2FMAA

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'small unit cell' form, atomic resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein precursor
publication title Structure of Alzheimer's disease amyloid precursor protein copper-binding domain at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fmaA00
3KTMA 2M05A 4PWQA 2FK1A 2FK2A 1OWTA 2FJZA 2FKLA 2FMAA 2FK3A
chains in the Genus database with same CATH superfamily
1BJTA 3KHRA 3FMAA 1KJQA 2ZJTA 2RDJA 3PR5B 1I94H 2PBZA 5IYCG 1FVIA 2YYAA 3H40A 4HNUA 3GQCA 5K2MA 1RJRA 4ETSA 3PW5A 2F4VH 2WB1A 4B3RH 3RJ0A 2AGQA 2R7KA 5IP7G 5DG9A 3BA9A 2YZGA 2CW7A 1KJIA 5EZYF 4U6PA 4UCRA 2YS7A 3M9MB 2I8CA 4QIWE 2W6ZA 2YL2A 5C8YF 4LF4H 4ECUA 2W6NA 5FD5A 4GC6A 4B3MH 4ED8A 2R6FA 1S68A 3GTMA 4IWXA 2HJWA 3ORRA 1B33N 5C1PA 4JV1A 4I7HA 3PW0A 3R5FA 2AGOA 3N44B 4PWQA 1VAJA 3FKIA 3ORQA 4WBNF 3RAQA 2JA7A 3RUPA 2Y0SA 4Y8VB 3FKIG 1DGSA 1HNZH 5KFGA 1K83A 2DZDA 4Q45A 4YR0A 1R9TA 5DGBA 4MA0A 4YHHH 4MV3A 1B6RA 3BAAA 4QWCA 4UCOA 3MFIA 2W7OA 4KHPH 3MR2A 3Q8RB 4YR2A 1Z2OX 5EWFA 1J5EH 1SFOA 5T14A 3GTLA 2XCLA 1JLLB 1V4YA 5L1LA 3KAJA 3GIQA 5CA0F 2R8KA 4LF8H 4BY7G 2VQFH 2UXCH 2FPPB 4MV8A 1N33H 3N41B 4ECYA 2C28A 4RUAA 2YZNA 1AUXA 4EFBA 1ZHSA 2JA6A 1M6VA 2IP4A 3HBLA 4TV9F 1JDBB 3H4DA 2VOBA 3KXYT 3VMMA 4DV7H 4LSXA 4R8UA 3GV5B 4X64H 1HR0H 4I4TF 3I12A 4J9KA 4GKJH 4ED7A 4O4LF 5KFHA 1T94A 5BR8H 4A3LG 4ED1A 2YRWA 4YBZB 4HNTA 5KFQA 3TQ1A 1EZ1A 4LF5H 5KFWA 4QW8A 3Q8PB 5IP9G 1RYSA 3V4ZA 1E4EB 2UUBH 5IYBG 2R7MA 2PMZE 4ZQIA 3RB0A 4EGJA 2FK1A 4XYLB 4JI2H 1JX4A 2IMWP 2NU7B 4J9QA 3WO0A 4DUZH 3GIIA 3HOZG 4F4WA 3JSNA 2V59A 1TWCA 4RNNA 1GSOA 5IT9W 5DQHA 2JEGA 4CC5A 2YW2A 4J9NA 2Q2TA 5C44G 5HV6A 3HOWG 3TINA 4CC6A 3UFXB 5KFLA 4BBRG 5KFPA 2AU0A 2WE6A 2UUAH 4A2BA 3HOUG 3WNZA 4E4TA 3L2PA 5LOVF 3HKZE 4HNVA 1SEIA 2E5LH 2UUCH 2W57A 5EWEA 1ZHQA 5KG6A 1E4GT 5FLXW 4J9RA 2GLTA 4DV0H 4DV4H 5IWAH 4QWBA 2YRXA 4LFCH 1RK5A 2C00A 5KFDA 4J9PA 5JUMA 4JI4H 3OHAA 1RK6A 2Q2UA 3T5LA 3K5IA 4DL5A 2ZDHA 3G6YA 4YQWA 5DG7A 2HGSA 4Q8FA 3T1YH 4ECTA 4I55F 2J9GA 4O3PA 3BJYA 1BGWA 2W6MA 3RB6A 4A3IG 1XDNA 4OX9H 4J0MA 1PK8A 4MA5A 2M05A 4XYMB 5IYDG 2VUMA 3LWBA 4O3SA 1IOVA 1EYZA 2QK4A 2V9WA 4IRDA 3T1HH 2O03A 1A9XA 4IZOA 4ECVA 3SE7A 4ECXA 3BQ1A 1O75A 4K0KH 1RJQA 4MTEA 4F4YA 5EDWA 3GTOA 2J6SA 2VR1A 1AN7A 2HVSA 3U9SA 3H0GG 5F9LA 4FBUA 2WAQA 4GLXA 2R7ZA 2ZDQA 4DL4A 2ASDA 2VPSA 3N6XA 4F4XA 4MV1A 3GIJA 5KFCA 1Y1WG 2FLLA 1GYFA 3IG0A 1AUVA 4HQ6A 1N32H 2Y0SE 5FPOA 1Z2PX 3HOXG 4A3EG 4JI6H 2FMAA 4LFAH 4Q8EA 2HVRA 2W9CA 2BR0A 1Y1VA 5KX5F 5DG8A 3Q8QB 1IBMH 2SCUB 1HNWH 2FPIB 1Y1VG 3J80W 5L1IA 1VBHA 3IN5A 1DV1A 2R7NA 3K3VA 5LYJF 2W9BA 5L1JA 4LH6A 1DIKA 2HVQA 4YJ3F 1L2ZA 1UC8A 4DR4H 2OWOA 5KFJA 4ECZA 4DV3H 1OWTA 4MV6A 5DLGA 2AQ4A 1W96A 5JH7F 5JQWA 2NUAB 3M9OB 3GILA 3KTMA 2J6UA 4X66H 3Q1KA 3OSPA 3N40P 4FU0A 2NU6B 2FKLA 2J6TA 4O3QA 3GTGA 2UVUA 2C22A 4YR3A 3PZPA 3R5XA 1XMQH 3BA8A 2XGPA 1S03G 4QWDA 2R8JA 4DR5H 2XCPA 2CKZB 4Q0YA 1GGOA 4A3JG 2R84A 2JA7G 3HXLA 3M4IA 5KG4A 3V6KA 4JV2A 4Q43A 2UVRA 5J2UF 4O4IF 1VKZA 2PVPA 4UCVA 5I47A 4TQSA 5KFIA 4EYIB 4EBEA 4C5CA 1KJJA 3QZ8A 1B04A 3F8NA 3BG5A 4A3KG 2VA2A 1RYRA 4I50F 4DR1H 2IBKA 1I6UA 2ASJA 4QWAA 3RGXA 4J9SA 5LA6F 2FK2A 1I3QA 3KHHA 4YJ2F 2R93A 2NVYA 5KG7A 3ETJA 5KFAA 4JYAH 2W70A 1RJPA 1S0MA 4QW9A 1WR2A 1WCMA 4RAYA 4MV4A 3E5NA 2JA6G 5KG0A 3UQ8A 3V6JA 3TIGA 1I7NA 5H80A 2MCTA 2I80A 4LSAA 1T36A 3GLKA 3MFHA 4ECRA 5JVDF 2YS6A 4DV5H 4A3BG 4A3CG 1E4FT 3VPCA 4RZRA 5D1OA 4X62H 1UC9A 5LP6F 3PN1A 4JV0A 5KG5A 1IOWA 4BBSG 4LF6H 4QIWA 2R7LA 1BXRA 2JA8G 3MWDA 2B63A 1SCUB 5C1OA 3V6HA 4B3TH 2FB9A 4BWSC 2W8KA 5KFSA 3RV4A 3GIMA 5KFBA 5A2QW 2YCHA 3N43B 4O2AF 4ZOLF 4A2AA 5FPRA 1GLVA 4JI3H 3NGDA 1TWGA 1T3NA 1TWFA 4JI5H 4IAJA 2R85A 4ZI7F 1IBKH 1CQJB 4YB8B 3MR5A 3OUUA 5DLFA 4TQRA 4XX0B 4FS2A 1VS0A 4RAZA 2W7PA 3BQ2A 4Q44A 4F4ZA 4FM9A 1FKAH 2FK3A 2XGQA 3PVXA 1XNRH 1BNCA 2OH2A 5D8DA 3MWEA 5DQGA 4IRKA 1XNQH 3GV8B 2V5AA 2XIGA 3M9NB 1C30A 2WAQE 1JXLA 4ME6A 4O4HF 3GTJA 4IR1A 4QJFA 3MR3A 2RGRA 1TWHA 4RNMA 4EGQA 3JZIA 4QWEA 3N8DA 1KBLA 3GTKA 3MWMA 3PO3G 1IBLH 4RB0A 2P0AA 3BABA 3CQZA 2CQYA 2CZGA 5KFFA 4DL2A 3GIKA 4AYBA 4C5AA 2YZMA 3VPBA 4LMYA 2WDTA 5BMVF 4YY3H 5LMUH 4DV1H 1FJGH 1N36H 4X65H 2WB1E 4M9UA 4UFZA 2XC9A 4J9MA 1I7LA 3RB3A 4RZQA 2VUMG 1VBGA 4AQYH 2JEIA 3PW7A 4NLGA 4R8UB 2E2IA 5KG3A 2V4RA 4UCTA 2W71A 1TWAA 3EYYA 5JVLA 4RNOA 3R23A 5KFXA 1K1SA 3RAXA 3CVZA 3T5JA 3LMLA 3GV7B 2FP4B 4ECQA 2BQUA 3RV3A 2R7ZG 4TUYF 3AYHB 5KG1A 4NXMH 5DQIA 1I50A 4MAMA 1TA8A 1CQIB 1JKJB 3OUZA 4B3SH 2UVVA 3GIPA 2NU9B 3N42B 4IWYA 5KFTA 2JA5A 1CS0A 1M0TA 4R7RA 5L9XA 1EHIA 3FDSA 4IHJF 2GPSA 5D1PA 3U9TA 2R92A 3EPGA 3R5HA 1N48A 4A3GG 2HHHH 2XCAA 4EEQA 3L4KA 1EUCB 5IYZF 3HKZA 4DR2H 5J2TF 1ZETA 3H20A 2UVWA 3GIDA 1KEEA 3T5KA 5HBRB 2JEJA 1P8LA 4YAKB 1XMOH 4JI7H 4LF9H 3JRWA 4XZ3B 4DV6H 4EBDA 4DR3H 1WSCA 2OLSA 5FLMG 5BPHA 3RGZA 4BXXG 5KT6A 3KHGA 4C5BA 4DR6H 1MZBA 5KFMA 2W8LA 3Q8SB 3HB9A 5LXTF 4TV8F 2FLNA 4HR7A 1DV2A 3MR6A 3TIIA 3WO1A 4ZHQF 2I87A 1X9NA 4A93G 5C4XG 4O2BF 1GSHA 4F50A 3KALA 5KT3A 5KKNB 4JI0H 1V51A 1HNXH 1S0NA 1S9FA 1E4EA 1GO3E 5CB4F 2X0SA 2UXBH 1Y14B 2ZDGA 2C2RA 2JEFA 4IR9A 2RDIA 3SI8A 2DIKA 5KT2A 1PX2A 1V9PA 2W6QA 2ZM6H 4UCUA 5EWGA 4G3IA 4U7CA 5C3EG 2AGPA 4NXNH 2BQ3A 2E2HA 4JV5H 2FLPA 5KFZA 5KG2A 4WD3A 4YAJB 5FD6A 3I4MG 2BQRA 3ETHA 2R93G 2UU9H 2VQDA 2W6PA 2QYZA 4MV9A 4DLKA 5FJ8G 5DGAA 3HOVG 1WCMG 3RTXA 4LF7H 4DUYH 4YP3A 3PO2G 1KC7A 5CA1F 3H4BA 2RGVA 4EEYA 3GTQA 1KJ9A 2W9CB 3Q2OA 4RU9A 4APMA 3PW2A 1S97A 4LH7A 4DL7A 2W9BB 5L1KA 1N34H 3PR4A 4O3RA 2R87A 4L1KA 2B63G 2FJZA 5KFUA 4EYHB 4DR7H 3TQTA 5KT4A 4RB3C 4ED3A 4AYBE 3RBDA 2CW8A 2R82A 5EOYA 2WTFA 2NU8B 2FE3A 3G6VA 1TAEA 4JUZA 1UNNC 2IA6A 2WYOA 2KSWA 1WH2A 2RF4A 3RBEA 1A0IA 3OHBA 5LMNH 2ALZA 3RF2A 2C2EA 4O3NA 2R86A 3KHLA 2V4QA 4ECSA 5KFVA 4ED0A 4FBTA 2W6OA 2V58A 2YU9A 1GSAA 3PW4A 2C2DA 4EG0A 3RIZA 3BQ0A 1N56A 5KFOA 2R8GA 1W93A 2C35B 2DPJA 1JIHA 1K1QA 4ED6A 5F9NA 4JI8H 4J9OA 3DF7A 4DL6A 4PDBA 4C2MA 2DLNA 4BY1G 3T5HA 4RB2C 4O3OA 3JRXA 4EBCA 2GPWA 4ED2A 5KFEA 5GONF 1Z2NX 3LP8A 2R8IA 2PN1A 3RFCA 3K3PA 2FPGB 3OTOH 4A3FG 1EUDB 3EPIA 1M7JA 3MJFA 2DPIA 3OSNA 3HOYG 5BPFA 1B6SA 4DV2H 3J7AK 1ULZA 5KFKA 2R8HA 3J81W 3QZ7A 2NVXA 1JDEA 5KT5A 3G8CA 1CE8A 3K5HA 4J9LA 2VPQA 1S10A 4JI1H 1SYXB 4RB1A 2PMZA 5D1OB 5KFYA 3H3VH 2DWCA 2XD4A 3GTPA 4LFBH 3KAKA 4M7EA 2UXDH 1S0OA 4A3DG 2VA3A 5LL6b 4HYKA 2VUGA 3V4SA 4MV7A 3QFFA 2VQEH 2ATLA 3JAMW 2W9AA 3G6XA 2JA5G 4EFEA 4GKKH 4FS1A 4UCSA 4RUCA 3RB4A 5KT7A 4IRCA 2R92G 4DL3A 4MTDA 5CAEB 1ZQ7A 2ASLA 3H0GA 3I4NG 1M0WA 3VPDA 5KFRA 4ECWA 3C0FB 1KJ8A 5KFNA 1Y1WA 3JSLA 1C3OA 4GC7A 5C5JA 4A3MG 3L4JA
chains in the Genus database with same CATH topology
3KTMA 2M05A 4PWQA 2FK1A 2FK2A 1OWTA 2FJZA 2FKLA 2FMAA 2FK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTM A;  2M05 A;  4PWQ A;  2FK1 A;  2FK2 A;  1OWT A;  2FJZ A;  2FKL A;  2FMA A;  2FK3 A; 
#chains in the Genus database with same CATH topology
 1BJT A;  3KHR A;  3FMA A;  1KJQ A;  2ZJT A;  2RDJ A;  3PR5 B;  1I94 H;  2PBZ A;  5IYC G;  1FVI A;  2YYA A;  3H40 A;  4HNU A;  3GQC A;  5K2M A;  1RJR A;  4ETS A;  3PW5 A;  2F4V H;  2WB1 A;  4B3R H;  3RJ0 A;  2AGQ A;  2R7K A;  5IP7 G;  5DG9 A;  3BA9 A;  2YZG A;  2CW7 A;  1KJI A;  5EZY F;  4U6P A;  4UCR A;  2YS7 A;  3M9M B;  2I8C A;  4QIW E;  2W6Z A;  2YL2 A;  5C8Y F;  4LF4 H;  4ECU A;  2W6N A;  5FD5 A;  4GC6 A;  4B3M H;  4ED8 A;  2R6F A;  1S68 A;  3GTM A;  4IWX A;  2HJW A;  3ORR A;  1B33 N;  5C1P A;  4JV1 A;  4I7H A;  3PW0 A;  3R5F A;  2AGO A;  3N44 B;  4PWQ A;  1VAJ A;  3FKI A;  3ORQ A;  4WBN F;  3RAQ A;  2JA7 A;  3RUP A;  2Y0S A;  4Y8V B;  3FKI G;  1DGS A;  1HNZ H;  5KFG A;  1K83 A;  2DZD A;  4Q45 A;  4YR0 A;  1R9T A;  5DGB A;  4MA0 A;  4YHH H;  4MV3 A;  1B6R A;  3BAA A;  4QWC A;  4UCO A;  3MFI A;  2W7O A;  4KHP H;  3MR2 A;  3Q8R B;  4YR2 A;  1Z2O X;  5EWF A;  1J5E H;  1SFO A;  5T14 A;  3GTL A;  2XCL A;  1JLL B;  1V4Y A;  5L1L A;  3KAJ A;  3GIQ A;  5CA0 F;  2R8K A;  4LF8 H;  4BY7 G;  2VQF H;  2UXC H;  2FPP B;  4MV8 A;  1N33 H;  3N41 B;  4ECY A;  2C28 A;  4RUA A;  2YZN A;  1AUX A;  4EFB A;  1ZHS A;  2JA6 A;  1M6V A;  2IP4 A;  3HBL A;  4TV9 F;  1JDB B;  3H4D A;  2VOB A;  3KXY T;  3VMM A;  4DV7 H;  4LSX A;  4R8U A;  3GV5 B;  4X64 H;  1HR0 H;  4I4T F;  3I12 A;  4J9K A;  4GKJ H;  4ED7 A;  4O4L F;  5KFH A;  1T94 A;  5BR8 H;  4A3L G;  4ED1 A;  2YRW A;  4YBZ B;  4HNT A;  5KFQ A;  3TQ1 A;  1EZ1 A;  4LF5 H;  5KFW A;  4QW8 A;  3Q8P B;  5IP9 G;  1RYS A;  3V4Z A;  1E4E B;  2UUB H;  5IYB G;  2R7M A;  2PMZ E;  4ZQI A;  3RB0 A;  4EGJ A;  2FK1 A;  4XYL B;  4JI2 H;  1JX4 A;  2IMW P;  2NU7 B;  4J9Q A;  3WO0 A;  4DUZ H;  3GII A;  3HOZ G;  4F4W A;  3JSN A;  2V59 A;  1TWC A;  4RNN A;  1GSO A;  5IT9 W;  5DQH A;  2JEG A;  4CC5 A;  2YW2 A;  4J9N A;  2Q2T A;  5C44 G;  5HV6 A;  3HOW G;  3TIN A;  4CC6 A;  3UFX B;  5KFL A;  4BBR G;  5KFP A;  2AU0 A;  2WE6 A;  2UUA H;  4A2B A;  3HOU G;  3WNZ A;  4E4T A;  3L2P A;  5LOV F;  3HKZ E;  4HNV A;  1SEI A;  2E5L H;  2UUC H;  2W57 A;  5EWE A;  1ZHQ A;  5KG6 A;  1E4G T;  5FLX W;  4J9R A;  2GLT A;  4DV0 H;  4DV4 H;  5IWA H;  4QWB A;  2YRX A;  4LFC H;  1RK5 A;  2C00 A;  5KFD A;  4J9P A;  5JUM A;  4JI4 H;  3OHA A;  1RK6 A;  2Q2U A;  3T5L A;  3K5I A;  4DL5 A;  2ZDH A;  3G6Y A;  4YQW A;  5DG7 A;  2HGS A;  4Q8F A;  3T1Y H;  4ECT A;  4I55 F;  2J9G A;  4O3P A;  3BJY A;  1BGW A;  2W6M A;  3RB6 A;  4A3I G;  1XDN A;  4OX9 H;  4J0M A;  1PK8 A;  4MA5 A;  2M05 A;  4XYM B;  5IYD G;  2VUM A;  3LWB A;  4O3S A;  1IOV A;  1EYZ A;  2QK4 A;  2V9W A;  4IRD A;  3T1H H;  2O03 A;  1A9X A;  4IZO A;  4ECV A;  3SE7 A;  4ECX A;  3BQ1 A;  1O75 A;  4K0K H;  1RJQ A;  4MTE A;  4F4Y A;  5EDW A;  3GTO A;  2J6S A;  2VR1 A;  1AN7 A;  2HVS A;  3U9S A;  3H0G G;  5F9L A;  4FBU A;  2WAQ A;  4GLX A;  2R7Z A;  2ZDQ A;  4DL4 A;  2ASD A;  2VPS A;  3N6X A;  4F4X A;  4MV1 A;  3GIJ A;  5KFC A;  1Y1W G;  2FLL A;  1GYF A;  3IG0 A;  1AUV A;  4HQ6 A;  1N32 H;  2Y0S E;  5FPO A;  1Z2P X;  3HOX G;  4A3E G;  4JI6 H;  2FMA A;  4LFA H;  4Q8E A;  2HVR A;  2W9C A;  2BR0 A;  1Y1V A;  5KX5 F;  5DG8 A;  3Q8Q B;  1IBM H;  2SCU B;  1HNW H;  2FPI B;  1Y1V G;  3J80 W;  5L1I A;  1VBH A;  3IN5 A;  1DV1 A;  2R7N A;  3K3V A;  5LYJ F;  2W9B A;  5L1J A;  4LH6 A;  1DIK A;  2HVQ A;  4YJ3 F;  1L2Z A;  1UC8 A;  4DR4 H;  2OWO A;  5KFJ A;  4ECZ A;  4DV3 H;  1OWT A;  4MV6 A;  5DLG A;  2AQ4 A;  1W96 A;  5JH7 F;  5JQW A;  2NUA B;  3M9O B;  3GIL A;  3KTM A;  2J6U A;  4X66 H;  3Q1K A;  3OSP A;  3N40 P;  4FU0 A;  2NU6 B;  2FKL A;  2J6T A;  4O3Q A;  3GTG A;  2UVU A;  2C22 A;  4YR3 A;  3PZP A;  3R5X A;  1XMQ H;  3BA8 A;  2XGP A;  1S03 G;  4QWD A;  2R8J A;  4DR5 H;  2XCP A;  2CKZ B;  4Q0Y A;  1GGO A;  4A3J G;  2R84 A;  2JA7 G;  3HXL A;  3M4I A;  5KG4 A;  3V6K A;  4JV2 A;  4Q43 A;  2UVR A;  5J2U F;  4O4I F;  1VKZ A;  2PVP A;  4UCV A;  5I47 A;  4TQS A;  5KFI A;  4EYI B;  4EBE A;  4C5C A;  1KJJ A;  3QZ8 A;  1B04 A;  3F8N A;  3BG5 A;  4A3K G;  2VA2 A;  1RYR A;  4I50 F;  4DR1 H;  2IBK A;  1I6U A;  2ASJ A;  4QWA A;  3RGX A;  4J9S A;  5LA6 F;  2FK2 A;  1I3Q A;  3KHH A;  4YJ2 F;  2R93 A;  2NVY A;  5KG7 A;  3ETJ A;  5KFA A;  4JYA H;  2W70 A;  1RJP A;  1S0M A;  4QW9 A;  1WR2 A;  1WCM A;  4RAY A;  4MV4 A;  3E5N A;  2JA6 G;  5KG0 A;  3UQ8 A;  3V6J A;  3TIG A;  1I7N A;  5H80 A;  2MCT A;  2I80 A;  4LSA A;  1T36 A;  3GLK A;  3MFH A;  4ECR A;  5JVD F;  2YS6 A;  4DV5 H;  4A3B G;  4A3C G;  1E4F T;  3VPC A;  4RZR A;  5D1O A;  4X62 H;  1UC9 A;  5LP6 F;  3PN1 A;  4JV0 A;  5KG5 A;  1IOW A;  4BBS G;  4LF6 H;  4QIW A;  2R7L A;  1BXR A;  2JA8 G;  3MWD A;  2B63 A;  1SCU B;  5C1O A;  3V6H A;  4B3T H;  2FB9 A;  4BWS C;  2W8K A;  5KFS A;  3RV4 A;  3GIM A;  5KFB A;  5A2Q W;  2YCH A;  3N43 B;  4O2A F;  4ZOL F;  4A2A A;  5FPR A;  1GLV A;  4JI3 H;  3NGD A;  1TWG A;  1T3N A;  1TWF A;  4JI5 H;  4IAJ A;  2R85 A;  4ZI7 F;  1IBK H;  1CQJ B;  4YB8 B;  3MR5 A;  3OUU A;  5DLF A;  4TQR A;  4XX0 B;  4FS2 A;  1VS0 A;  4RAZ A;  2W7P A;  3BQ2 A;  4Q44 A;  4F4Z A;  4FM9 A;  1FKA H;  2FK3 A;  2XGQ A;  3PVX A;  1XNR H;  1BNC A;  2OH2 A;  5D8D A;  3MWE A;  5DQG A;  4IRK A;  1XNQ H;  3GV8 B;  2V5A A;  2XIG A;  3M9N B;  1C30 A;  2WAQ E;  1JXL A;  4ME6 A;  4O4H F;  3GTJ A;  4IR1 A;  4QJF A;  3MR3 A;  2RGR A;  1TWH A;  4RNM A;  4EGQ A;  3JZI A;  4QWE A;  3N8D A;  1KBL A;  3GTK A;  3MWM A;  3PO3 G;  1IBL H;  4RB0 A;  2P0A A;  3BAB A;  3CQZ A;  2CQY A;  2CZG A;  5KFF A;  4DL2 A;  3GIK A;  4AYB A;  4C5A A;  2YZM A;  3VPB A;  4LMY A;  2WDT A;  5BMV F;  4YY3 H;  5LMU H;  4DV1 H;  1FJG H;  1N36 H;  4X65 H;  2WB1 E;  4M9U A;  4UFZ A;  2XC9 A;  4J9M A;  1I7L A;  3RB3 A;  4RZQ A;  2VUM G;  1VBG A;  4AQY H;  2JEI A;  3PW7 A;  4NLG A;  4R8U B;  2E2I A;  5KG3 A;  2V4R A;  4UCT A;  2W71 A;  1TWA A;  3EYY A;  5JVL A;  4RNO A;  3R23 A;  5KFX A;  1K1S A;  3RAX A;  3CVZ A;  3T5J A;  3LML A;  3GV7 B;  2FP4 B;  4ECQ A;  2BQU A;  3RV3 A;  2R7Z G;  4TUY F;  3AYH B;  5KG1 A;  4NXM H;  5DQI A;  1I50 A;  4MAM A;  1TA8 A;  1CQI B;  1JKJ B;  3OUZ A;  4B3S H;  2UVV A;  3GIP A;  2NU9 B;  3N42 B;  4IWY A;  5KFT A;  2JA5 A;  1CS0 A;  1M0T A;  4R7R A;  5L9X A;  1EHI A;  3FDS A;  4IHJ F;  2GPS A;  5D1P A;  3U9T A;  2R92 A;  3EPG A;  3R5H A;  1N48 A;  4A3G G;  2HHH H;  2XCA A;  4EEQ A;  3L4K A;  1EUC B;  5IYZ F;  3HKZ A;  4DR2 H;  5J2T F;  1ZET A;  3H20 A;  2UVW A;  3GID A;  1KEE A;  3T5K A;  5HBR B;  2JEJ A;  1P8L A;  4YAK B;  1XMO H;  4JI7 H;  4LF9 H;  3JRW A;  4XZ3 B;  4DV6 H;  4EBD A;  4DR3 H;  1WSC A;  2OLS A;  5FLM G;  5BPH A;  3RGZ A;  4BXX G;  5KT6 A;  3KHG A;  4C5B A;  4DR6 H;  1MZB A;  5KFM A;  2W8L A;  3Q8S B;  3HB9 A;  5LXT F;  4TV8 F;  2FLN A;  4HR7 A;  1DV2 A;  3MR6 A;  3TII A;  3WO1 A;  4ZHQ F;  2I87 A;  1X9N A;  4A93 G;  5C4X G;  4O2B F;  1GSH A;  4F50 A;  3KAL A;  5KT3 A;  5KKN B;  4JI0 H;  1V51 A;  1HNX H;  1S0N A;  1S9F A;  1E4E A;  1GO3 E;  5CB4 F;  2X0S A;  2UXB H;  1Y14 B;  2ZDG A;  2C2R A;  2JEF A;  4IR9 A;  2RDI A;  3SI8 A;  2DIK A;  5KT2 A;  1PX2 A;  1V9P A;  2W6Q A;  2ZM6 H;  4UCU A;  5EWG A;  4G3I A;  4U7C A;  5C3E G;  2AGP A;  4NXN H;  2BQ3 A;  2E2H A;  4JV5 H;  2FLP A;  5KFZ A;  5KG2 A;  4WD3 A;  4YAJ B;  5FD6 A;  3I4M G;  2BQR A;  3ETH A;  2R93 G;  2UU9 H;  2VQD A;  2W6P A;  2QYZ A;  4MV9 A;  4DLK A;  5FJ8 G;  5DGA A;  3HOV G;  1WCM G;  3RTX A;  4LF7 H;  4DUY H;  4YP3 A;  3PO2 G;  1KC7 A;  5CA1 F;  3H4B A;  2RGV A;  4EEY A;  3GTQ A;  1KJ9 A;  2W9C B;  3Q2O A;  4RU9 A;  4APM A;  3PW2 A;  1S97 A;  4LH7 A;  4DL7 A;  2W9B B;  5L1K A;  1N34 H;  3PR4 A;  4O3R A;  2R87 A;  4L1K A;  2B63 G;  2FJZ A;  5KFU A;  4EYH B;  4DR7 H;  3TQT A;  5KT4 A;  4RB3 C;  4ED3 A;  4AYB E;  3RBD A;  2CW8 A;  2R82 A;  5EOY A;  2WTF A;  2NU8 B;  2FE3 A;  3G6V A;  1TAE A;  4JUZ A;  1UNN C;  2IA6 A;  2WYO A;  2KSW A;  1WH2 A;  2RF4 A;  3RBE A;  1A0I A;  3OHB A;  5LMN H;  2ALZ A;  3RF2 A;  2C2E A;  4O3N A;  2R86 A;  3KHL A;  2V4Q A;  4ECS A;  5KFV A;  4ED0 A;  4FBT A;  2W6O A;  2V58 A;  2YU9 A;  1GSA A;  3PW4 A;  2C2D A;  4EG0 A;  3RIZ A;  3BQ0 A;  1N56 A;  5KFO A;  2R8G A;  1W93 A;  2C35 B;  2DPJ A;  1JIH A;  1K1Q A;  4ED6 A;  5F9N A;  4JI8 H;  4J9O A;  3DF7 A;  4DL6 A;  4PDB A;  4C2M A;  2DLN A;  4BY1 G;  3T5H A;  4RB2 C;  4O3O A;  3JRX A;  4EBC A;  2GPW A;  4ED2 A;  5KFE A;  5GON F;  1Z2N X;  3LP8 A;  2R8I A;  2PN1 A;  3RFC A;  3K3P A;  2FPG B;  3OTO H;  4A3F G;  1EUD B;  3EPI A;  1M7J A;  3MJF A;  2DPI A;  3OSN A;  3HOY G;  5BPF A;  1B6S A;  4DV2 H;  3J7A K;  1ULZ A;  5KFK A;  2R8H A;  3J81 W;  3QZ7 A;  2NVX A;  1JDE A;  5KT5 A;  3G8C A;  1CE8 A;  3K5H A;  4J9L A;  2VPQ A;  1S10 A;  4JI1 H;  1SYX B;  4RB1 A;  2PMZ A;  5D1O B;  5KFY A;  3H3V H;  2DWC A;  2XD4 A;  3GTP A;  4LFB H;  3KAK A;  4M7E A;  2UXD H;  1S0O A;  4A3D G;  2VA3 A;  5LL6 b;  4HYK A;  2VUG A;  3V4S A;  4MV7 A;  3QFF A;  2VQE H;  2ATL A;  3JAM W;  2W9A A;  3G6X A;  2JA5 G;  4EFE A;  4GKK H;  4FS1 A;  4UCS A;  4RUC A;  3RB4 A;  5KT7 A;  4IRC A;  2R92 G;  4DL3 A;  4MTD A;  5CAE B;  1ZQ7 A;  2ASL A;  3H0G A;  3I4N G;  1M0W A;  3VPD A;  5KFR A;  4ECW A;  3C0F B;  1KJ8 A;  5KFN A;  1Y1W A;  3JSL A;  1C3O A;  4GC7 A;  5C5J A;  4A3M G;  3L4J A; 
#chains in the Genus database with same CATH homology
 3KTM A;  2M05 A;  4PWQ A;  2FK1 A;  2FK2 A;  1OWT A;  2FJZ A;  2FKL A;  2FMA A;  2FK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...