2FM1A

Crystal structure of l-allo-threonine aldolase (tm1744) from thermotoga maritima at 2.25 a resolution
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
343
structure length
342
Chain Sequence
b'MIDLRSDTVTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIRPRNIHFPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKEYAGYADSVMFCLSGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALTKMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEALRNSGVLANAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-allo-threonine aldolase
publication title Crystal structure of L-ALLO-threonine aldolase (tm1744) from Thermotoga maritima at 2.25 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 125
structure length 342
sequence length 343
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01212 Beta_elim_lyase Beta-eliminating lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2fm1A01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2fm1A02
4AZKA 4W8IA 2VGVA 3IF2A 2AY2A 1VJOA 1GC2A 4A72A 4RJYA 2BIEA 1Z3ZA 3WGBA 3NDNA 1KMKA 2HUIA 3E77A 4W1XA 1AJSA 1O69A 2W7JA 1GEWA 2Q7WA 2D65A 3VK4A 1EJIA 3BWNC 3HBXA 4OYTA 3QM2A 4OCAA 3TQXA 8AATA 2C44A 2OGEA 3NNKA 1C4KA 1CQ8A 1FG7A 2BYLA 4WXGA 4RKCA 4KAMA 4WYAA 4XK1A 5EQCA 1ASGA 4LNMA 1KKPA 1W7LA 1OATA 1JF9A 1SVVA 1V2EA 2BI3A 3UWCA 5BJ4A 4E1OA 3WKSA 3K28A 3EI7A 4OTLA 2CH2A 2PB2A 2VLFA 1ARHA 3FDDA 5DX5A 1CS1A 1IAYA 3R9AA 1M0QA 3FZ7A 2NMPA 2R5CB 3E6GA 4JEZA 4TMRA 2PB0A 3WGCA 3LWSA 1MAQA 4GSAA 2VMVA 3NU7A 1OXPA 4RKDA 3ZRQA 2EGYA 1DJEA 4R5ZA 1C0NA 1ARTA 1TOKA 2BI9A 2YKXA 3DC1A 3EUCA 4ITGA 2JJHA 3W1JA 4CBRA 4F5IA 5M46A 2FM1A 3QPGA 2W7KA 2E7UA 2VGWA 2VMWA 1AMQA 2VYCA 1M4NA 3EI6A 3HQTA 4AO4A 1I43A 2EO5A 5D95A 1AHXA 1N8PA 2BWOA 5HXXA 2W7IA 1CQ7A 1GEXA 1ASDA 3HL2A 3DXVA 4RITA 4WXFA 3GETA 5DJ9A 5FT5A 1O62A 1W7MA 3GJUA 2R5CA 4NOGA 4DBCA 4IYOA 2CY8A 4A0HA 2ZY5A 3DODA 1EQBA 5G0AA 4B9BA 3FVXA 1KMJA 2AY8A 1J04A 3MBBA 1IBJA 3BCAA 3UAKA 1AJRA 1QJ3A 5M4DA 1AX4A 1TATA 3G0TA 4IW7A 4WYDA 1GCKA 3FVSA 1LC7A 5HHYA 4OBUA 1LS3A 2EZ2A 3PAAA 1X29A 4E3RA 1TOEA 4BQ0A 4WYFA 4I8AA 3KE3A 1G7XA 4M2MA 1GDEA 4MSOA 1DTYA 1LK9A 1YIZA 1AHGA 1V2DA 2Z9WA 3JWBA 1C7NA 4IX8A 1B5OA 1WKGA 4JE5D 1H1CA 1JG8A 2WK9A 2AY4A 3JWAA 1IVRA 3PGYA 1QITA 1TOJA 4OMAA 3FFRA 1QGNA 2D64A 3A9YA 1S09A 2WK8A 4LW2A 4K2BA 1TOIA 1CZCA 1AMRA 1OHWA 1AAWA 1MDXA 2X5DA 1CL2A 2CJHA 3N75A 1O4SA 2W7HA 3TCMA 1LC8A 1ECXA 1M0OA 4A0FA 2DGMA 3NYUA 4ZLVA 4UHOA 1MLZA 2E54A 2OKJA 2DKJA 4UHNA 1W23A 1GBNA 4ZDLA 3JW9A 1ZC9A 3FQAA 4ZM3A 3AENA 1XEYA 1AKAA 2BWNA 1RV3A 1BW0A 2D7YA 3MEBA 4JEVA 2AATA 3D6KA 4K2MA 5G4IA 4KXKA 4WYCA 4F5GA 1GD9A 1WYVA 1LKCA 1VP4A 1D7VA 4PFNA 3NX3A 2VMZA 2FNIA 1M7YA 1UKJA 5E3KA 4WYGA 1I29A 1IX8A 1JS6A 3N0LA 1AMAA 4LW4A 4ZWMA 5HDMA 2VI9A 4WD2A 2VIAA 3WY7A 3A9ZA 4IXSA 4EB7A 1GC4A 1M0PA 1ASAA 2R2NA 3B8XA 3R4TA 1Z7DA 3AOWA 2O0RA 1IJIA 3B1DA 2W8TA 4H51A 5EIGA 2ZJGA 5FT4A 3TATA 4F5HA 4ATQA 4B98A 4O6ZA 3VOMA 4J5UA 2EPJA 5C6UA 1UU0A 1AIAA 3AATA 1AHYA 2GMUA 3BV0A 5G09A 3COGA 3CQ6A 1TARA 4ZASA 3VK3A 4QGRA 2V1PA 2DOUA 2ZSLA 3AEPA 1BJ4A 1W7NA 4CXQA 1RVUA 3E2YA 4RJ0A 3TFTA 2FNUA 2BWPA 2CANA 5BJ3A 4ZWVA 3AEOA 5FT8A 2VGTA 3P6KA 3B1CA 4UOYA 3WLXA 4WXBA 3QGUA 2YRRA 4WP0A 1Y4IA 5JAYA 5EAVA 4F4EA 2ZY2A 2O1BA 4BA5A 1YJZA 3L8AA 1ZOBA 3NU8A 4GE4A 3MAFB 3WX9A 4ATPA 4PIWA 4ZDPA 2D61A 1S07A 2BI2A 1LC5A 3FRKA 3FD0A 1ASEA 1D7SA 3PD6B 4ADBA 4OC9A 2QBTA 4OT8A 1ELUA 2R0TA 2VMRA 4TN4A 2Z9XA 4Q31A 1KL2A 1E5FA 2CINA 1WSTA 4EU1A 1CQ6A 2DGKA 2VMUA 3I16A 4ZAHA 4U1TA 4N0WA 2QB3A 4MGRA 2W7MA 2JJGA 1IUGA 3LV2A 4W91A 4Y0DA 3GR9A 1ASBA 4A0GA 2RFVA 1YJSA 4RLGA 4P7YA 1OHVA 1YAAA 4ZDOA 4DQ6A 4XQ2A 5M4BA 2QLRA 3AOVA 3K7YA 1W3UA 3BN1A 3I5TA 4CVQA 3W1IA 3GZCA 1SF2A 1QIRA 3USFA 4XJPA 3FSLA 3P1TA 1BQDA 3FZ6A 2Z1ZA 2WK7A 2CFBA 1ASMA 4XJMA 4P3MA 5EUEA 3VAXA 2HOXA 1X0MA 4Y0IA 1PFFA 4ADCA 3LVJA 4ISYA 3FZ8A 4F5JA 3AV7A 3RQ1A 2FYFA 1N2TA 1PMOA 4FL0A 1C7GA 4W1VA 2JG2A 3I4JA 5I92A 3RCHB 3BS8A 3VK2A 1QISA 3G8MA 2VMQA 1DGEA 1BKGA 4CXRA 2BI1A 1AMSA 3W1HA 2BKWA 2CTZA 2YCNA 2HZPA 1ORDA 4WYEA 1G7WA 3GZDA 2VGSA 1GEYA 3EI9A 1FC4A 2AY5A 3IHJA 2ZUKA 4PFFA 2WKAA 1BJOA 2VLHA 4R8DA 1LW5A 3JTXA 3ZZKA 1SPAA 2VMPA 1DKAA 1GC3A 2PO3A 2YCPA 3KGXA 3KKIA 3M5UA 1OXOA 1SZSA 4BMKA 2ZY4A 3LVMA 5EAAA 5G2QA 3AEJA 2VMTA 3BC8A 5E5IA 1CZEA 3G7QA 2VMSA 3E9KA 1I48A 2AY1A 2YCTA 4GRXA 3NYTA 1IX6A 2W8VA 1X2AA 1KL1A 1BS0A 4R5FA 2VGZA 3GWPA 1ARIA 3HMUA 5LHAA 2Z67A 1MLYA 1PG8A 1ELQA 4AOAA 4K2IA 3NRAA 2W7LA 1B5PA 1DGDA 1AHFA 3CBFA 3RI6A 4A0RA 4JEXA 4ADDA 2W7GA 2G6WA 3NUIA 2OQXA 1AICA 1QZ9A 1XI9A 5DJ1A 3VP6A 2BHXA 3EIBA 4GE7A 4F5KA 2Z9UA 2XBNA 4FFCA 3DR4A 4LNJA 1D2FA 3NUBA 3NYSA 1ARGA 1ASLA 1X28A 1M32A 2W8JA 4RAEA 1BJWA 2VMXA 2YKUA 2YKYA 2ZP7A 3BCXA 4IY7A 3BWOA 4WLHA 5J8QA 4A6RA 4RM1A 3FQ8A 4JEYA 4E3QA 3CAIA 7AATA 3FVUA 2W8WA 2X8UA 1ZODA 4ZSYA 1AJSB 3FFHA 3QBOA 1UU1A 2O7CA 2OKKA 2HOZA 2VGUA 4Q75A 3MADA 2BIAA 3F9TA 3L44A 1N31A 3A9XA 4BA4A 4F5FA 1OHYA 1RVYA 3HLMA 2VI8A 2DGLA 3T32A 1D7RA 1TOGA 3ASBA 4R2NA 3PJ0A 2EZ1A 2CJDA 3MC6A 3N5MA 2AY3A 1ASFA 1C7OA 1C9CA 2OGAA 5G4JA 1DJUA 4WLJA 1E5EA 3DR7A 5AX8A 4BHDA 2GB3A 2VMYA 3EIAA 3E2FA 2ORDA 2ZSMA 4RIZA 1TASA 4DGTA 5IWQA 2F8JA 3FCRA 3B46A 2HP1A 2VMOA 5FT6A 1G4XA 3EI5A 3KGWA 2GQNA 4ZSWA 3UE8A 4HVKA 3DXWA 1WYTB 2D63A 2GSAA 1QJ5A 2D5YA 3DRDA 2AY9A 1S06A 2W7FA 3EI8A 4MKJA 3TFUA 4IXOA 3GZDC 2AEUA 3WCOA 2ZC0A 1J32A 3CQ4A 2JISA 2JJFA 1DFOA 5E4ZA 4JF0A 5LH9A 3ZRRA 2JJEA 1AAMA 4XAUA 3E2ZB 2TPLA 1KKJA 3LY1A 1YOOA 2AEVA 4W5KA 3AEJC 1B4XA 1T3IA 4N0BA 3PA9A 4A00A 2HUUA 1H0CA 1YNUA 2QA3A 2QMAA 3DYDA 1U08A 4J8LA 1V2FA 4XJLA 4EFFA 1M6SA 3LG0A 3II0A 2QB2A 3MAFA 1WYTA 1AY4A 1AIBA 2W7EA 3HVYA 3F6TA 4GEBA 3ASAA 5F9SA 4IYOB 4IXZA 1LW4A 3HDOA 4WBTA 2C0RA 3PD6A 4UHMA 1BJNA 3AEMA 3JZLA 2OATA 2V0YA 2HORA 2W8UA 1B9HA 2HOYA 4OBVA 3E2ZA 1M0NA 4F5LA 2CH1A 3A2BA 5EUNA 1ASNA 3B1EA 3FKDA 1SZUA 3FDBA 1G4VA 1WKHA 3LVKA 1MDOA 3PDXA 2X3LA 2BI5A 1VEFA 5D5SA 3BB8A 5G2PA 2Z20A 2Z9VA 3BWNA 2C7TA 2JGTA 1ASCA 2VIBA 4A6UA 4WB0B 4EMYA 3GSBA 3PPLA 3ATHA 2BIGA 4CBSA 3DZZA 3FTBA 4GE9A 3ECDA 3JU7A 4ADEA 4F5MA 4PVFA 3BCBA 3NTJA 4AZJA 2DKBA 2XH1A 1SFFA 3K40A 3QHXA 1TPLA 2DR1A 1AY5A 4M2KA 3RUYA 4LC3A 1YIYA 2BYJA 2YKVA 4KYOA 2EH6A 3MC6C 4MQRA 4U2HA 1MGVA 5EFSA 1SZKA 3RCHA 2YHKA 5M49A 5TF5A 1I41A 1AKCA 2AY7A 1DJ9A 1GC0A 3ELPA 4JF1A 3PDBB 3AENB 4MY5A 1AKBA 1PMMA 1YJYA 3QN6A 1CL1A 3OP7A 1ARSA 2HUFA 1B8GA 4GDYA 2VMNA 1WYVB 4A6TA 4WB0A 1O61A 4MQPA 1CJ0A 1IAXA 5EUDA 1V72A 1P3WA 3EZ1A 4MKKA 4XJOA 3WKRA 2X5FA 3HT4A 4ITXA 2D7ZA 4JE5A 2YOBA 3EZSA 4Q76A 2C81A 4AO9A 2R5EA 1MDZA 3A8UX 3RBLA 4AH3A 4MQQA 1UU2A 1BQAA 3RBFA 1D7UA 4W1WA 1WYUB 2CB1A 3ZRPA 5EIGB 1BJOB 2CJGA 2FQ6A 1RV4A 3H7FA 4L0OA 4JEWA 3Q8NA 4M2JA 4EB5A 3CQ5A 1S08A 2ZY3A 1MAPA 3ISLA 3MAUA 2GMSA 2W7DA 1S0AA 2YRIA 4HF8A 2D66A 5K8BA 1IX7A 2CSTA 3ACZA 3PDBA 2Z1YA 1AHEA 1JS3A 3GBXA 3DU4A 2ZYJA 4Q6RA 1B9IA 5F8VA 2FN6A 3WCNA 4UQVA 1AY8A 3WZFA 4ZM4A 3AELA 4E77A 3OKSA 3FQ7A 3H14A 4LNLA 3F0HA 5DB5A 2Z61A 2E7JA 3QI6A 4TV7A 4XEWA 3ELEA 3LVLB 3AEMC 2AY6A 2E7IA 4Y0HA 1BT4A 1WYUA 1FG3A 3PIUA 2HP2A 9AATA 1EG5A 3ZZJA 3MKJA
chains in the Genus database with same CATH superfamily
4AZKA 4W8IA 2VGVA 3IF2A 2AY2A 1VJOA 1GC2A 4A72A 4RJYA 2BIEA 1Z3ZA 3WGBA 3NDNA 1KMKA 2HUIA 3E77A 4W1XA 1AJSA 1O69A 2W7JA 1GEWA 2Q7WA 2D65A 3VK4A 1EJIA 3BWNC 3HBXA 4OYTA 3N4XA 3QM2A 4OCAA 3TQXA 8AATA 2C44A 2OGEA 3NNKA 1C4KA 1CQ8A 1FG7A 2BYLA 4WXGA 4RKCA 4KAMA 4WYAA 4XK1A 5EQCA 1ASGA 4LNMA 1KKPA 1W7LA 1OATA 1JF9A 1SVVA 1V2EA 2BI3A 3UWCA 5BJ4A 4E1OA 3WKSA 3K28A 3EI7A 4OTLA 2CH2A 2PB2A 2VLFA 1ARHA 3FDDA 5DX5A 1CS1A 1IAYA 3R9AA 1M0QA 3FZ7A 2NMPA 2R5CB 3E6GA 4JEZA 4TMRA 2PB0A 3WGCA 3LWSA 1MAQA 4GSAA 2VMVA 3NU7A 1OXPA 4RKDA 3ZRQA 2EGYA 1DJEA 4R5ZA 1C0NA 1ARTA 1TOKA 2BI9A 2YKXA 3DC1A 3EUCA 4ITGA 2JJHA 3W1JA 4CBRA 4F5IA 5M46A 2FM1A 3QPGA 2W7KA 2E7UA 2VGWA 2VMWA 1AMQA 2VYCA 1M4NA 3EI6A 3HQTA 4AO4A 1I43A 2EO5A 5D95A 1AHXA 1N8PA 2BWOA 5HXXA 2W7IA 1CQ7A 1GEXA 1ASDA 3HL2A 3DXVA 4RITA 4WXFA 3GETA 5DJ9A 5FT5A 1O62A 1W7MA 3GJUA 2R5CA 4NOGA 4DBCA 4IYOA 2CY8A 4A0HA 2ZY5A 3DODA 1EQBA 5G0AA 4B9BA 3FVXA 1KMJA 2AY8A 1J04A 3MBBA 1IBJA 3BCAA 3UAKA 1AJRA 1QJ3A 5M4DA 1AX4A 1TATA 3G0TA 4IW7A 4WYDA 2QSRA 1GCKA 3FVSA 1LC7A 5HHYA 4OBUA 1LS3A 2EZ2A 3PAAA 1X29A 4E3RA 1TOEA 4BQ0A 4WYFA 4I8AA 3KE3A 1G7XA 4M2MA 1GDEA 4MSOA 1DTYA 1LK9A 1YIZA 1AHGA 1V2DA 2Z9WA 3JWBA 1C7NA 4IX8A 1B5OA 1WKGA 4JE5D 1H1CA 1JG8A 2WK9A 2AY4A 3JWAA 1IVRA 3PGYA 1QITA 1TOJA 4OMAA 3FFRA 1QGNA 2D64A 3A9YA 1S09A 2WK8A 4LW2A 4K2BA 1TOIA 1CZCA 1AMRA 1OHWA 1AAWA 1MDXA 2X5DA 1CL2A 2CJHA 3N75A 1O4SA 2W7HA 3TCMA 1LC8A 1ECXA 1M0OA 4A0FA 2DGMA 3NYUA 4ZLVA 4UHOA 1MLZA 2E54A 2OKJA 2DKJA 4UHNA 1W23A 1GBNA 4ZDLA 3JW9A 1ZC9A 3FQAA 4ZM3A 3AENA 1XEYA 1AKAA 2BWNA 1RV3A 1BW0A 2D7YA 3MEBA 4JEVA 2AATA 3D6KA 4K2MA 5G4IA 4KXKA 4WYCA 4F5GA 1GD9A 1WYVA 1LKCA 1VP4A 1D7VA 4PFNA 3NX3A 2VMZA 2FNIA 1M7YA 1UKJA 5E3KA 4WYGA 1I29A 1IX8A 1JS6A 3N0LA 1AMAA 4LW4A 4ZWMA 5HDMA 2VI9A 4WD2A 2VIAA 3WY7A 3A9ZA 4IXSA 4EB7A 4K05A 1GC4A 1M0PA 1ASAA 2R2NA 3B8XA 3R4TA 1Z7DA 3AOWA 2O0RA 1IJIA 3B1DA 2W8TA 4H51A 5EIGA 2ZJGA 5FT4A 3TATA 4F5HA 4ATQA 4B98A 4O6ZA 3VOMA 4J5UA 2EPJA 5C6UA 1UU0A 1AIAA 3AATA 1AHYA 2GMUA 3BV0A 5G09A 3COGA 3CQ6A 1TARA 4ZASA 3VK3A 4QGRA 2V1PA 2DOUA 2ZSLA 3AEPA 1BJ4A 1W7NA 4CXQA 1RVUA 3E2YA 4RJ0A 3TFTA 2FNUA 2BWPA 2CANA 5BJ3A 4ZWVA 3AEOA 5FT8A 2VGTA 3P6KA 3B1CA 4UOYA 3WLXA 4WXBA 2FKIA 3QGUA 2YRRA 4WP0A 1Y4IA 5JAYA 5EAVA 4F4EA 2ZY2A 2O1BA 4BA5A 1YJZA 3L8AA 1ZOBA 3NU8A 4GE4A 3MAFB 3WX9A 4ATPA 4PIWA 4ZDPA 2D61A 1S07A 2BI2A 1LC5A 3FRKA 3FD0A 1ASEA 1D7SA 3PD6B 4ADBA 4OC9A 2QBTA 4OT8A 1ELUA 2R0TA 2VMRA 4TN4A 2Z9XA 4Q31A 1KL2A 1E5FA 2CINA 1WSTA 4EU1A 1CQ6A 2DGKA 2VMUA 3I16A 4ZAHA 4U1TA 4N0WA 2QB3A 4MGRA 2W7MA 2JJGA 1IUGA 3LV2A 4W91A 4Y0DA 3GR9A 1ASBA 4A0GA 2RFVA 1YJSA 4RLGA 4P7YA 1OHVA 1YAAA 4ZDOA 4DQ6A 4XQ2A 5M4BA 2QLRA 3AOVA 3K7YA 1W3UA 3BN1A 3I5TA 4CVQA 3W1IA 3GZCA 1SF2A 1QIRA 3USFA 4XJPA 3FSLA 3P1TA 1BQDA 3FZ6A 2Z1ZA 2WK7A 2CFBA 1ASMA 4XJMA 4P3MA 5EUEA 3VAXA 2HOXA 1X0MA 4Y0IA 1PFFA 4ADCA 3LVJA 4ISYA 3FZ8A 4F5JA 3AV7A 3RQ1A 2FYFA 1N2TA 1PMOA 4FL0A 4H63Q 1C7GA 4W1VA 2JG2A 3I4JA 5I92A 3RCHB 3BS8A 3VK2A 1QISA 3G8MA 2VMQA 1DGEA 1BKGA 4CXRA 2BI1A 1AMSA 3W1HA 2BKWA 2CTZA 2YCNA 2HZPA 1ORDA 4WYEA 1G7WA 3GZDA 2VGSA 1GEYA 3EI9A 1FC4A 2AY5A 3IHJA 2ZUKA 4PFFA 2WKAA 1BJOA 2VLHA 4R8DA 1LW5A 3JTXA 3ZZKA 1SPAA 2VMPA 1DKAA 1GC3A 2PO3A 2YCPA 3KGXA 3KKIA 3M5UA 1OXOA 1SZSA 4BMKA 2ZY4A 3LVMA 5EAAA 5G2QA 3AEJA 2VMTA 3BC8A 5E5IA 1CZEA 3G7QA 2VMSA 3E9KA 1I48A 2AY1A 2YCTA 4GRXA 3NYTA 1IX6A 3N4RA 2W8VA 1X2AA 1KL1A 1BS0A 4R5FA 2VGZA 3GWPA 1ARIA 3HMUA 5LHAA 2Z67A 1MLYA 1PG8A 1ELQA 4AOAA 4K2IA 3NRAA 2W7LA 1B5PA 1DGDA 1AHFA 3CBFA 3RI6A 4A0RA 4JEXA 4ADDA 2W7GA 2G6WA 3NUIA 2OQXA 1AICA 1QZ9A 1XI9A 5DJ1A 3VP6A 2BHXA 3EIBA 4GE7A 4F5KA 2Z9UA 2XBNA 4FFCA 3DR4A 4LNJA 1D2FA 3NUBA 3NYSA 1ARGA 1ASLA 1X28A 1M32A 2W8JA 4RAEA 1BJWA 2VMXA 2YKUA 2YKYA 2ZP7A 3BCXA 4IY7A 3BWOA 4WLHA 5J8QA 4A6RA 4RM1A 3FQ8A 4JEYA 4E3QA 3CAIA 7AATA 3FVUA 2W8WA 2X8UA 1ZODA 4ZSYA 1AJSB 3FFHA 3QBOA 1UU1A 2O7CA 2OKKA 2HOZA 2VGUA 4Q75A 3MADA 2BIAA 3F9TA 3L44A 1N31A 3A9XA 4BA4A 4F5FA 5KTBA 1OHYA 1RVYA 3HLMA 2VI8A 2DGLA 3T32A 1D7RA 1TOGA 3ASBA 4R2NA 3PJ0A 2EZ1A 2CJDA 3MC6A 3N5MA 2AY3A 1ASFA 1C7OA 1C9CA 2OGAA 5G4JA 1DJUA 4WLJA 1E5EA 3DR7A 5AX8A 4BHDA 2GB3A 2VMYA 3EIAA 3E2FA 2ORDA 2ZSMA 4RIZA 1TASA 4DGTA 5IWQA 2F8JA 3FCRA 3B46A 2HP1A 2VMOA 5FT6A 1G4XA 3EI5A 3KGWA 2GQNA 4ZSWA 3N4SA 3UE8A 4HVKA 3DXWA 1WYTB 2D63A 2GSAA 1QJ5A 2D5YA 2KFPA 3DRDA 2AY9A 1S06A 2W7FA 3EI8A 4MKJA 3TFUA 4IXOA 3GZDC 2AEUA 3WCOA 2ZC0A 3H9XA 1J32A 3CQ4A 2JISA 2JJFA 1DFOA 5E4ZA 4JF0A 5LH9A 3ZRRA 2JJEA 1AAMA 4XAUA 3E2ZB 2TPLA 2A1VA 1KKJA 3LY1A 1YOOA 2AEVA 4W5KA 3AEJC 1B4XA 1T3IA 4N0BA 3PA9A 4A00A 2HUUA 1H0CA 1YNUA 2QA3A 2QMAA 3DYDA 1U08A 4J8LA 1V2FA 4XJLA 4EFFA 1M6SA 3LG0A 3II0A 2QB2A 2WB6A 3MAFA 1WYTA 1AY4A 1AIBA 2W7EA 3HVYA 3F6TA 4GEBA 3ASAA 5F9SA 4IYOB 4IXZA 1LW4A 3HDOA 4WBTA 2C0RA 3PD6A 4UHMA 1BJNA 3AEMA 3JZLA 2OATA 2V0YA 2HORA 2W8UA 1B9HA 2HOYA 4OBVA 3E2ZA 1M0NA 4F5LA 2CH1A 3A2BA 5EUNA 1ASNA 2EYQA 3B1EA 3FKDA 1SZUA 3FDBA 1G4VA 1WKHA 3LVKA 1MDOA 3PDXA 2X3LA 2BI5A 1VEFA 1KAFA 5D5SA 3BB8A 5G2PA 2Z20A 2Z9VA 3BWNA 2C7TA 2JGTA 1ASCA 2VIBA 4A6UA 4WB0B 4EMYA 3GSBA 3PPLA 3ATHA 2BIGA 4CBSA 3DZZA 3FTBA 4GE9A 3ECDA 3JU7A 4ADEA 4F5MA 4PVFA 3BCBA 3NTJA 4AZJA 2DKBA 2XH1A 1SFFA 3K40A 3QHXA 1TPLA 2DR1A 1AY5A 4M2KA 3RUYA 4LC3A 1YIYA 2G7JA 2BYJA 2YKVA 4KYOA 2EH6A 3MC6C 4MQRA 4U2HA 1MGVA 5EFSA 1SZKA 3RCHA 2YHKA 5M49A 5TF5A 1I41A 1AKCA 2AY7A 1DJ9A 1GC0A 3ELPA 4JF1A 3PDBB 3AENB 4MY5A 1AKBA 1PMMA 1YJYA 3QN6A 1CL1A 3OP7A 1ARSA 2HUFA 1B8GA 4GDYA 2VMNA 1WYVB 4A6TA 4WB0A 1O61A 4MQPA 1CJ0A 1IAXA 5EUDA 1V72A 1P3WA 3EZ1A 4MKKA 4XJOA 3WKRA 2X5FA 3HT4A 4ITXA 2D7ZA 4JE5A 2YOBA 3EZSA 4Q76A 2C81A 4AO9A 2R5EA 1MDZA 3A8UX 3RBLA 4AH3A 4MQQA 1UU2A 1BQAA 3RBFA 1D7UA 4W1WA 1WYUB 2CB1A 3ZRPA 5EIGB 1BJOB 2CJGA 2FQ6A 1RV4A 3H7FA 4L0OA 4JEWA 3Q8NA 4M2JA 4EB5A 3CQ5A 1S08A 2ZY3A 1MAPA 3ISLA 3MAUA 2GMSA 2W7DA 1S0AA 2YRIA 4HF8A 2D66A 5K8BA 1IX7A 2CSTA 3ACZA 3PDBA 2Z1YA 1AHEA 1JS3A 3GBXA 3DU4A 2ZYJA 4Q6RA 1B9IA 5F8VA 2FN6A 3WCNA 4UQVA 1AY8A 3WZFA 4ZM4A 3AELA 4E77A 3OKSA 3FQ7A 3H14A 4LNLA 3F0HA 5DB5A 2Z61A 2E7JA 3QI6A 4TV7A 4XEWA 3ELEA 3LVLB 3AEMC 2AY6A 2E7IA 3N7NA 4Y0HA 1BT4A 1WYUA 1FG3A 3PIUA 2HP2A 9AATA 1EG5A 3ZZJA 3MKJA
chains in the Genus database with same CATH topology
4AZKA 4W8IA 2VGVA 3IF2A 2AY2A 1VJOA 1GC2A 4A72A 4RJYA 2BIEA 1Z3ZA 3WGBA 3NDNA 1KMKA 2HUIA 3E77A 4W1XA 1AJSA 1O69A 2W7JA 1GEWA 2Q7WA 2D65A 3VK4A 1EJIA 3BWNC 3HBXA 4OYTA 3N4XA 3QM2A 4OCAA 3TQXA 8AATA 2C44A 2OGEA 3NNKA 1C4KA 1CQ8A 1FG7A 2BYLA 4WXGA 4RKCA 4KAMA 4WYAA 4XK1A 5EQCA 1ASGA 4LNMA 1KKPA 1W7LA 1OATA 1JF9A 1SVVA 1V2EA 2BI3A 3UWCA 5BJ4A 4E1OA 3WKSA 3K28A 3EI7A 4OTLA 2CH2A 2PB2A 2VLFA 1ARHA 3FDDA 5DX5A 1CS1A 1IAYA 3R9AA 1M0QA 3FZ7A 2NMPA 2R5CB 3E6GA 4JEZA 4TMRA 2PB0A 3WGCA 3LWSA 1MAQA 4GSAA 2VMVA 3NU7A 1OXPA 4RKDA 3ZRQA 2EGYA 1DJEA 4R5ZA 1C0NA 1ARTA 1TOKA 2BI9A 2YKXA 3DC1A 3EUCA 4ITGA 2JJHA 3W1JA 4CBRA 4F5IA 5M46A 2FM1A 3QPGA 2W7KA 2E7UA 2VGWA 2VMWA 1AMQA 2VYCA 1M4NA 3EI6A 3HQTA 4AO4A 1I43A 2EO5A 5D95A 1AHXA 1N8PA 2BWOA 5HXXA 2W7IA 1CQ7A 1GEXA 1ASDA 3HL2A 3DXVA 4RITA 4WXFA 3GETA 5DJ9A 5FT5A 1O62A 1W7MA 3GJUA 2R5CA 4NOGA 4DBCA 4IYOA 2CY8A 4A0HA 2ZY5A 3DODA 1EQBA 5G0AA 4B9BA 3FVXA 1KMJA 2AY8A 1J04A 3MBBA 1IBJA 3BCAA 3UAKA 1AJRA 1QJ3A 5M4DA 1AX4A 1TATA 3G0TA 4IW7A 4WYDA 2QSRA 1GCKA 3FVSA 1LC7A 5HHYA 4OBUA 1LS3A 2EZ2A 3PAAA 1X29A 4E3RA 1TOEA 4BQ0A 4WYFA 4I8AA 3KE3A 1G7XA 4M2MA 1GDEA 4MSOA 1DTYA 1LK9A 1YIZA 1AHGA 1V2DA 2Z9WA 3JWBA 1C7NA 4IX8A 1B5OA 1WKGA 4JE5D 1H1CA 1JG8A 2WK9A 2AY4A 3JWAA 1IVRA 3PGYA 1QITA 1TOJA 4OMAA 3FFRA 1QGNA 2D64A 3A9YA 1S09A 2WK8A 4LW2A 4K2BA 1TOIA 1CZCA 1AMRA 1OHWA 1AAWA 1MDXA 2X5DA 1CL2A 2CJHA 3N75A 1O4SA 2W7HA 3TCMA 1LC8A 1ECXA 1M0OA 4A0FA 2DGMA 3NYUA 4ZLVA 4UHOA 1MLZA 2E54A 2OKJA 2DKJA 4UHNA 1W23A 1GBNA 4ZDLA 3JW9A 1ZC9A 3FQAA 4ZM3A 3AENA 1XEYA 1AKAA 2BWNA 1RV3A 1BW0A 2D7YA 3MEBA 4JEVA 2AATA 3D6KA 4K2MA 5G4IA 4KXKA 4WYCA 4F5GA 1GD9A 1WYVA 1LKCA 1VP4A 1D7VA 4PFNA 3NX3A 2VMZA 2FNIA 1M7YA 1UKJA 5E3KA 4WYGA 1I29A 1IX8A 1JS6A 3N0LA 1AMAA 4LW4A 4ZWMA 5HDMA 2VI9A 4WD2A 2VIAA 3WY7A 3A9ZA 4IXSA 4EB7A 4K05A 1GC4A 1M0PA 1ASAA 2R2NA 3B8XA 3R4TA 1Z7DA 3AOWA 2O0RA 1IJIA 3B1DA 2W8TA 4H51A 5EIGA 2ZJGA 5FT4A 3TATA 4F5HA 4ATQA 4B98A 4O6ZA 3VOMA 4J5UA 2EPJA 5C6UA 1UU0A 1AIAA 3AATA 1AHYA 2GMUA 3BV0A 5G09A 3COGA 3CQ6A 1TARA 4ZASA 3VK3A 4QGRA 2V1PA 2DOUA 2ZSLA 3AEPA 1BJ4A 1W7NA 4CXQA 1RVUA 3E2YA 4RJ0A 3TFTA 2FNUA 2BWPA 2CANA 5BJ3A 4ZWVA 3AEOA 5FT8A 2VGTA 3P6KA 3B1CA 4UOYA 3WLXA 4WXBA 2FKIA 3QGUA 2YRRA 4WP0A 1Y4IA 5JAYA 5EAVA 4F4EA 2ZY2A 2O1BA 4BA5A 1YJZA 3L8AA 1ZOBA 3NU8A 4GE4A 3MAFB 3WX9A 4ATPA 4PIWA 4ZDPA 2D61A 1S07A 2BI2A 1LC5A 3FRKA 3FD0A 1ASEA 1D7SA 3PD6B 4ADBA 4OC9A 2QBTA 4OT8A 1ELUA 2R0TA 2VMRA 4TN4A 2Z9XA 4Q31A 1KL2A 1E5FA 2CINA 1WSTA 4EU1A 1CQ6A 2DGKA 2VMUA 3I16A 4ZAHA 4U1TA 4N0WA 2QB3A 4MGRA 2W7MA 2JJGA 1IUGA 3LV2A 4W91A 4Y0DA 3GR9A 1ASBA 4A0GA 2RFVA 1YJSA 4RLGA 4P7YA 1OHVA 1YAAA 4ZDOA 4DQ6A 4XQ2A 5M4BA 2QLRA 3AOVA 3K7YA 1W3UA 3BN1A 3I5TA 4CVQA 3W1IA 3GZCA 1SF2A 1QIRA 3USFA 4XJPA 3FSLA 3P1TA 1BQDA 3FZ6A 2Z1ZA 2WK7A 2CFBA 1ASMA 4XJMA 4P3MA 5EUEA 3VAXA 2HOXA 1X0MA 4Y0IA 1PFFA 4ADCA 3LVJA 4ISYA 3FZ8A 4F5JA 3AV7A 3RQ1A 2FYFA 1N2TA 1PMOA 4FL0A 4H63Q 1C7GA 4W1VA 2JG2A 3I4JA 5I92A 3RCHB 3BS8A 3VK2A 1QISA 3G8MA 2VMQA 1DGEA 1BKGA 4CXRA 2BI1A 1AMSA 3W1HA 2BKWA 2CTZA 2YCNA 2HZPA 1ORDA 4WYEA 1G7WA 3GZDA 2VGSA 1GEYA 3EI9A 1FC4A 2AY5A 3IHJA 2ZUKA 4PFFA 2WKAA 1BJOA 2VLHA 4R8DA 1LW5A 3JTXA 3ZZKA 1SPAA 2VMPA 1DKAA 1GC3A 2PO3A 2YCPA 3KGXA 3KKIA 3M5UA 1OXOA 1SZSA 4BMKA 2ZY4A 3LVMA 5EAAA 5G2QA 3AEJA 2VMTA 3BC8A 5E5IA 1CZEA 3G7QA 2VMSA 3E9KA 1I48A 2AY1A 2YCTA 4GRXA 3NYTA 1IX6A 3N4RA 2W8VA 1X2AA 1KL1A 1BS0A 4R5FA 2VGZA 3GWPA 1ARIA 3HMUA 5LHAA 2Z67A 1MLYA 1PG8A 1ELQA 4AOAA 4K2IA 3NRAA 2W7LA 1B5PA 1DGDA 1AHFA 3CBFA 3RI6A 4A0RA 4JEXA 4ADDA 2W7GA 2G6WA 3NUIA 2OQXA 1AICA 1QZ9A 1XI9A 5DJ1A 3VP6A 2BHXA 3EIBA 4GE7A 4F5KA 2Z9UA 2XBNA 4FFCA 3DR4A 4LNJA 1D2FA 3NUBA 3NYSA 1ARGA 1ASLA 1X28A 1M32A 2W8JA 4RAEA 1BJWA 2VMXA 2YKUA 2YKYA 2ZP7A 3BCXA 4IY7A 3BWOA 4WLHA 5J8QA 4A6RA 4RM1A 3FQ8A 4JEYA 4E3QA 3CAIA 7AATA 3FVUA 2W8WA 2X8UA 1ZODA 4ZSYA 1AJSB 3FFHA 3QBOA 1UU1A 2O7CA 2OKKA 2HOZA 2VGUA 4Q75A 3MADA 2BIAA 3F9TA 3L44A 1N31A 3A9XA 4BA4A 4F5FA 5KTBA 1OHYA 1RVYA 3HLMA 2VI8A 2DGLA 3T32A 1D7RA 1TOGA 3ASBA 4R2NA 3PJ0A 2EZ1A 2CJDA 3MC6A 3N5MA 2AY3A 1ASFA 1C7OA 1C9CA 2OGAA 5G4JA 1DJUA 4WLJA 1E5EA 3DR7A 5AX8A 4BHDA 2GB3A 2VMYA 3EIAA 3E2FA 2ORDA 2ZSMA 4RIZA 1TASA 4DGTA 5IWQA 2F8JA 3FCRA 3B46A 2HP1A 2VMOA 5FT6A 1G4XA 3EI5A 3KGWA 2GQNA 4ZSWA 3N4SA 3UE8A 4HVKA 3DXWA 1WYTB 2D63A 2GSAA 1QJ5A 2D5YA 2KFPA 3DRDA 2AY9A 1S06A 2W7FA 3EI8A 4MKJA 3TFUA 4IXOA 3GZDC 2AEUA 3WCOA 2ZC0A 3H9XA 1J32A 3CQ4A 2JISA 2JJFA 1DFOA 5E4ZA 4JF0A 5LH9A 3ZRRA 2JJEA 1AAMA 4XAUA 3E2ZB 2TPLA 2A1VA 1KKJA 3LY1A 1YOOA 2AEVA 4W5KA 3AEJC 1B4XA 1T3IA 4N0BA 3PA9A 4A00A 2HUUA 1H0CA 1YNUA 2QA3A 2QMAA 3DYDA 1U08A 4J8LA 1V2FA 4XJLA 4EFFA 1M6SA 3LG0A 3II0A 2QB2A 2WB6A 3MAFA 1WYTA 1AY4A 1AIBA 2W7EA 3HVYA 3F6TA 4GEBA 3ASAA 5F9SA 4IYOB 4IXZA 1LW4A 3HDOA 4WBTA 2C0RA 3PD6A 4UHMA 1BJNA 3AEMA 3JZLA 2OATA 2V0YA 2HORA 2W8UA 1B9HA 2HOYA 4OBVA 3E2ZA 1M0NA 4F5LA 2CH1A 3A2BA 5EUNA 1ASNA 2EYQA 3B1EA 3FKDA 1SZUA 3FDBA 1G4VA 1WKHA 3LVKA 1MDOA 3PDXA 2X3LA 2BI5A 1VEFA 5D5SA 3BB8A 5G2PA 2Z20A 2Z9VA 3BWNA 2C7TA 2JGTA 1ASCA 2VIBA 4A6UA 4WB0B 4EMYA 3GSBA 3PPLA 3ATHA 2BIGA 4CBSA 3DZZA 3FTBA 4GE9A 3ECDA 3JU7A 4ADEA 4F5MA 4PVFA 3BCBA 3NTJA 4AZJA 2DKBA 2XH1A 1SFFA 3K40A 3QHXA 1TPLA 2DR1A 1AY5A 4M2KA 3RUYA 4LC3A 1YIYA 2G7JA 2BYJA 2YKVA 4KYOA 2EH6A 3MC6C 4MQRA 4U2HA 1MGVA 5EFSA 1SZKA 3RCHA 2YHKA 5M49A 5TF5A 1I41A 1AKCA 2AY7A 1DJ9A 1GC0A 3ELPA 4JF1A 3PDBB 3AENB 4MY5A 1AKBA 1PMMA 1YJYA 3QN6A 1CL1A 3OP7A 1ARSA 2HUFA 1B8GA 4GDYA 2VMNA 1WYVB 4A6TA 4WB0A 1O61A 4MQPA 1CJ0A 1IAXA 5EUDA 1V72A 1P3WA 3EZ1A 4MKKA 4XJOA 3WKRA 2X5FA 3HT4A 4ITXA 2D7ZA 4JE5A 2YOBA 3EZSA 4Q76A 2C81A 4AO9A 2R5EA 1MDZA 3A8UX 3RBLA 4AH3A 4MQQA 1UU2A 1BQAA 3RBFA 1D7UA 4W1WA 1WYUB 2CB1A 3ZRPA 5EIGB 1BJOB 2CJGA 2FQ6A 1RV4A 3H7FA 4L0OA 4JEWA 3Q8NA 4M2JA 4EB5A 3CQ5A 1S08A 2ZY3A 1MAPA 3ISLA 3MAUA 2GMSA 2W7DA 1S0AA 2YRIA 4HF8A 2D66A 5K8BA 1IX7A 2CSTA 3ACZA 3PDBA 2Z1YA 1AHEA 1JS3A 3GBXA 3DU4A 2ZYJA 4Q6RA 1B9IA 5F8VA 2FN6A 3WCNA 4UQVA 1AY8A 3WZFA 4ZM4A 3AELA 4E77A 3OKSA 3FQ7A 3H14A 4LNLA 3F0HA 5DB5A 2Z61A 2E7JA 3QI6A 4TV7A 4XEWA 3ELEA 3LVLB 3AEMC 2AY6A 2E7IA 3N7NA 4Y0HA 1BT4A 1WYUA 1FG3A 3PIUA 2HP2A 9AATA 1EG5A 3ZZJA 3MKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AZK A;  4W8I A;  2VGV A;  3IF2 A;  2AY2 A;  1VJO A;  1GC2 A;  4A72 A;  4RJY A;  2BIE A;  1Z3Z A;  3WGB A;  3NDN A;  1KMK A;  2HUI A;  3E77 A;  4W1X A;  1AJS A;  1O69 A;  2W7J A;  1GEW A;  2Q7W A;  2D65 A;  3VK4 A;  1EJI A;  3BWN C;  3HBX A;  4OYT A;  3QM2 A;  4OCA A;  3TQX A;  8AAT A;  2C44 A;  2OGE A;  3NNK A;  1C4K A;  1CQ8 A;  1FG7 A;  2BYL A;  4WXG A;  4RKC A;  4KAM A;  4WYA A;  4XK1 A;  5EQC A;  1ASG A;  4LNM A;  1KKP A;  1W7L A;  1OAT A;  1JF9 A;  1SVV A;  1V2E A;  2BI3 A;  3UWC A;  5BJ4 A;  4E1O A;  3WKS A;  3K28 A;  3EI7 A;  4OTL A;  2CH2 A;  2PB2 A;  2VLF A;  1ARH A;  3FDD A;  5DX5 A;  1CS1 A;  1IAY A;  3R9A A;  1M0Q A;  3FZ7 A;  2NMP A;  2R5C B;  3E6G A;  4JEZ A;  4TMR A;  2PB0 A;  3WGC A;  3LWS A;  1MAQ A;  4GSA A;  2VMV A;  3NU7 A;  1OXP A;  4RKD A;  3ZRQ A;  2EGY A;  1DJE A;  4R5Z A;  1C0N A;  1ART A;  1TOK A;  2BI9 A;  2YKX A;  3DC1 A;  3EUC A;  4ITG A;  2JJH A;  3W1J A;  4CBR A;  4F5I A;  5M46 A;  2FM1 A;  3QPG A;  2W7K A;  2E7U A;  2VGW A;  2VMW A;  1AMQ A;  2VYC A;  1M4N A;  3EI6 A;  3HQT A;  4AO4 A;  1I43 A;  2EO5 A;  5D95 A;  1AHX A;  1N8P A;  2BWO A;  5HXX A;  2W7I A;  1CQ7 A;  1GEX A;  1ASD A;  3HL2 A;  3DXV A;  4RIT A;  4WXF A;  3GET A;  5DJ9 A;  5FT5 A;  1O62 A;  1W7M A;  3GJU A;  2R5C A;  4NOG A;  4DBC A;  4IYO A;  2CY8 A;  4A0H A;  2ZY5 A;  3DOD A;  1EQB A;  5G0A A;  4B9B A;  3FVX A;  1KMJ A;  2AY8 A;  1J04 A;  3MBB A;  1IBJ A;  3BCA A;  3UAK A;  1AJR A;  1QJ3 A;  5M4D A;  1AX4 A;  1TAT A;  3G0T A;  4IW7 A;  4WYD A;  1GCK A;  3FVS A;  1LC7 A;  5HHY A;  4OBU A;  1LS3 A;  2EZ2 A;  3PAA A;  1X29 A;  4E3R A;  1TOE A;  4BQ0 A;  4WYF A;  4I8A A;  3KE3 A;  1G7X A;  4M2M A;  1GDE A;  4MSO A;  1DTY A;  1LK9 A;  1YIZ A;  1AHG A;  1V2D A;  2Z9W A;  3JWB A;  1C7N A;  4IX8 A;  1B5O A;  1WKG A;  4JE5 D;  1H1C A;  1JG8 A;  2WK9 A;  2AY4 A;  3JWA A;  1IVR A;  3PGY A;  1QIT A;  1TOJ A;  4OMA A;  3FFR A;  1QGN A;  2D64 A;  3A9Y A;  1S09 A;  2WK8 A;  4LW2 A;  4K2B A;  1TOI A;  1CZC A;  1AMR A;  1OHW A;  1AAW A;  1MDX A;  2X5D A;  1CL2 A;  2CJH A;  3N75 A;  1O4S A;  2W7H A;  3TCM A;  1LC8 A;  1ECX A;  1M0O A;  4A0F A;  2DGM A;  3NYU A;  4ZLV A;  4UHO A;  1MLZ A;  2E54 A;  2OKJ A;  2DKJ A;  4UHN A;  1W23 A;  1GBN A;  4ZDL A;  3JW9 A;  1ZC9 A;  3FQA A;  4ZM3 A;  3AEN A;  1XEY A;  1AKA A;  2BWN A;  1RV3 A;  1BW0 A;  2D7Y A;  3MEB A;  4JEV A;  2AAT A;  3D6K A;  4K2M A;  5G4I A;  4KXK A;  4WYC A;  4F5G A;  1GD9 A;  1WYV A;  1LKC A;  1VP4 A;  1D7V A;  4PFN A;  3NX3 A;  2VMZ A;  2FNI A;  1M7Y A;  1UKJ A;  5E3K A;  4WYG A;  1I29 A;  1IX8 A;  1JS6 A;  3N0L A;  1AMA A;  4LW4 A;  4ZWM A;  5HDM A;  2VI9 A;  4WD2 A;  2VIA A;  3WY7 A;  3A9Z A;  4IXS A;  4EB7 A;  1GC4 A;  1M0P A;  1ASA A;  2R2N A;  3B8X A;  3R4T A;  1Z7D A;  3AOW A;  2O0R A;  1IJI A;  3B1D A;  2W8T A;  4H51 A;  5EIG A;  2ZJG A;  5FT4 A;  3TAT A;  4F5H A;  4ATQ A;  4B98 A;  4O6Z A;  3VOM A;  4J5U A;  2EPJ A;  5C6U A;  1UU0 A;  1AIA A;  3AAT A;  1AHY A;  2GMU A;  3BV0 A;  5G09 A;  3COG A;  3CQ6 A;  1TAR A;  4ZAS A;  3VK3 A;  4QGR A;  2V1P A;  2DOU A;  2ZSL A;  3AEP A;  1BJ4 A;  1W7N A;  4CXQ A;  1RVU A;  3E2Y A;  4RJ0 A;  3TFT A;  2FNU A;  2BWP A;  2CAN A;  5BJ3 A;  4ZWV A;  3AEO A;  5FT8 A;  2VGT A;  3P6K A;  3B1C A;  4UOY A;  3WLX A;  4WXB A;  3QGU A;  2YRR A;  4WP0 A;  1Y4I A;  5JAY A;  5EAV A;  4F4E A;  2ZY2 A;  2O1B A;  4BA5 A;  1YJZ A;  3L8A A;  1ZOB A;  3NU8 A;  4GE4 A;  3MAF B;  3WX9 A;  4ATP A;  4PIW A;  4ZDP A;  2D61 A;  1S07 A;  2BI2 A;  1LC5 A;  3FRK A;  3FD0 A;  1ASE A;  1D7S A;  3PD6 B;  4ADB A;  4OC9 A;  2QBT A;  4OT8 A;  1ELU A;  2R0T A;  2VMR A;  4TN4 A;  2Z9X A;  4Q31 A;  1KL2 A;  1E5F A;  2CIN A;  1WST A;  4EU1 A;  1CQ6 A;  2DGK A;  2VMU A;  3I16 A;  4ZAH A;  4U1T A;  4N0W A;  2QB3 A;  4MGR A;  2W7M A;  2JJG A;  1IUG A;  3LV2 A;  4W91 A;  4Y0D A;  3GR9 A;  1ASB A;  4A0G A;  2RFV A;  1YJS A;  4RLG A;  4P7Y A;  1OHV A;  1YAA A;  4ZDO A;  4DQ6 A;  4XQ2 A;  5M4B A;  2QLR A;  3AOV A;  3K7Y A;  1W3U A;  3BN1 A;  3I5T A;  4CVQ A;  3W1I A;  3GZC A;  1SF2 A;  1QIR A;  3USF A;  4XJP A;  3FSL A;  3P1T A;  1BQD A;  3FZ6 A;  2Z1Z A;  2WK7 A;  2CFB A;  1ASM A;  4XJM A;  4P3M A;  5EUE A;  3VAX A;  2HOX A;  1X0M A;  4Y0I A;  1PFF A;  4ADC A;  3LVJ A;  4ISY A;  3FZ8 A;  4F5J A;  3AV7 A;  3RQ1 A;  2FYF A;  1N2T A;  1PMO A;  4FL0 A;  1C7G A;  4W1V A;  2JG2 A;  3I4J A;  5I92 A;  3RCH B;  3BS8 A;  3VK2 A;  1QIS A;  3G8M A;  2VMQ A;  1DGE A;  1BKG A;  4CXR A;  2BI1 A;  1AMS A;  3W1H A;  2BKW A;  2CTZ A;  2YCN A;  2HZP A;  1ORD A;  4WYE A;  1G7W A;  3GZD A;  2VGS A;  1GEY A;  3EI9 A;  1FC4 A;  2AY5 A;  3IHJ A;  2ZUK A;  4PFF A;  2WKA A;  1BJO A;  2VLH A;  4R8D A;  1LW5 A;  3JTX A;  3ZZK A;  1SPA A;  2VMP A;  1DKA A;  1GC3 A;  2PO3 A;  2YCP A;  3KGX A;  3KKI A;  3M5U A;  1OXO A;  1SZS A;  4BMK A;  2ZY4 A;  3LVM A;  5EAA A;  5G2Q A;  3AEJ A;  2VMT A;  3BC8 A;  5E5I A;  1CZE A;  3G7Q A;  2VMS A;  3E9K A;  1I48 A;  2AY1 A;  2YCT A;  4GRX A;  3NYT A;  1IX6 A;  2W8V A;  1X2A A;  1KL1 A;  1BS0 A;  4R5F A;  2VGZ A;  3GWP A;  1ARI A;  3HMU A;  5LHA A;  2Z67 A;  1MLY A;  1PG8 A;  1ELQ A;  4AOA A;  4K2I A;  3NRA A;  2W7L A;  1B5P A;  1DGD A;  1AHF A;  3CBF A;  3RI6 A;  4A0R A;  4JEX A;  4ADD A;  2W7G A;  2G6W A;  3NUI A;  2OQX A;  1AIC A;  1QZ9 A;  1XI9 A;  5DJ1 A;  3VP6 A;  2BHX A;  3EIB A;  4GE7 A;  4F5K A;  2Z9U A;  2XBN A;  4FFC A;  3DR4 A;  4LNJ A;  1D2F A;  3NUB A;  3NYS A;  1ARG A;  1ASL A;  1X28 A;  1M32 A;  2W8J A;  4RAE A;  1BJW A;  2VMX A;  2YKU A;  2YKY A;  2ZP7 A;  3BCX A;  4IY7 A;  3BWO A;  4WLH A;  5J8Q A;  4A6R A;  4RM1 A;  3FQ8 A;  4JEY A;  4E3Q A;  3CAI A;  7AAT A;  3FVU A;  2W8W A;  2X8U A;  1ZOD A;  4ZSY A;  1AJS B;  3FFH A;  3QBO A;  1UU1 A;  2O7C A;  2OKK A;  2HOZ A;  2VGU A;  4Q75 A;  3MAD A;  2BIA A;  3F9T A;  3L44 A;  1N31 A;  3A9X A;  4BA4 A;  4F5F A;  1OHY A;  1RVY A;  3HLM A;  2VI8 A;  2DGL A;  3T32 A;  1D7R A;  1TOG A;  3ASB A;  4R2N A;  3PJ0 A;  2EZ1 A;  2CJD A;  3MC6 A;  3N5M A;  2AY3 A;  1ASF A;  1C7O A;  1C9C A;  2OGA A;  5G4J A;  1DJU A;  4WLJ A;  1E5E A;  3DR7 A;  5AX8 A;  4BHD A;  2GB3 A;  2VMY A;  3EIA A;  3E2F A;  2ORD A;  2ZSM A;  4RIZ A;  1TAS A;  4DGT A;  5IWQ A;  2F8J A;  3FCR A;  3B46 A;  2HP1 A;  2VMO A;  5FT6 A;  1G4X A;  3EI5 A;  3KGW A;  2GQN A;  4ZSW A;  3UE8 A;  4HVK A;  3DXW A;  1WYT B;  2D63 A;  2GSA A;  1QJ5 A;  2D5Y A;  3DRD A;  2AY9 A;  1S06 A;  2W7F A;  3EI8 A;  4MKJ A;  3TFU A;  4IXO A;  3GZD C;  2AEU A;  3WCO A;  2ZC0 A;  1J32 A;  3CQ4 A;  2JIS A;  2JJF A;  1DFO A;  5E4Z A;  4JF0 A;  5LH9 A;  3ZRR A;  2JJE A;  1AAM A;  4XAU A;  3E2Z B;  2TPL A;  1KKJ A;  3LY1 A;  1YOO A;  2AEV A;  4W5K A;  3AEJ C;  1B4X A;  1T3I A;  4N0B A;  3PA9 A;  4A00 A;  2HUU A;  1H0C A;  1YNU A;  2QA3 A;  2QMA A;  3DYD A;  1U08 A;  4J8L A;  1V2F A;  4XJL A;  4EFF A;  1M6S A;  3LG0 A;  3II0 A;  2QB2 A;  3MAF A;  1WYT A;  1AY4 A;  1AIB A;  2W7E A;  3HVY A;  3F6T A;  4GEB A;  3ASA A;  5F9S A;  4IYO B;  4IXZ A;  1LW4 A;  3HDO A;  4WBT A;  2C0R A;  3PD6 A;  4UHM A;  1BJN A;  3AEM A;  3JZL A;  2OAT A;  2V0Y A;  2HOR A;  2W8U A;  1B9H A;  2HOY A;  4OBV A;  3E2Z A;  1M0N A;  4F5L A;  2CH1 A;  3A2B A;  5EUN A;  1ASN A;  3B1E A;  3FKD A;  1SZU A;  3FDB A;  1G4V A;  1WKH A;  3LVK A;  1MDO A;  3PDX A;  2X3L A;  2BI5 A;  1VEF A;  5D5S A;  3BB8 A;  5G2P A;  2Z20 A;  2Z9V A;  3BWN A;  2C7T A;  2JGT A;  1ASC A;  2VIB A;  4A6U A;  4WB0 B;  4EMY A;  3GSB A;  3PPL A;  3ATH A;  2BIG A;  4CBS A;  3DZZ A;  3FTB A;  4GE9 A;  3ECD A;  3JU7 A;  4ADE A;  4F5M A;  4PVF A;  3BCB A;  3NTJ A;  4AZJ A;  2DKB A;  2XH1 A;  1SFF A;  3K40 A;  3QHX A;  1TPL A;  2DR1 A;  1AY5 A;  4M2K A;  3RUY A;  4LC3 A;  1YIY A;  2BYJ A;  2YKV A;  4KYO A;  2EH6 A;  3MC6 C;  4MQR A;  4U2H A;  1MGV A;  5EFS A;  1SZK A;  3RCH A;  2YHK A;  5M49 A;  5TF5 A;  1I41 A;  1AKC A;  2AY7 A;  1DJ9 A;  1GC0 A;  3ELP A;  4JF1 A;  3PDB B;  3AEN B;  4MY5 A;  1AKB A;  1PMM A;  1YJY A;  3QN6 A;  1CL1 A;  3OP7 A;  1ARS A;  2HUF A;  1B8G A;  4GDY A;  2VMN A;  1WYV B;  4A6T A;  4WB0 A;  1O61 A;  4MQP A;  1CJ0 A;  1IAX A;  5EUD A;  1V72 A;  1P3W A;  3EZ1 A;  4MKK A;  4XJO A;  3WKR A;  2X5F A;  3HT4 A;  4ITX A;  2D7Z A;  4JE5 A;  2YOB A;  3EZS A;  4Q76 A;  2C81 A;  4AO9 A;  2R5E A;  1MDZ A;  3A8U X;  3RBL A;  4AH3 A;  4MQQ A;  1UU2 A;  1BQA A;  3RBF A;  1D7U A;  4W1W A;  1WYU B;  2CB1 A;  3ZRP A;  5EIG B;  1BJO B;  2CJG A;  2FQ6 A;  1RV4 A;  3H7F A;  4L0O A;  4JEW A;  3Q8N A;  4M2J A;  4EB5 A;  3CQ5 A;  1S08 A;  2ZY3 A;  1MAP A;  3ISL A;  3MAU A;  2GMS A;  2W7D A;  1S0A A;  2YRI A;  4HF8 A;  2D66 A;  5K8B A;  1IX7 A;  2CST A;  3ACZ A;  3PDB A;  2Z1Y A;  1AHE A;  1JS3 A;  3GBX A;  3DU4 A;  2ZYJ A;  4Q6R A;  1B9I A;  5F8V A;  2FN6 A;  3WCN A;  4UQV A;  1AY8 A;  3WZF A;  4ZM4 A;  3AEL A;  4E77 A;  3OKS A;  3FQ7 A;  3H14 A;  4LNL A;  3F0H A;  5DB5 A;  2Z61 A;  2E7J A;  3QI6 A;  4TV7 A;  4XEW A;  3ELE A;  3LVL B;  3AEM C;  2AY6 A;  2E7I A;  4Y0H A;  1BT4 A;  1WYU A;  1FG3 A;  3PIU A;  2HP2 A;  9AAT A;  1EG5 A;  3ZZJ A;  3MKJ A; 
#chains in the Genus database with same CATH topology
 4AZK A;  4W8I A;  2VGV A;  3IF2 A;  2AY2 A;  1VJO A;  1GC2 A;  4A72 A;  4RJY A;  2BIE A;  1Z3Z A;  3WGB A;  3NDN A;  1KMK A;  2HUI A;  3E77 A;  4W1X A;  1AJS A;  1O69 A;  2W7J A;  1GEW A;  2Q7W A;  2D65 A;  3VK4 A;  1EJI A;  3BWN C;  3HBX A;  4OYT A;  3N4X A;  3QM2 A;  4OCA A;  3TQX A;  8AAT A;  2C44 A;  2OGE A;  3NNK A;  1C4K A;  1CQ8 A;  1FG7 A;  2BYL A;  4WXG A;  4RKC A;  4KAM A;  4WYA A;  4XK1 A;  5EQC A;  1ASG A;  4LNM A;  1KKP A;  1W7L A;  1OAT A;  1JF9 A;  1SVV A;  1V2E A;  2BI3 A;  3UWC A;  5BJ4 A;  4E1O A;  3WKS A;  3K28 A;  3EI7 A;  4OTL A;  2CH2 A;  2PB2 A;  2VLF A;  1ARH A;  3FDD A;  5DX5 A;  1CS1 A;  1IAY A;  3R9A A;  1M0Q A;  3FZ7 A;  2NMP A;  2R5C B;  3E6G A;  4JEZ A;  4TMR A;  2PB0 A;  3WGC A;  3LWS A;  1MAQ A;  4GSA A;  2VMV A;  3NU7 A;  1OXP A;  4RKD A;  3ZRQ A;  2EGY A;  1DJE A;  4R5Z A;  1C0N A;  1ART A;  1TOK A;  2BI9 A;  2YKX A;  3DC1 A;  3EUC A;  4ITG A;  2JJH A;  3W1J A;  4CBR A;  4F5I A;  5M46 A;  2FM1 A;  3QPG A;  2W7K A;  2E7U A;  2VGW A;  2VMW A;  1AMQ A;  2VYC A;  1M4N A;  3EI6 A;  3HQT A;  4AO4 A;  1I43 A;  2EO5 A;  5D95 A;  1AHX A;  1N8P A;  2BWO A;  5HXX A;  2W7I A;  1CQ7 A;  1GEX A;  1ASD A;  3HL2 A;  3DXV A;  4RIT A;  4WXF A;  3GET A;  5DJ9 A;  5FT5 A;  1O62 A;  1W7M A;  3GJU A;  2R5C A;  4NOG A;  4DBC A;  4IYO A;  2CY8 A;  4A0H A;  2ZY5 A;  3DOD A;  1EQB A;  5G0A A;  4B9B A;  3FVX A;  1KMJ A;  2AY8 A;  1J04 A;  3MBB A;  1IBJ A;  3BCA A;  3UAK A;  1AJR A;  1QJ3 A;  5M4D A;  1AX4 A;  1TAT A;  3G0T A;  4IW7 A;  4WYD A;  2QSR A;  1GCK A;  3FVS A;  1LC7 A;  5HHY A;  4OBU A;  1LS3 A;  2EZ2 A;  3PAA A;  1X29 A;  4E3R A;  1TOE A;  4BQ0 A;  4WYF A;  4I8A A;  3KE3 A;  1G7X A;  4M2M A;  1GDE A;  4MSO A;  1DTY A;  1LK9 A;  1YIZ A;  1AHG A;  1V2D A;  2Z9W A;  3JWB A;  1C7N A;  4IX8 A;  1B5O A;  1WKG A;  4JE5 D;  1H1C A;  1JG8 A;  2WK9 A;  2AY4 A;  3JWA A;  1IVR A;  3PGY A;  1QIT A;  1TOJ A;  4OMA A;  3FFR A;  1QGN A;  2D64 A;  3A9Y A;  1S09 A;  2WK8 A;  4LW2 A;  4K2B A;  1TOI A;  1CZC A;  1AMR A;  1OHW A;  1AAW A;  1MDX A;  2X5D A;  1CL2 A;  2CJH A;  3N75 A;  1O4S A;  2W7H A;  3TCM A;  1LC8 A;  1ECX A;  1M0O A;  4A0F A;  2DGM A;  3NYU A;  4ZLV A;  4UHO A;  1MLZ A;  2E54 A;  2OKJ A;  2DKJ A;  4UHN A;  1W23 A;  1GBN A;  4ZDL A;  3JW9 A;  1ZC9 A;  3FQA A;  4ZM3 A;  3AEN A;  1XEY A;  1AKA A;  2BWN A;  1RV3 A;  1BW0 A;  2D7Y A;  3MEB A;  4JEV A;  2AAT A;  3D6K A;  4K2M A;  5G4I A;  4KXK A;  4WYC A;  4F5G A;  1GD9 A;  1WYV A;  1LKC A;  1VP4 A;  1D7V A;  4PFN A;  3NX3 A;  2VMZ A;  2FNI A;  1M7Y A;  1UKJ A;  5E3K A;  4WYG A;  1I29 A;  1IX8 A;  1JS6 A;  3N0L A;  1AMA A;  4LW4 A;  4ZWM A;  5HDM A;  2VI9 A;  4WD2 A;  2VIA A;  3WY7 A;  3A9Z A;  4IXS A;  4EB7 A;  4K05 A;  1GC4 A;  1M0P A;  1ASA A;  2R2N A;  3B8X A;  3R4T A;  1Z7D A;  3AOW A;  2O0R A;  1IJI A;  3B1D A;  2W8T A;  4H51 A;  5EIG A;  2ZJG A;  5FT4 A;  3TAT A;  4F5H A;  4ATQ A;  4B98 A;  4O6Z A;  3VOM A;  4J5U A;  2EPJ A;  5C6U A;  1UU0 A;  1AIA A;  3AAT A;  1AHY A;  2GMU A;  3BV0 A;  5G09 A;  3COG A;  3CQ6 A;  1TAR A;  4ZAS A;  3VK3 A;  4QGR A;  2V1P A;  2DOU A;  2ZSL A;  3AEP A;  1BJ4 A;  1W7N A;  4CXQ A;  1RVU A;  3E2Y A;  4RJ0 A;  3TFT A;  2FNU A;  2BWP A;  2CAN A;  5BJ3 A;  4ZWV A;  3AEO A;  5FT8 A;  2VGT A;  3P6K A;  3B1C A;  4UOY A;  3WLX A;  4WXB A;  2FKI A;  3QGU A;  2YRR A;  4WP0 A;  1Y4I A;  5JAY A;  5EAV A;  4F4E A;  2ZY2 A;  2O1B A;  4BA5 A;  1YJZ A;  3L8A A;  1ZOB A;  3NU8 A;  4GE4 A;  3MAF B;  3WX9 A;  4ATP A;  4PIW A;  4ZDP A;  2D61 A;  1S07 A;  2BI2 A;  1LC5 A;  3FRK A;  3FD0 A;  1ASE A;  1D7S A;  3PD6 B;  4ADB A;  4OC9 A;  2QBT A;  4OT8 A;  1ELU A;  2R0T A;  2VMR A;  4TN4 A;  2Z9X A;  4Q31 A;  1KL2 A;  1E5F A;  2CIN A;  1WST A;  4EU1 A;  1CQ6 A;  2DGK A;  2VMU A;  3I16 A;  4ZAH A;  4U1T A;  4N0W A;  2QB3 A;  4MGR A;  2W7M A;  2JJG A;  1IUG A;  3LV2 A;  4W91 A;  4Y0D A;  3GR9 A;  1ASB A;  4A0G A;  2RFV A;  1YJS A;  4RLG A;  4P7Y A;  1OHV A;  1YAA A;  4ZDO A;  4DQ6 A;  4XQ2 A;  5M4B A;  2QLR A;  3AOV A;  3K7Y A;  1W3U A;  3BN1 A;  3I5T A;  4CVQ A;  3W1I A;  3GZC A;  1SF2 A;  1QIR A;  3USF A;  4XJP A;  3FSL A;  3P1T A;  1BQD A;  3FZ6 A;  2Z1Z A;  2WK7 A;  2CFB A;  1ASM A;  4XJM A;  4P3M A;  5EUE A;  3VAX A;  2HOX A;  1X0M A;  4Y0I A;  1PFF A;  4ADC A;  3LVJ A;  4ISY A;  3FZ8 A;  4F5J A;  3AV7 A;  3RQ1 A;  2FYF A;  1N2T A;  1PMO A;  4FL0 A;  4H63 Q;  1C7G A;  4W1V A;  2JG2 A;  3I4J A;  5I92 A;  3RCH B;  3BS8 A;  3VK2 A;  1QIS A;  3G8M A;  2VMQ A;  1DGE A;  1BKG A;  4CXR A;  2BI1 A;  1AMS A;  3W1H A;  2BKW A;  2CTZ A;  2YCN A;  2HZP A;  1ORD A;  4WYE A;  1G7W A;  3GZD A;  2VGS A;  1GEY A;  3EI9 A;  1FC4 A;  2AY5 A;  3IHJ A;  2ZUK A;  4PFF A;  2WKA A;  1BJO A;  2VLH A;  4R8D A;  1LW5 A;  3JTX A;  3ZZK A;  1SPA A;  2VMP A;  1DKA A;  1GC3 A;  2PO3 A;  2YCP A;  3KGX A;  3KKI A;  3M5U A;  1OXO A;  1SZS A;  4BMK A;  2ZY4 A;  3LVM A;  5EAA A;  5G2Q A;  3AEJ A;  2VMT A;  3BC8 A;  5E5I A;  1CZE A;  3G7Q A;  2VMS A;  3E9K A;  1I48 A;  2AY1 A;  2YCT A;  4GRX A;  3NYT A;  1IX6 A;  3N4R A;  2W8V A;  1X2A A;  1KL1 A;  1BS0 A;  4R5F A;  2VGZ A;  3GWP A;  1ARI A;  3HMU A;  5LHA A;  2Z67 A;  1MLY A;  1PG8 A;  1ELQ A;  4AOA A;  4K2I A;  3NRA A;  2W7L A;  1B5P A;  1DGD A;  1AHF A;  3CBF A;  3RI6 A;  4A0R A;  4JEX A;  4ADD A;  2W7G A;  2G6W A;  3NUI A;  2OQX A;  1AIC A;  1QZ9 A;  1XI9 A;  5DJ1 A;  3VP6 A;  2BHX A;  3EIB A;  4GE7 A;  4F5K A;  2Z9U A;  2XBN A;  4FFC A;  3DR4 A;  4LNJ A;  1D2F A;  3NUB A;  3NYS A;  1ARG A;  1ASL A;  1X28 A;  1M32 A;  2W8J A;  4RAE A;  1BJW A;  2VMX A;  2YKU A;  2YKY A;  2ZP7 A;  3BCX A;  4IY7 A;  3BWO A;  4WLH A;  5J8Q A;  4A6R A;  4RM1 A;  3FQ8 A;  4JEY A;  4E3Q A;  3CAI A;  7AAT A;  3FVU A;  2W8W A;  2X8U A;  1ZOD A;  4ZSY A;  1AJS B;  3FFH A;  3QBO A;  1UU1 A;  2O7C A;  2OKK A;  2HOZ A;  2VGU A;  4Q75 A;  3MAD A;  2BIA A;  3F9T A;  3L44 A;  1N31 A;  3A9X A;  4BA4 A;  4F5F A;  5KTB A;  1OHY A;  1RVY A;  3HLM A;  2VI8 A;  2DGL A;  3T32 A;  1D7R A;  1TOG A;  3ASB A;  4R2N A;  3PJ0 A;  2EZ1 A;  2CJD A;  3MC6 A;  3N5M A;  2AY3 A;  1ASF A;  1C7O A;  1C9C A;  2OGA A;  5G4J A;  1DJU A;  4WLJ A;  1E5E A;  3DR7 A;  5AX8 A;  4BHD A;  2GB3 A;  2VMY A;  3EIA A;  3E2F A;  2ORD A;  2ZSM A;  4RIZ A;  1TAS A;  4DGT A;  5IWQ A;  2F8J A;  3FCR A;  3B46 A;  2HP1 A;  2VMO A;  5FT6 A;  1G4X A;  3EI5 A;  3KGW A;  2GQN A;  4ZSW A;  3N4S A;  3UE8 A;  4HVK A;  3DXW A;  1WYT B;  2D63 A;  2GSA A;  1QJ5 A;  2D5Y A;  2KFP A;  3DRD A;  2AY9 A;  1S06 A;  2W7F A;  3EI8 A;  4MKJ A;  3TFU A;  4IXO A;  3GZD C;  2AEU A;  3WCO A;  2ZC0 A;  3H9X A;  1J32 A;  3CQ4 A;  2JIS A;  2JJF A;  1DFO A;  5E4Z A;  4JF0 A;  5LH9 A;  3ZRR A;  2JJE A;  1AAM A;  4XAU A;  3E2Z B;  2TPL A;  2A1V A;  1KKJ A;  3LY1 A;  1YOO A;  2AEV A;  4W5K A;  3AEJ C;  1B4X A;  1T3I A;  4N0B A;  3PA9 A;  4A00 A;  2HUU A;  1H0C A;  1YNU A;  2QA3 A;  2QMA A;  3DYD A;  1U08 A;  4J8L A;  1V2F A;  4XJL A;  4EFF A;  1M6S A;  3LG0 A;  3II0 A;  2QB2 A;  2WB6 A;  3MAF A;  1WYT A;  1AY4 A;  1AIB A;  2W7E A;  3HVY A;  3F6T A;  4GEB A;  3ASA A;  5F9S A;  4IYO B;  4IXZ A;  1LW4 A;  3HDO A;  4WBT A;  2C0R A;  3PD6 A;  4UHM A;  1BJN A;  3AEM A;  3JZL A;  2OAT A;  2V0Y A;  2HOR A;  2W8U A;  1B9H A;  2HOY A;  4OBV A;  3E2Z A;  1M0N A;  4F5L A;  2CH1 A;  3A2B A;  5EUN A;  1ASN A;  2EYQ A;  3B1E A;  3FKD A;  1SZU A;  3FDB A;  1G4V A;  1WKH A;  3LVK A;  1MDO A;  3PDX A;  2X3L A;  2BI5 A;  1VEF A;  1KAF A;  5D5S A;  3BB8 A;  5G2P A;  2Z20 A;  2Z9V A;  3BWN A;  2C7T A;  2JGT A;  1ASC A;  2VIB A;  4A6U A;  4WB0 B;  4EMY A;  3GSB A;  3PPL A;  3ATH A;  2BIG A;  4CBS A;  3DZZ A;  3FTB A;  4GE9 A;  3ECD A;  3JU7 A;  4ADE A;  4F5M A;  4PVF A;  3BCB A;  3NTJ A;  4AZJ A;  2DKB A;  2XH1 A;  1SFF A;  3K40 A;  3QHX A;  1TPL A;  2DR1 A;  1AY5 A;  4M2K A;  3RUY A;  4LC3 A;  1YIY A;  2G7J A;  2BYJ A;  2YKV A;  4KYO A;  2EH6 A;  3MC6 C;  4MQR A;  4U2H A;  1MGV A;  5EFS A;  1SZK A;  3RCH A;  2YHK A;  5M49 A;  5TF5 A;  1I41 A;  1AKC A;  2AY7 A;  1DJ9 A;  1GC0 A;  3ELP A;  4JF1 A;  3PDB B;  3AEN B;  4MY5 A;  1AKB A;  1PMM A;  1YJY A;  3QN6 A;  1CL1 A;  3OP7 A;  1ARS A;  2HUF A;  1B8G A;  4GDY A;  2VMN A;  1WYV B;  4A6T A;  4WB0 A;  1O61 A;  4MQP A;  1CJ0 A;  1IAX A;  5EUD A;  1V72 A;  1P3W A;  3EZ1 A;  4MKK A;  4XJO A;  3WKR A;  2X5F A;  3HT4 A;  4ITX A;  2D7Z A;  4JE5 A;  2YOB A;  3EZS A;  4Q76 A;  2C81 A;  4AO9 A;  2R5E A;  1MDZ A;  3A8U X;  3RBL A;  4AH3 A;  4MQQ A;  1UU2 A;  1BQA A;  3RBF A;  1D7U A;  4W1W A;  1WYU B;  2CB1 A;  3ZRP A;  5EIG B;  1BJO B;  2CJG A;  2FQ6 A;  1RV4 A;  3H7F A;  4L0O A;  4JEW A;  3Q8N A;  4M2J A;  4EB5 A;  3CQ5 A;  1S08 A;  2ZY3 A;  1MAP A;  3ISL A;  3MAU A;  2GMS A;  2W7D A;  1S0A A;  2YRI A;  4HF8 A;  2D66 A;  5K8B A;  1IX7 A;  2CST A;  3ACZ A;  3PDB A;  2Z1Y A;  1AHE A;  1JS3 A;  3GBX A;  3DU4 A;  2ZYJ A;  4Q6R A;  1B9I A;  5F8V A;  2FN6 A;  3WCN A;  4UQV A;  1AY8 A;  3WZF A;  4ZM4 A;  3AEL A;  4E77 A;  3OKS A;  3FQ7 A;  3H14 A;  4LNL A;  3F0H A;  5DB5 A;  2Z61 A;  2E7J A;  3QI6 A;  4TV7 A;  4XEW A;  3ELE A;  3LVL B;  3AEM C;  2AY6 A;  2E7I A;  3N7N A;  4Y0H A;  1BT4 A;  1WYU A;  1FG3 A;  3PIU A;  2HP2 A;  9AAT A;  1EG5 A;  3ZZJ A;  3MKJ A; 
#chains in the Genus database with same CATH homology
 4AZK A;  4W8I A;  2VGV A;  3IF2 A;  2AY2 A;  1VJO A;  1GC2 A;  4A72 A;  4RJY A;  2BIE A;  1Z3Z A;  3WGB A;  3NDN A;  1KMK A;  2HUI A;  3E77 A;  4W1X A;  1AJS A;  1O69 A;  2W7J A;  1GEW A;  2Q7W A;  2D65 A;  3VK4 A;  1EJI A;  3BWN C;  3HBX A;  4OYT A;  3N4X A;  3QM2 A;  4OCA A;  3TQX A;  8AAT A;  2C44 A;  2OGE A;  3NNK A;  1C4K A;  1CQ8 A;  1FG7 A;  2BYL A;  4WXG A;  4RKC A;  4KAM A;  4WYA A;  4XK1 A;  5EQC A;  1ASG A;  4LNM A;  1KKP A;  1W7L A;  1OAT A;  1JF9 A;  1SVV A;  1V2E A;  2BI3 A;  3UWC A;  5BJ4 A;  4E1O A;  3WKS A;  3K28 A;  3EI7 A;  4OTL A;  2CH2 A;  2PB2 A;  2VLF A;  1ARH A;  3FDD A;  5DX5 A;  1CS1 A;  1IAY A;  3R9A A;  1M0Q A;  3FZ7 A;  2NMP A;  2R5C B;  3E6G A;  4JEZ A;  4TMR A;  2PB0 A;  3WGC A;  3LWS A;  1MAQ A;  4GSA A;  2VMV A;  3NU7 A;  1OXP A;  4RKD A;  3ZRQ A;  2EGY A;  1DJE A;  4R5Z A;  1C0N A;  1ART A;  1TOK A;  2BI9 A;  2YKX A;  3DC1 A;  3EUC A;  4ITG A;  2JJH A;  3W1J A;  4CBR A;  4F5I A;  5M46 A;  2FM1 A;  3QPG A;  2W7K A;  2E7U A;  2VGW A;  2VMW A;  1AMQ A;  2VYC A;  1M4N A;  3EI6 A;  3HQT A;  4AO4 A;  1I43 A;  2EO5 A;  5D95 A;  1AHX A;  1N8P A;  2BWO A;  5HXX A;  2W7I A;  1CQ7 A;  1GEX A;  1ASD A;  3HL2 A;  3DXV A;  4RIT A;  4WXF A;  3GET A;  5DJ9 A;  5FT5 A;  1O62 A;  1W7M A;  3GJU A;  2R5C A;  4NOG A;  4DBC A;  4IYO A;  2CY8 A;  4A0H A;  2ZY5 A;  3DOD A;  1EQB A;  5G0A A;  4B9B A;  3FVX A;  1KMJ A;  2AY8 A;  1J04 A;  3MBB A;  1IBJ A;  3BCA A;  3UAK A;  1AJR A;  1QJ3 A;  5M4D A;  1AX4 A;  1TAT A;  3G0T A;  4IW7 A;  4WYD A;  2QSR A;  1GCK A;  3FVS A;  1LC7 A;  5HHY A;  4OBU A;  1LS3 A;  2EZ2 A;  3PAA A;  1X29 A;  4E3R A;  1TOE A;  4BQ0 A;  4WYF A;  4I8A A;  3KE3 A;  1G7X A;  4M2M A;  1GDE A;  4MSO A;  1DTY A;  1LK9 A;  1YIZ A;  1AHG A;  1V2D A;  2Z9W A;  3JWB A;  1C7N A;  4IX8 A;  1B5O A;  1WKG A;  4JE5 D;  1H1C A;  1JG8 A;  2WK9 A;  2AY4 A;  3JWA A;  1IVR A;  3PGY A;  1QIT A;  1TOJ A;  4OMA A;  3FFR A;  1QGN A;  2D64 A;  3A9Y A;  1S09 A;  2WK8 A;  4LW2 A;  4K2B A;  1TOI A;  1CZC A;  1AMR A;  1OHW A;  1AAW A;  1MDX A;  2X5D A;  1CL2 A;  2CJH A;  3N75 A;  1O4S A;  2W7H A;  3TCM A;  1LC8 A;  1ECX A;  1M0O A;  4A0F A;  2DGM A;  3NYU A;  4ZLV A;  4UHO A;  1MLZ A;  2E54 A;  2OKJ A;  2DKJ A;  4UHN A;  1W23 A;  1GBN A;  4ZDL A;  3JW9 A;  1ZC9 A;  3FQA A;  4ZM3 A;  3AEN A;  1XEY A;  1AKA A;  2BWN A;  1RV3 A;  1BW0 A;  2D7Y A;  3MEB A;  4JEV A;  2AAT A;  3D6K A;  4K2M A;  5G4I A;  4KXK A;  4WYC A;  4F5G A;  1GD9 A;  1WYV A;  1LKC A;  1VP4 A;  1D7V A;  4PFN A;  3NX3 A;  2VMZ A;  2FNI A;  1M7Y A;  1UKJ A;  5E3K A;  4WYG A;  1I29 A;  1IX8 A;  1JS6 A;  3N0L A;  1AMA A;  4LW4 A;  4ZWM A;  5HDM A;  2VI9 A;  4WD2 A;  2VIA A;  3WY7 A;  3A9Z A;  4IXS A;  4EB7 A;  4K05 A;  1GC4 A;  1M0P A;  1ASA A;  2R2N A;  3B8X A;  3R4T A;  1Z7D A;  3AOW A;  2O0R A;  1IJI A;  3B1D A;  2W8T A;  4H51 A;  5EIG A;  2ZJG A;  5FT4 A;  3TAT A;  4F5H A;  4ATQ A;  4B98 A;  4O6Z A;  3VOM A;  4J5U A;  2EPJ A;  5C6U A;  1UU0 A;  1AIA A;  3AAT A;  1AHY A;  2GMU A;  3BV0 A;  5G09 A;  3COG A;  3CQ6 A;  1TAR A;  4ZAS A;  3VK3 A;  4QGR A;  2V1P A;  2DOU A;  2ZSL A;  3AEP A;  1BJ4 A;  1W7N A;  4CXQ A;  1RVU A;  3E2Y A;  4RJ0 A;  3TFT A;  2FNU A;  2BWP A;  2CAN A;  5BJ3 A;  4ZWV A;  3AEO A;  5FT8 A;  2VGT A;  3P6K A;  3B1C A;  4UOY A;  3WLX A;  4WXB A;  2FKI A;  3QGU A;  2YRR A;  4WP0 A;  1Y4I A;  5JAY A;  5EAV A;  4F4E A;  2ZY2 A;  2O1B A;  4BA5 A;  1YJZ A;  3L8A A;  1ZOB A;  3NU8 A;  4GE4 A;  3MAF B;  3WX9 A;  4ATP A;  4PIW A;  4ZDP A;  2D61 A;  1S07 A;  2BI2 A;  1LC5 A;  3FRK A;  3FD0 A;  1ASE A;  1D7S A;  3PD6 B;  4ADB A;  4OC9 A;  2QBT A;  4OT8 A;  1ELU A;  2R0T A;  2VMR A;  4TN4 A;  2Z9X A;  4Q31 A;  1KL2 A;  1E5F A;  2CIN A;  1WST A;  4EU1 A;  1CQ6 A;  2DGK A;  2VMU A;  3I16 A;  4ZAH A;  4U1T A;  4N0W A;  2QB3 A;  4MGR A;  2W7M A;  2JJG A;  1IUG A;  3LV2 A;  4W91 A;  4Y0D A;  3GR9 A;  1ASB A;  4A0G A;  2RFV A;  1YJS A;  4RLG A;  4P7Y A;  1OHV A;  1YAA A;  4ZDO A;  4DQ6 A;  4XQ2 A;  5M4B A;  2QLR A;  3AOV A;  3K7Y A;  1W3U A;  3BN1 A;  3I5T A;  4CVQ A;  3W1I A;  3GZC A;  1SF2 A;  1QIR A;  3USF A;  4XJP A;  3FSL A;  3P1T A;  1BQD A;  3FZ6 A;  2Z1Z A;  2WK7 A;  2CFB A;  1ASM A;  4XJM A;  4P3M A;  5EUE A;  3VAX A;  2HOX A;  1X0M A;  4Y0I A;  1PFF A;  4ADC A;  3LVJ A;  4ISY A;  3FZ8 A;  4F5J A;  3AV7 A;  3RQ1 A;  2FYF A;  1N2T A;  1PMO A;  4FL0 A;  4H63 Q;  1C7G A;  4W1V A;  2JG2 A;  3I4J A;  5I92 A;  3RCH B;  3BS8 A;  3VK2 A;  1QIS A;  3G8M A;  2VMQ A;  1DGE A;  1BKG A;  4CXR A;  2BI1 A;  1AMS A;  3W1H A;  2BKW A;  2CTZ A;  2YCN A;  2HZP A;  1ORD A;  4WYE A;  1G7W A;  3GZD A;  2VGS A;  1GEY A;  3EI9 A;  1FC4 A;  2AY5 A;  3IHJ A;  2ZUK A;  4PFF A;  2WKA A;  1BJO A;  2VLH A;  4R8D A;  1LW5 A;  3JTX A;  3ZZK A;  1SPA A;  2VMP A;  1DKA A;  1GC3 A;  2PO3 A;  2YCP A;  3KGX A;  3KKI A;  3M5U A;  1OXO A;  1SZS A;  4BMK A;  2ZY4 A;  3LVM A;  5EAA A;  5G2Q A;  3AEJ A;  2VMT A;  3BC8 A;  5E5I A;  1CZE A;  3G7Q A;  2VMS A;  3E9K A;  1I48 A;  2AY1 A;  2YCT A;  4GRX A;  3NYT A;  1IX6 A;  3N4R A;  2W8V A;  1X2A A;  1KL1 A;  1BS0 A;  4R5F A;  2VGZ A;  3GWP A;  1ARI A;  3HMU A;  5LHA A;  2Z67 A;  1MLY A;  1PG8 A;  1ELQ A;  4AOA A;  4K2I A;  3NRA A;  2W7L A;  1B5P A;  1DGD A;  1AHF A;  3CBF A;  3RI6 A;  4A0R A;  4JEX A;  4ADD A;  2W7G A;  2G6W A;  3NUI A;  2OQX A;  1AIC A;  1QZ9 A;  1XI9 A;  5DJ1 A;  3VP6 A;  2BHX A;  3EIB A;  4GE7 A;  4F5K A;  2Z9U A;  2XBN A;  4FFC A;  3DR4 A;  4LNJ A;  1D2F A;  3NUB A;  3NYS A;  1ARG A;  1ASL A;  1X28 A;  1M32 A;  2W8J A;  4RAE A;  1BJW A;  2VMX A;  2YKU A;  2YKY A;  2ZP7 A;  3BCX A;  4IY7 A;  3BWO A;  4WLH A;  5J8Q A;  4A6R A;  4RM1 A;  3FQ8 A;  4JEY A;  4E3Q A;  3CAI A;  7AAT A;  3FVU A;  2W8W A;  2X8U A;  1ZOD A;  4ZSY A;  1AJS B;  3FFH A;  3QBO A;  1UU1 A;  2O7C A;  2OKK A;  2HOZ A;  2VGU A;  4Q75 A;  3MAD A;  2BIA A;  3F9T A;  3L44 A;  1N31 A;  3A9X A;  4BA4 A;  4F5F A;  5KTB A;  1OHY A;  1RVY A;  3HLM A;  2VI8 A;  2DGL A;  3T32 A;  1D7R A;  1TOG A;  3ASB A;  4R2N A;  3PJ0 A;  2EZ1 A;  2CJD A;  3MC6 A;  3N5M A;  2AY3 A;  1ASF A;  1C7O A;  1C9C A;  2OGA A;  5G4J A;  1DJU A;  4WLJ A;  1E5E A;  3DR7 A;  5AX8 A;  4BHD A;  2GB3 A;  2VMY A;  3EIA A;  3E2F A;  2ORD A;  2ZSM A;  4RIZ A;  1TAS A;  4DGT A;  5IWQ A;  2F8J A;  3FCR A;  3B46 A;  2HP1 A;  2VMO A;  5FT6 A;  1G4X A;  3EI5 A;  3KGW A;  2GQN A;  4ZSW A;  3N4S A;  3UE8 A;  4HVK A;  3DXW A;  1WYT B;  2D63 A;  2GSA A;  1QJ5 A;  2D5Y A;  2KFP A;  3DRD A;  2AY9 A;  1S06 A;  2W7F A;  3EI8 A;  4MKJ A;  3TFU A;  4IXO A;  3GZD C;  2AEU A;  3WCO A;  2ZC0 A;  3H9X A;  1J32 A;  3CQ4 A;  2JIS A;  2JJF A;  1DFO A;  5E4Z A;  4JF0 A;  5LH9 A;  3ZRR A;  2JJE A;  1AAM A;  4XAU A;  3E2Z B;  2TPL A;  2A1V A;  1KKJ A;  3LY1 A;  1YOO A;  2AEV A;  4W5K A;  3AEJ C;  1B4X A;  1T3I A;  4N0B A;  3PA9 A;  4A00 A;  2HUU A;  1H0C A;  1YNU A;  2QA3 A;  2QMA A;  3DYD A;  1U08 A;  4J8L A;  1V2F A;  4XJL A;  4EFF A;  1M6S A;  3LG0 A;  3II0 A;  2QB2 A;  2WB6 A;  3MAF A;  1WYT A;  1AY4 A;  1AIB A;  2W7E A;  3HVY A;  3F6T A;  4GEB A;  3ASA A;  5F9S A;  4IYO B;  4IXZ A;  1LW4 A;  3HDO A;  4WBT A;  2C0R A;  3PD6 A;  4UHM A;  1BJN A;  3AEM A;  3JZL A;  2OAT A;  2V0Y A;  2HOR A;  2W8U A;  1B9H A;  2HOY A;  4OBV A;  3E2Z A;  1M0N A;  4F5L A;  2CH1 A;  3A2B A;  5EUN A;  1ASN A;  2EYQ A;  3B1E A;  3FKD A;  1SZU A;  3FDB A;  1G4V A;  1WKH A;  3LVK A;  1MDO A;  3PDX A;  2X3L A;  2BI5 A;  1VEF A;  5D5S A;  3BB8 A;  5G2P A;  2Z20 A;  2Z9V A;  3BWN A;  2C7T A;  2JGT A;  1ASC A;  2VIB A;  4A6U A;  4WB0 B;  4EMY A;  3GSB A;  3PPL A;  3ATH A;  2BIG A;  4CBS A;  3DZZ A;  3FTB A;  4GE9 A;  3ECD A;  3JU7 A;  4ADE A;  4F5M A;  4PVF A;  3BCB A;  3NTJ A;  4AZJ A;  2DKB A;  2XH1 A;  1SFF A;  3K40 A;  3QHX A;  1TPL A;  2DR1 A;  1AY5 A;  4M2K A;  3RUY A;  4LC3 A;  1YIY A;  2G7J A;  2BYJ A;  2YKV A;  4KYO A;  2EH6 A;  3MC6 C;  4MQR A;  4U2H A;  1MGV A;  5EFS A;  1SZK A;  3RCH A;  2YHK A;  5M49 A;  5TF5 A;  1I41 A;  1AKC A;  2AY7 A;  1DJ9 A;  1GC0 A;  3ELP A;  4JF1 A;  3PDB B;  3AEN B;  4MY5 A;  1AKB A;  1PMM A;  1YJY A;  3QN6 A;  1CL1 A;  3OP7 A;  1ARS A;  2HUF A;  1B8G A;  4GDY A;  2VMN A;  1WYV B;  4A6T A;  4WB0 A;  1O61 A;  4MQP A;  1CJ0 A;  1IAX A;  5EUD A;  1V72 A;  1P3W A;  3EZ1 A;  4MKK A;  4XJO A;  3WKR A;  2X5F A;  3HT4 A;  4ITX A;  2D7Z A;  4JE5 A;  2YOB A;  3EZS A;  4Q76 A;  2C81 A;  4AO9 A;  2R5E A;  1MDZ A;  3A8U X;  3RBL A;  4AH3 A;  4MQQ A;  1UU2 A;  1BQA A;  3RBF A;  1D7U A;  4W1W A;  1WYU B;  2CB1 A;  3ZRP A;  5EIG B;  1BJO B;  2CJG A;  2FQ6 A;  1RV4 A;  3H7F A;  4L0O A;  4JEW A;  3Q8N A;  4M2J A;  4EB5 A;  3CQ5 A;  1S08 A;  2ZY3 A;  1MAP A;  3ISL A;  3MAU A;  2GMS A;  2W7D A;  1S0A A;  2YRI A;  4HF8 A;  2D66 A;  5K8B A;  1IX7 A;  2CST A;  3ACZ A;  3PDB A;  2Z1Y A;  1AHE A;  1JS3 A;  3GBX A;  3DU4 A;  2ZYJ A;  4Q6R A;  1B9I A;  5F8V A;  2FN6 A;  3WCN A;  4UQV A;  1AY8 A;  3WZF A;  4ZM4 A;  3AEL A;  4E77 A;  3OKS A;  3FQ7 A;  3H14 A;  4LNL A;  3F0H A;  5DB5 A;  2Z61 A;  2E7J A;  3QI6 A;  4TV7 A;  4XEW A;  3ELE A;  3LVL B;  3AEM C;  2AY6 A;  2E7I A;  3N7N A;  4Y0H A;  1BT4 A;  1WYU A;  1FG3 A;  3PIU A;  2HP2 A;  9AAT A;  1EG5 A;  3ZZJ A;  3MKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...