGWA 5KOIA 4NCAA 1MABA 1C41A 4JR2A 5IK2D 1OTHA 3CUYA 3ETEA 4DIMA 3STVA 1DDGA 1JLMA 1XCPA 1PFWA 3DJFA 1V11B 3RKRA 1ZIPA 3O0DA 3QUQA 4LCBA 3ADBA 2NYAA 4H0CA 3T34A 4AY4A 5A4JA 1QCCA 5TVGA 2A4KA 4E5VA 4ESOA 1XZLA 3HXPA 4NC9A 5LOVA 2PUTA 1XN1A 2G17A 2VZLA 4K05A 3FPBA 4M0UA 2KI5A 5BWCA 1ZWKA 7REQA 1CSEE 2ZLBA 4NG4A 5U4XA 2VOJA 2M6KA 1W2HA 4R1PA 2D1SA 5JNUA 2E85A 2A9FA 2OO5A 1DOHA 2CJXA 4ZDJA 3VPGA 3WKBA 5C4MA 2ISQA 4UZFA 5HQTA 3FW1A 2ECQA 1P62B 4JLNA 4B8ZA 4LCJA 4TKVA 1M8PA 2J6HA 1VMDA 2Z9DA 3U5ZB 4F4JA 3NHMA 5LQMA 1KZ6A 1TECE 2YOFA 4AG5A 2WHQA 3OO1A 2H51A 3H8WA 3PI6A 1KH3A 4D3FA 5A5GA 2PD6A 4FI3C 3NYRA 3QVGB 1CIPA 4HH0A 2AFHA 4KEAA 3WL4A 1QYWA 4CM7A 3LW7A 1XD8A 5CCEA 4HMPA 3F5FA 1OYOA 3W7VA 2VJAA 3TJZA 3K05A 4ISCA 1B0AA 1E2LA 3P9PA 3SZUA 3S5JA 3WNDA 2WWFA 4URUR 4RVDA 2Z8XA 3S81A 1XRJA 2W48A 1KO5A 5KOHA 1PEYA 3BGSA 5E6RB 4CL2A 2CC2A 4MPJA 3REQA 2BI8A 3H84A 2ZZNA 3CA8A 4MQEB 1XX6A 2IEAA 3DVAA 3MMXA 4S1WA 3BWBA 1D4AA 3PBKA 4XWGA 1I36A 5D00A 5P21A 3IEUA 1T1JA 1DJMA 2PRIA 4FKBA 4MVCA 5EKSA 3PQDA 2WY2D 5B3JC 4US1R 1J22A 3ZTYA 3UJBA 2ZCVA 1UZLA 3OPYA 1M8GA 1W52X 1CV2A 1H2BA 1M2GA 2CMHA 3B6JA 3RU3A 5B4UA 1BIFA 5A9TA 5DKFA 1P1FA 1Z6AA 2OXFA 4CNBA 3DBVO 2K87A 2PS0A 2CW5A 3EFBA 4M4SA 4WOPA 5E0OA 5JVDF 3B6KA 3E3MA 1WXHA 3D3KA 4PLWA 3SC4A 1M8KA 2VDMB 2WI8A 3BWVA 4KYIB 4CLRB 1F8FA 5DM70 1G5PA 2W00A 2QD5A 4DBZA 4NJMA 4OSPA 2MSLA 1DX9A 2QAIA 4MQMA 4H7KA 1JLRA 4YONB 2NU8A 3HVJA 2O3RA 2WYIA 3ETLA 4OQNA 1GGVA 5TF0A 1K4KA 1T3GA 4WVFA 3VC1A 4A2QA 1UAAA 1NJGA 1GCAA 3GC6A 5IAKA 4NDNE 5SZKB 1Y6RA 4MS3A 2AN9A 3QLUC 2FQ1A 3UB2A 5A7FA 1PGNA 4HNAB 2ZAMA 5KKCA 4ECAA 1VG8A 2SCUA 3A4YA 4PIVA 5J4HA 4EA7A 1RXCA 1MB9A 2JLYA 2W2VA 4TT8A 2PYZA 3SYRA 3UV6A 4YUXA 2QMOA 1LPBB 2R8XA 3C3DA 2GYUA 4L3OA 4ZQIA 2IS4A 4IRMA 4AI6A 2BHLA 4JLPA 4XUGB 4EZIA 2CDBA 1W8DA 3EDQA 4D5EA 1UZMA 2J0QA 2F59A 1RYDA 1YMUA 3QUCA 2QL6A 4N5DA 1YXMA 4DJJA 2XSZD 1K3FA 3DT8A 1EFVB 1MO4A 4IUBS 3T7RA 4DXHA 5AVRA 3WOVA 3ZCTA 3N6XA 1Z6TA 4U4AA 4RTLA 1G3RA 1AU9A 4LMAA 2WKQA 5T57A 3DAFA 2XXBA 1GQRA 3J7AC 2ZR0A 2N3ZA 2JARA 1YASA 1JSLA 1PR6A 1PTJC 4UDNA 5E4TA 5F2KA 3WB1A 2BGWA 1U9JA 3VH1A 1DKPA 2B1RA 2EEZA 2PWPA 2BKVA 5HZMA 1NJ2A 2WT8A 1TF5A 3GD7A 1MOZA 2FFQA 3HRHA 2G0NA 4QPCA 4Q4JB 5JSUA 4BPBA 3KKNA 2RGBA 4WY8A 1N6PA 1PTKA 2Q6OA 3AB3A 5AVKA 1W85B 1USVA 5AJUA 2OM6A 2WJZB 3IMCA 2FF7A 1BX3A 4DKXA 2OG2A 2P11A 1K92A 4EO7A 5JV5A 4QBKA 3F9IA 4P7FA 3I05A 4UM5A 4WVLA 2WICA 3TLYA 3B9RA 2VDVE 3JQ9A 3PP8A 3Q9SA 1DEHA 3JR3A 4HK4A 4QUHA 2C3OA 4WOKA 3EGVA 4L5JA 4F71A 2FG6C 4GGOA 2RH4A 1FJ2A 1XEXB 1RRFA 3F78A 1ZWLA 2CYBA 3INGA 1KORA 3OJCA 4MVJE 5H0IA 5FYQA 1R9NA 2ZZMA 2OBXA 1MORA 4LWQA 4JLUA 5JYDA 5EIAA 1CUSA 3KS9A 4V0KA 1T9HA 3IULA 3V7UA 1U2QA 3MK31 3H8VA 2PL3A 5CMLA 5DMHA 4BUJA 1YDWA 3RYFA 3HPRA 2I1WA 4G9GA 4AG3A 3AHJA 4HWOA 3WSTA 3U61B 3G8DA 1PFQA 2JI6A 4I3FA 2VEOA 5DNDA 2VUSA 3A6KA 4WXRA 3CQ9A 1FFAA 2VXOA 5AJWA 5KU7A 2QJRA 3AL2A 4FFLA 5DSZA 5ENDA 3PNKA 4QEZA 1SKUA 4G1BA 3WKEA 5JIBA 9GPBA 2CL7X 3RIGA 3VJMA 1IOZA 3LO5A 1IJBA 3KLOA 4BQFA 2O2CA 1SIBE 1JR4A 4R7TA 3PQ4A 2WC1A 4G65A 4V0RA 4G8CA 1IXSB 4LXYA 3KSDO 4BTVA 2LRHA 3AW8A 5KYUB 1LSUA 1EX1A 4J90A 1F48A 4CCAA 2XJ9A 5M7EA 4W63A 3EPLA 2DQYA 4QGFA 4YCLA 1ECJA 4LA4A 4FJ0A 1AO3A 1HE3A 4XLLA 4EI9A 1PQYA 2R8PA 3C3WA 4H35A 1EJ2A 5AW0A 3B1WA 3EZ7A 2ZW9A 4F4HA 5BPFA 1NMQA 1Y1LA 1ZINA 4YJ2F 2QXTA 4DT1A 3D4NA 3CX8A 3CZAA 2ZUTA 1NDHA 1OWNA 3BG5A 4IDFA 1H4VB 3S1AA 1ND5A 3C3CA 4L2IA 4B4VA 4BFVA 4DBLC 3GEBA 1QZUA 3ZHRA 2GF9A 1U3DA 5E6SB 5HWSA 2X6QA 4QVGA 1OH7A 1QV9A 1LTHR 4IG4A 1F0PA 1YBAA 2IZZA 4UBMA 2B98A 1B0ZA 3IXMA 2XTNA 4RO0A 2FZWA 3LWDA 4KQ9A 3U7GA 3CX4A 2MIIA 1I4LD 1EVKA 2P2YA 1LDMA 4JJFA 5FB3A 3WXBA 2DTDA 4WECA 5IARA 4D4LA 2IWRA 1SHLA 4CKXA 4WXHA 4JJIA 2JIRA 5DYGA 4L8LA 3E2PA 4C21A 1T8WA 5ALTA 4IQFA 3X1KA 5HQ3B 1SCUA 1VE5A 4V1CI 3K0SA 1EFKA 3O8DA 1QOQB 4PRZA 1EZZA 1Y5MA 3ZVLA 3B1VA 4B7CA 5MHTA 3D5EA 3NX4A 1YTLA 2JAUA 3K0CC 2HLDA 4LXXA 5SYAA 3ISJA 3L8EA 4R2IA 1DQNA 4HATA 4RK7A 5AMXA 3EEIA 3N2IA 1SXJA 2H2IA 3AIMA 2BBOA 1J99A 1IQUA 1IATA 2D1FA 1BYIA 2XF2A 2XQGA 3BD6A 3MJCA 1CHNA 3AFMA 4NP6A 3WMWA 4FLMA 4RVOA 1NQWA 3WL5A 1F17A 2VSXA 3UMMA 2OCBA 2ZRDA 3ZY4A 3ER8A 1J5XA 3A6DA 3TD2A 2BZSA 1S9DA 2IEZA 1NF9A 2YW9A 2QNBA 3O3OB 4GYJA 3UHOA 1AS2A 1XZHA 3WOHA 3LF1A 2IHBA 5DF1A 2AR0A 1HOXA 4GLJA 4AJHA 2OZPA 1XMQB 3K9BA 3ZX5A 4UD2A 5BRNA 5MFZA 5KKNB 2FSPA 1BHSA 3TBKA 2HT1A 5EKXA 2I4IA 2AI1A 2I2AA 3WNCA 3NMUF 3PHCA 3BUSA 3E9DA 3ZH9B 3IKTA 5GM1A 2V0CA 1COWD 1E1LA 5B7GA 1ISSA 3H87A 1CFJA 1CEEA 2RGRA 1Y42X 4X93A 5B3LA 4OHUA 4BLQA 3OT4A 4CIDA 5AI4A 1JIQA 2EEPA 4WE3A 1YI1A 1QPZA 1JDVA 3PTLA 3R77A 4HY3A 5AW8A 3T7JA 4QOGA 5LXTF 4LJKA 4R8MA 3M89A 3BBPA 2WT4A 4RF4A 5JH7A 4QXAA 3N0WA 4ZO8A 3RS0A 3V6MA 2EJCA 5JATA 4X60A 2BFEB 1U2TA 3BZUA 5IVPA 2EBUA 1XKQA 4GO1A 3ZHBA 3RVSA 5EWLB 1T5DX 5JEDA 1DV1A 4NZZA 3DZHA 3KUKA 3E22A 3LRTA 4W9NA 2H29A 1NT2A 1N0HA 4IQ8A 5DM60 2V0GA 1Z3CA 5PGMA 1PR0A 1AKWA 5CDGA 3GELA 1NAIA 3E0XA 2YIJA 2O5CA 3ET5A 4JKOA 3ZV3A 3FNEA 1GZVA 1PR2A 5K0LA 3IESA 1ST3A 1Y4ZA 3IA7A 1S2GA 1DBQA 2CBGA 1E8NA 3QM1A 1X1EA 3ILSA 3C8ZA 4UMEA 3C0KA 5DZSA 4E2ZA 5EJ5A 2H1VA 2ODAA 1YNSA 4PXYA 5IAOA 5BQPA 3ZHCA 1QV6A 3TTTA 1B73A 1YWGO 1P74A 3DNPA 3MWKA 4IGKA 4IXMA 2NVUA 4WJZA 4BO6A 4PYJA 2I2WA 4G1VA 4QUJA 1GZ3A 4N49A 3RFTA 3WWYA 2EWWA 4BEBA 1H3FA 1TJ5A 1S1MA 1VKZA 2CHUA 2QN8A 3I4LA 4QDZA 1R16A 4U8HA 3W4KA 1L5GB 1OASA 4ACAA 1SHUX 3ND9A 5DMXA 4F85A 4QFCA 5KREA 4RUKA 4PCLA 4QUGA 4ZCRA 1JPUA 2IZ0A 3GFFA 1A76A 1AQYA 2H5LA 2HZBA 2O8VA 4TLDA 4CI9A 1YFLA 2HJWA 2J5BA 3E1SA 1Y1PA 5B2ZA 3LF2A 1Z0SA 2PSJA 3KBOA 3W6UA 3E03A 2XV1A 1RC0A 3GJ3A 4X8MA 3WQRA 3ZXIA 2XWSA 3KX2A 4C08A 1J7KA 1M10A 1K0FA 4C2BA 4BO8A 5IYZA 1NBME 4AKIA 1E7SA 1GRCA 1W4ZA 2P78A 4FDAA 4N6OA 2XOKD 1JXMA 4QOEA 5AXCA 3SE7A 3EXAA 1DX6A 3H9UA 3PFFA 4IDEA 5DT2A 1SU8A 2PWBA 1NNUA 1OXXK 3PKJA 3IQWA 2E55A 2L42A 1EE1A 1L7XA 4BGVA 3VNVA 1VZ2A 4GZMA 5AK5A 2HTFA 3K5PA 4LF6B 1E9FA 3HJFA 3DMTC 4DC1A 4I2VA 1PKXA 1PGOA 4ZI3A 1GQOA 3LX8A 1R10A 3SXPA 1RWOA 5L7WA 1IBLB 1TC1A 3E7FA 3OAAD 4HLCA 5TQ0B 8LDHA 1V37A 1L7NA 1LEHA 1X1QA 2BFOA 3FIUA 3QVVA 4DWVA 4ILKA 5CEJA 2XRZA 2B83A 2R2AA 4UREA 1HNWB 1VJ0A 4MYHA 5CT9A 3X3HA 5DNUA 1N2IA 1HZJA 2P5SA 2ZVPX 3FTPA 1Q0ZA 4Q4AB 4S12A 3DPIA 1SUPA 2BM0A 1TM5E 1Y5IA 1EG2A 3HM9A 1KFJB 3O4VA 1FDOA 2M32A 3OCVA 4TYNA 4PLVA 3L7IA 3MWLA 3RVDA 2F1JA 2ATXA 4XOIA 2E6UX 1XU7A 3K94A 5JVDB 1X15A 4Q03A 1EXNA 4KN9S 1NURA 2YN2A 3TCKA 4JI0B 1F06A 1WZNA 1FXWF 1R5BA 4RKQA 3TRHA 5ALYA 1TKCA 1ZEMA 1JW9B 2BFFB 4JLKA 3RAGA 1S9HA 5AH0A 2QN2A 5T4HA 2W2LD 1MQ9A 3OEED 3F3YA 3ICPA 1Z0FA 4KQFA 1BJTA 2CE2X 1FQJA 1H94A 4COOA 3VPAA 2ENUA 1FNMA 2K7ZA 4PZLA 1F14A 2YYYA 3ZK9A 1UBUS 4J76A 4W5OA 1RXVA 1YZUA 2J31A 2PPLA 4MOWA 3KOMA 3SC2B 4CODB 1U1FA 4Q9JA 2PZMA 5FXMA 3P9IA 4DM7A 4YMVA 2X2EA 4MUFA 4HFJA 2QVYX 2B25A 1GXSA 4JQYA 3ZLBA 4EDFA 1P1BA 4LBWA 2P9JA 4O6VA 5AVYA 1NNI1 1VHLA 5DYYA 5G4LA 4Q7KA 3CNLA 1UZNA 3ZV5A 1UC8A 2WUFA 3N0RA 4TS9A 4ZJPA 5JCPA 1GY8A 4FX5A 4M9XA 3M4XA 3DVRX 1J2UA 3P45A 4HZUA 3ZOZA 1SCNE 5IULC 2ZI6A 3IKVA 1C4KA 3P2MA 1JA1A 3Q3IA 2IYEA 2AF4C 2OBMA 3MRVA 1BXRB 3JRNA 5ER6A 4NQZA 3S0JA 2C96A 3NTOA 1YBHA 3QLEA 4NZ9A 2HWXA 2Q2QA 3O92A 3QWIA 1II9A 3HJTA 4MKXA 4N12A 4V0ME 3T9DA 1J06A 2ZJ0A 3DPUA 1BMFD 1VPLA 2QV0A 3K2QA 3K4QA 4IJ6A 4N7MA 3PPIA 5KJEA 3NHRA 1R6BX 2JLSA 1FTQA 3AOEC 4YIKA 4UDYX 2CV2A 1ZM4A 4GAEA 1N8KA 1G291 1FW8A 1MVOA 2R86A 3EF0A 3F6CA 2DFPA 5CLLA 4Y6PA 3TLGB 1JQJC 1PR9A 1K6EA 2GN0A 4G9BA 4F4CA 2JDID 2PFKA 2R8OA 2V5VA 3REGA 2Q0SA 2YKGA 3Q9LA 1K2VN 1Q20A 1M0SA 3E6AA 3GPDG 5KVAA 3V7WA 16PKA 3PIIA 4ZEWA 3AY7A 4L0MA 4HDAA 5AVOA 2VEDA 3FFBA 1XVAA 3AEXA 2ICAA 4NDZA 1JKMA 2OGZA 1UJCA 5BUSA 3BTVA 3FOFC 4YAIA 3DKIA 2XECA 2M1ZA 3WZLA 3UEOA 1CB7A 2QTTA 1E2JA 3GEDA 3I92A 3OZFA 1GGNA 1T2NA 3CIFA 4LMPA 1SA0A 4UCFA 3UNXA 4YRKA 3JQQA 3W7BA 2VWQA 1G2PA 1T8UA 1D2AA 3R7WA 1G6Q1 2JJQA 2GZMA 3FCXA 1CJUC 5HIAA 2O8DB 2PXXA 1GYRA 3BMNB 5ADHA 4TS1A 3NT5A 2I7CA 1JYFA 3MUEA 2AZ4A 3NVMB 3UFXA 3E1KA 1OI7A 1NQUA 4RGBA 5AI0A 1ENOA 2Q3JA 3EISA 4L6IA 3CG0A 4MMXB 1KAOA 2A7XA 2JA2A 3MOGA 3NTXA 3JQAA 4EKEA 4J29A 3HP7A 1CULC 2K4MA 4DABA 3HZZA 1XVVA 4HAOA 4ARUA 4AKTA 2P3SA 3UKOA 4HLDA 1FYVA 3FOAA 1QYIA 1JDJA 2JCSA 3BF7A 3QMWA 4OA5A 5EXTA 2GCNA 2RK6A 1MT0A 2VJPA 2OQVA 3FNGA 1VP9A 2IEYA 3FVTA 3MN1A 4C01A 4LIPD 1AA9A 5AXAA 1IEVA 1JMVA 3AJ9A 2HV8A 4IQGA 1OIXA 1SOVA 1T6BY 1IBSA 4CI0B 1QIGA 2Z0MA 4UXJA 1I0ZA 3AR7A 3DZ8A 1HBJA 1Z7YA 4BNXA 1EUQA 3AL0C 4KX5A 2M6LA 1ZAKA 1OFVA 1U0HC 1WWKA 3T15A 3NT2A 5EXEA 1GV0A 4XDGA 4EVSA 3ZDDA 4NMLA 1IWPB 3IS3A 1IHXA 1LC3A 4JI6B 2OO7A 4OQYA 1P0QA 3TRKA 4Z9YA 2D3WA 3LCJA 3NGXA 1SBNE 4Q3CA 5FPSA 3UQYS 5K9ZA 4NHOA 2O1EA 1WKCA 2H52A 2GKGA 1PL7A 1RC1A 1HNNA 4ON9A 2GX6A 5B5SA 2UU9B 1G5HA 1M2NA 1U7TA 2OGUA 2ORVA 3OZAA 2ZPTX 1ZUIA 2Q46A 4CEIB 1NN5A 1RW4A 1NX9A 5I3CA 2W6OA 4YX9A 1OGYA 1UPTA 3CKKA 3GJXC 3MQ4A 4GC5A 1HYHA 2GEBA 3LUKA 3WB9A 3ROEA 4A91A 1Q7GA 5FJJA 1AB6A 2FUKA 2IY8A 4ZVMA 3WFJA 4HBGA 5FQNA 2VSQA 3KDSE 3QKSB 5B1SA 4B84A 3D0KA 5EWJB 2P4HX 3P2EA 1YR3A 4KWIA 4ZQBA 4ZVKA 2V4UA 5AKIA 3PD1A 1RTTA 4NTZA 3W8FA 2YZNA 1QQTA 1Y9EA 3TRDA 3WMGA 5B6JA 1UJMA 5MGNA 3HN7A 3OJOA 5TMBA 1Y1KE 2WV7A 5WRFA 2B4RO 1EAYA 3CKYA 4IHJF 4DG5A 3LWZA 2HREA 4CMEA 3LVRE 1UFOA 3VX3A 1XZJA 1MH1A 3F5MA 2BMEA 3O93A 3WMXA 4OLBA 1YE3A 4IF6A 5K0ZA 5ISMA 2C2MA 2W2PA 3JR7A 1G21A 3U44B 3VR4D 5KPJA 2R8YA 1U04A 1EXVA 2ZUUA 2P9GA 1HTTA 5EJIA 4YR7A 5K03A 1QUFA 2YJ4A 4G97A 4C0LA 2AN5A 3PK0A 5BR4A 5IZCA 4LJ6A 3EFOB 5FBHA 4DCNA 4DSTA 3DTYA 4Y2QA 4LC1A 2L2QA 1Z16A 2OZLA 3HL0A 1W8IA 4AKEA 5AW1A 3INNA 1GZDA 4RWZA 4FOOA 1YRYE 4YLYA 1T10A 4OMDA 5ALEA 2DTEA 4HTAA 4QXPA 3RUHA 1ZHHA 4K9DA 3HO1A 1V1MA 3EGXB 4QUBA 1NLFA 4KLAA 4E07A 1WOYA 1KFBB 1NYLA 4H7HA 3VZSA 4HLUC 1NNEA 3IQEA 1ACLA 3NU1A 3Q9UA 4M98A 4DSUA 1BDIA 1KHTA 1Z6GA 3INYA 5FBLB 4QTZA 1NJ5A 1E9RA 2OUIA 1P73A 1UZAA 2D0OB 2RHCA 2BM8A 2C2WA 1GL6A 2C3YA 3NBKA 2OBFA 1A2BA 3NHSA 3OCYA 4NONA 3G2MA 4J9VA 3VJKA 4Z9XA 2JFGA 4FONA 5TQJA 2J4FA 3TKAA 3H3XA 4I6JA 3TUIC 2PVSA 5KOJB 1FY2A 4PZYA 4PLYA 2EJVA 3FHCB 4DANA 1J1IA 1ONSA 3I42A 4M0EA 3TQRA 1WXEA 3QUTA 3FWHA 1GUAA 3G2JA 3PFNA 2ZPUA 1E7MA 3FAZA 3N39C 4U7DA 5DSTA 2ZIXA 1RJDA 5TJ9A 3SQLA 4BLVA 1Z8DA 3HKEB 2XMDA 3MTBA 1SBCA 1BDJA 3FG9A 1JDBB 1X1DA 3BREA 1QFMA 4IG9A 1DZIA 1EX9A 3A7EA 1A50B 2JLQA 2VK4A 4AY6A 3DF7A 4C04A 1P2TA 4WZBA 1K7FB 1N7HA 2CL0X 5IVIA 3CT6A 3E18A 3ZY5A 5BR1A 2CMDA 4N9QA 4QBHA 4RD6A 1FC0A 1E32A 2I7DA 3DE4X 3GPLA 2JLUA 1T3TA 2QD3A 4LHEA 4NOJA 1Z82A 4NK5A 4ZYZA 1A9SA 1BXGA 4JBYA 3OLYA 1GUZA 4H2DA 3PWSA 5LOVF 1KAHA 1E9BA 2ERXA 2JCVA 3GLFE 2W83A 1GNSA 3DONA 1E79D 4F1KA 4W5WA 3C6ZA 3CJTA 4B3CA 4FUQA 2QG6A 2VAVA 4JOSA 4DFDA 1KU0A 1DAKA 3NNDA 2WPDA 4RMNA 4HUQA 3W9SA 4OI4A 2ID9A 5JWRA 4DN6A 3DE3X 2L82A 4CM4A 1EHCA 4DEXA 1O8BA 2JK1A 3JQGA 1P81A 1T3ZA 2Z1DA 2H48A 2NQTA 1U3TA 2CXQA 3ZNPA 1UDWA 2G04A 3KPVA 3FKJA 2RKBA 3HVRA 2OFPA 1Z75A 1DJPA 4Y2VA 2WSYB 1BYUA 2IS2A 1Z63A 1KXZA 1WB6A 1OX6A 1SZDA 3DBRA 3GZNB 4Y2GA 4WCFA 1J1ZA 4RLFA 3QYPA 2VTBA 2X6RA 1T1SA 2CD9A 1BD3A 2CNKA 3N8HA 4LYDA 4PTYA 4W5HA 4X3PA 1PYGA 5BOVA 1ZCAA 2PR7A 3KFXA 3TMKA 4MVJG 1AQIA 4L7QA 4BKMA 4OHWA 1EGHA 4HEQA 1IQ0A 2BDTA 2YYAA 3VZPA 5KYYA 3R8FA 1W46A 1HLPA 3RJMA 4RY2A 5K0JA 5LD2C 2HMTA 5CU7A 1DJLA 3LUPA 4Q9KA 4AO6A 3TRJA 1FFSA 3QI7A 2EV9A 1LTQA 2BFCB 4G26A 4MYUA 5H3CA 4FYVA 4G1EB 2G80A 1F6BA 2X14A 2AJBA 1WX1A 3BDIA 4D9JA 4INZA 3VU9B 4KE9A 1E4OA 1VSQA 1I51A 2I8A