2FMAA

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'small unit cell' form, atomic resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Alzheimer's disease amyloid precursor protein copper-binding domain at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Amyloid beta A4 protein precursor
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fmaA00
2M05A 4PWQA 1OWTA 2FK1A 2FKLA 2FJZA 3KTMA 2FMAA 2FK2A 2FK3A
chains in the Genus database with same CATH superfamily
5KKNB 3LMLA 2OWOA 5KT5A 3OUUA 3T5KA 2IMWP 1XNRH 5KFOA 2FPGB 5KG4A 2W9AA 4ECYA 3H4DA 3KALA 3RGZA 1JXLA 2YZNA 3RGXA 3K5IA 2PVPA 2ZDQA 3HOUG 4ED8A 1Y1WA 1B04A 4O3PA 4JI2H 3RBEA 4MV7A 4JYAH 4YP3A 1L2ZA 2CW8A 5DQGA 1EZ1A 1M6VA 1T36A 3L2PA 4Q0YA 2W57A 4AYBA 1A9XA 4RUAA 2VQDA 3H40A 4EBCA 1R9TA 2VUMG 4GC6A 3SE7A 2UXDH 3NGDA 3GIQA 2FLLA 2J6TA 4XYMB 4EFBA 5JH7F 5IT9W 2ZDGA 2O03A 4YR2A 3WO0A 1Z2OX 4A3EG 2RGRA 2R7ZA 2YZGA 5D1PA 5KFQA 5EOYA 5KFXA 2V9WA 4IAJA 1I50A 4YAKB 4MV6A 4IRCA 4A3CG 4ED6A 4R7RA 1JDEA 2NU6B 1RJPA 4MV1A 4O3OA 4I4TF 5C5JA 5KG7A 4KHPH 5KFBA 5KG0A 4EGQA 4LF5H 2C00A 4TQSA 3ETHA 1Y1VG 5F9LA 3Q2OA 2IBKA 3KTMA 3HOZG 4F4WA 4QIWE 3RBDA 4A3BG 4DR4H 4XYLB 2W6OA 3GTKA 2FK2A 4B3TH 3BQ2A 4O2BF 3TIIA 3Q8SB 3G6XA 4BY1G 1HR0H 3VMMA 2WAQE 3AYHB 2C2EA 2RF4A 4YJ2F 4LF7H 3VPCA 4YQWA 3MWEA 4TUYF 2W9CA 2UU9H 3RTXA 5C1PA 4LFAH 3HOWG 3RAQA 3LWBA 1OWTA 5L1JA 1V4YA 4HYKA 1UC9A 1JKJB 5KX5F 4EYHB 4Q43A 3J81W 1B6RA 2YCHA 5KFUA 4ECWA 1TWCA 4ETSA 2PBZA 2P0AA 2ZM6H 2W8KA 2YS6A 3BQ1A 4DV4H 4LF4H 4Q8EA 1GSHA 5KFCA 2I87A 2R8KA 2M05A 4K0KH 2FLPA 4UFZA 4MV4A 5KG3A 5J2UF 4ECVA 2AQ4A 2WB1E 4TV9F 4APMA 1K83A 4A2AA 4IHJF 3M9NB 1M7JA 5LMNH 1JIHA 5KFPA 5LL6b 5KFSA 4LH6A 4LSXA 4ED7A 4BBSG 3EYYA 4QJFA 4DR3H 5KG2A 1GSAA 4FM9A 1S10A 4JI8H 3KAJA 3I12A 4RAZA 3QFFA 4J9QA 4DV7H 3HOYG 2W9BB 1S03G 1FJGH 4B3MH 4B3SH 4R8UA 5F9NA 2R8HA 4JI1H 3JRXA 2R86A 4YY3H 3GIKA 5IYZF 5LOVF 3RB4A 5KFMA 3VPBA 3PZPA 2ATLA 2W6QA 3OHBA 1CQJB 2B63G 4DV0H 1Y14B 2R6FA 2R7LA 2VUGA 4DL3A 4J9LA 1WCMG 1EYZA 5D8DA 2FJZA 1BXRA 2WAQA 3T5JA 1HNWH 4G3IA 1T94A 2SCUB 3VPDA 1RJQA 3KHGA 4RAYA 2BQUA 2R7NA 3WNZA 4JI4H 2R82A 4YBZB 4J9RA 2OLSA 3H4BA 1GYFA 5FPRA 5KFNA 2E2HA 4O4HF 2W70A 4WBNF 5DGBA 3GQCA 1TWGA 4J9SA 4JI3H 4ME6A 4IWYA 5FLMG 3L4JA 3JZIA 4MV9A 4MV8A 1CQIB 3N41B 5IYCG 3Q8PB 1V9PA 4X62H 3G8CA 5LP6F 2AGOA 5KG5A 1PX2A 2FB9A 1IBKH 3MFIA 4JUZA 3R5HA 3T1HH 4EYIB 2X0SA 3N40P 4C5CA 2WE6A 5DG8A 3JAMW 4DV1H 1ULZA 3N6XA 1RYSA 3PW0A 2R85A 5JQWA 4ZHQF 1I6UA 4I50F 3Q8QB 1CE8A 5KFYA 3HBLA 2DPIA 5BPHA 4RB2C 4RNMA 1KJ8A 3KXYT 3OSNA 4J0MA 4O3RA 3N44B 3RUPA 5KFRA 5KFHA 2YYAA 3UQ8A 5T14A 1K1SA 4X66H 5CAEB 3RV3A 4DLKA 2QK4A 3GV7B 2CZGA 4QWEA 2UUAH 1KJ9A 4OX9H 4GKKH 4A93G 2FP4B 2FPPB 4RZRA 1GSOA 1MZBA 4DV3H 3IN5A 2R8JA 5H80A 3WO1A 2V4RA 3J7AK 2PMZA 2HVSA 4JV2A 4X65H 4BXXG 4MA0A 5L1IA 3H0GA 5C8YF 4J9OA 1B33N 4JI5H 3TQ1A 2XC9A 2DIKA 3J80W 5KT7A 4FS1A 1XMOH 2W9CB 2J6UA 4DR6H 1UNNC 2NUAB 2R84A 4LMYA 5D1OB 1N32H 4TQRA 2ZDHA 5HV6A 5DQIA 3Q1KA 4EEQA 2UUBH 5KFVA 1E4EB 3ORRA 4XZ3B 5L9XA 3PO2G 2DWCA 2MCTA 5LYJF 1AN7A 1BGWA 4DR5H 3PW5A 1A0IA 5KFIA 1XNQH 1V51A 3GIIA 2J6SA 5JUMA 2BQ3A 2NVXA 2JA6A 1IOVA 2QYZA 4RB0A 4C5AA 4ZI7F 3N42B 4O3QA 2IP4A 4ECUA 2Q2UA 3RIZA 4HNUA 4FBUA 4ECXA 1IBMH 4UCRA 4QWAA 4O2AF 3RV4A 1AUVA 4ECSA 3GTQA 3KHLA 4JI7H 4CC6A 3C0FB 3MWMA 2XCLA 5L1LA 3FKIA 4ECTA 4C5BA 3GTLA 4R8UB 2V4QA 4J9KA 2UXBH 2VA2A 3GV8B 4FS2A 4JV0A 1BNCA 3HXLA 2V5AA 2BQRA 2J9GA 2RGVA 1S68A 4ECRA 2I8CA 1ZHQA 3E5NA 4IR1A 5BPFA 4UCUA 3MWDA 3GTPA 4O4IF 1S0MA 5DLGA 4I55F 2AGQA 4IRDA 4JV1A 2JA8G 5KFEA 4O3SA 1Z2NX 2UUCH 5FD6A 3PR4A 4A3IG 5C1OA 1I7LA 1PK8A 4NLGA 4RNOA 4XX0B 2KSWA 4EG0A 4DL6A 4A3LG 2NU7B 1VAJA 1S97A 2OH2A 2BR0A 1E4EA 1K1QA 2VPQA 2WDTA 3RB3A 4RZQA 4O3NA 4DUYH 4I7HA 4HNVA 4HNTA 1KEEA 4B3RH 2HVQA 3CQZA 4QW9A 1VBGA 1B6SA 5BR8H 2R8GA 2JA5A 2R92A 1IOWA 3PW7A 1Z2PX 3HKZE 3MR5A 1GGOA 2C2DA 2VQEH 4C2MA 2HHHH 1O75A 4TV8F 1UC8A 1AUXA 2WTFA 3K3PA 1XMQH 2YS7A 2C22A 1DIKA 2NU8B 4A3MG 2RDIA 2V59A 1SEIA 3FDSA 4LF8H 4PDBA 5J2TF 3KHRA 5CA1F 2R93G 3GIMA 3GIDA 4Y8VB 2W7PA 5KG1A 3TQTA 2ASJA 3V6KA 2ASLA 1RJRA 3OSPA 4YHHH 5JVDF 4A3KG 2YRXA 1C30A 2C2RA 2Y0SA 1N33H 2YW2A 1X9NA 2WYOA 4YR3A 3G6VA 1VKZA 3V4ZA 5KFZA 5I47A 2R92G 4A3GG 3R23A 5KT6A 3N8DA 3MFHA 3EPIA 4EGJA 5KT4A 1BJTA 2R87A 3K3VA 4ED3A 4LFBH 3CVZA 2FK3A 2YL2A 3HOXG 5EDWA 3L4KA 4L1KA 4Q8FA 3M4IA 1E4GT 2FLNA 4YAJB 5K2MA 4GKJH 3N43B 4J9PA 4AYBE 3M9OB 3PW2A 3GIJA 4IRKA 2XIGA 1N34H 5GONF 2XCPA 4Q44A 2E5LH 2W8LA 3MJFA 3HKZA 2XCAA 4F4ZA 2FMAA 2HVRA 3PO3G 4FU0A 1KJQA 2JA7G 4NXNH 2AU0A 4A3JG 3RF2A 1Y1VA 5D1OA 4MTEA 1WH2A 1EUDB 1ZETA 2R7ZG 3KAKA 2UVUA 1S0OA 1EHIA 4ECQA 5KG6A 4A3FG 1TWAA 3BAAA 1I94H 2JEGA 5FPOA 3RB0A 2F4VH 4O4LF 4ED1A 5KFWA 3ETJA 4UCVA 5CB4F 3Q8RB 5KFTA 4LSAA 3GTJA 2GPSA 5JVLA 2UVRA 3GLKA 1HNXH 5KT2A 1GLVA 4DV6H 3ORQA 2NVYA 2R8IA 4IR9A 1Y1WG 4UCSA 3BG5A 4HR7A 2W6NA 4BWSC 4EBDA 1SFOA 2YRWA 1SCUB 4PWQA 5HBRB 4U6PA 2JA6G 3GIPA 5FD5A 1DGSA 1RK5A 4RB1A 3MR3A 4QWCA 4FBTA 4RUCA 1KJIA 2ALZA 2W7OA 3QZ8A 3BA9A 2W6PA 5IP9G 4DV2H 5KFLA 3GILA 5KFJA 4ECZA 3DF7A 2RDJA 3H20A 2W6MA 1WR2A 2VR1A 3RB6A 2UVWA 3H0GG 5IWAH 4AQYH 2HJWA 5BMVF 4DUZH 4RNNA 4LFCH 3M9MB 5EWFA 4DL7A 5KT3A 2XGPA 3UFXB 1FKAH 1S0NA 2B63A 3TIGA 4U7CA 3JSLA 3G6YA 1WSCA 3GV5B 1S9FA 5EZYF 2NU9B 4Q45A 3HOVG 2CKZB 1WCMA 2VOBA 1TAEA 2W6ZA 4HQ6A 3GTGA 3PW4A 1JLLB 2JEJA 2E2IA 5KFGA 1VBHA 1N36H 1RK6A 3EPGA 4DV5H 3H3VH 4BY7G 1KC7A 2FK1A 3OHAA 4UCTA 2YU9A 3V6HA 3R5XA 5FJ8G 4JV5H 4GC7A 5KFAA 3FMAA 2VPSA 1FVIA 1TA8A 5C44G 2R93A 3R5FA 1JDBB 3V4SA 2CQYA 2DZDA 3PN1A 4CC5A 4A3DG 2R7KA 3SI8A 5IYDG 4DL4A 2R7MA 3BABA 2Q2TA 1JX4A 1EUCB 1M0TA 1TWFA 4MAMA 4QWDA 3KHHA 2ZJTA 1SYXB 5A2QW 3T1YH 5KFDA 2CW7A 2VUMA 4MV3A 5LXTF 4X64H 2GLTA 5EWGA 3QZ7A 4DR7H 2FKLA 3BA8A 4WD3A 1I3QA 3U9TA 3MR6A 3JSNA 3OTOH 4J9MA 1J5EH 2W9BA 4J9NA 2UVVA 1KJJA 1P8LA 2JA5G 1IBLH 3I4MG 2JA7A 3U9SA 1M0WA 1HNZH 4IZOA 4M9UA 5LA6F 2JEIA 1XDNA 3RJ0A 4ZQIA 4ZOLF 1DV2A 2GPWA 1E4FT 4EFEA 5IYBG 1N56A 3JRWA 1KBLA 4DR2H 4LF6H 4NXMH 4LH7A 3T5HA 4F50A 4EBEA 5EWEA 2V58A 4MA5A 4UCOA 3T5LA 3GTOA 2PN1A 3BQ0A 1RYRA 1I7NA 3K5HA 4LF9H 5FLXW 2JEFA 1CS0A 4YB8B 1GO3E 3RFCA 5IP7G 4DL5A 3PR5B 4YJ3F 5KFKA 2VQFH 4RU9A 4M7EA 4A2BA 4ED2A 5CA0F 1ZQ7A 3V6JA 4BBRG 5C4XG 2YZMA 4F4YA 4QW8A 3OUZA 2DLNA 3HB9A 2PMZE 3FKIG 1T3NA 2I80A 2C35B 2XD4A 4IWXA 1DV1A 2AGPA 3BJYA 3TINA 2IA6A 2ASDA 3LP8A 4ED0A 3GTMA 1W93A 4MTDA 2FPIB 5DQHA 2C28A 1N48A 3IG0A 2WB1A 4DL2A 4EEYA 4YR0A 5LMUH 5DG9A 1ZHSA 4JI6H 2XGQA 1TWHA 3RAXA 5C3EG 2W71A 5L1KA 4E4TA 1VS0A 2DPJA 4RB3C 4GLXA 3MR2A 2HGSA 5KFFA 1C3OA 2Y0SE 4QWBA 5DGAA 2VA3A 5DG7A 2UXCH 3F8NA 1W96A 4QIWA 4JI0H 3PVXA 3I4NG 2FE3A 4DR1H 4F4XA 5DLFA
chains in the Genus database with same CATH topology
2M05A 4PWQA 1OWTA 2FK1A 2FKLA 2FJZA 3KTMA 2FMAA 2FK2A 2FK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M05 A;  4PWQ A;  1OWT A;  2FK1 A;  2FKL A;  2FJZ A;  3KTM A;  2FMA A;  2FK2 A;  2FK3 A; 
#chains in the Genus database with same CATH topology
 5KKN B;  3LML A;  2OWO A;  5KT5 A;  3OUU A;  3T5K A;  2IMW P;  1XNR H;  5KFO A;  2FPG B;  5KG4 A;  2W9A A;  4ECY A;  3H4D A;  3KAL A;  3RGZ A;  1JXL A;  2YZN A;  3RGX A;  3K5I A;  2PVP A;  2ZDQ A;  3HOU G;  4ED8 A;  1Y1W A;  1B04 A;  4O3P A;  4JI2 H;  3RBE A;  4MV7 A;  4JYA H;  4YP3 A;  1L2Z A;  2CW8 A;  5DQG A;  1EZ1 A;  1M6V A;  1T36 A;  3L2P A;  4Q0Y A;  2W57 A;  4AYB A;  1A9X A;  4RUA A;  2VQD A;  3H40 A;  4EBC A;  1R9T A;  2VUM G;  4GC6 A;  3SE7 A;  2UXD H;  3NGD A;  3GIQ A;  2FLL A;  2J6T A;  4XYM B;  4EFB A;  5JH7 F;  5IT9 W;  2ZDG A;  2O03 A;  4YR2 A;  3WO0 A;  1Z2O X;  4A3E G;  2RGR A;  2R7Z A;  2YZG A;  5D1P A;  5KFQ A;  5EOY A;  5KFX A;  2V9W A;  4IAJ A;  1I50 A;  4YAK B;  4MV6 A;  4IRC A;  4A3C G;  4ED6 A;  4R7R A;  1JDE A;  2NU6 B;  1RJP A;  4MV1 A;  4O3O A;  4I4T F;  5C5J A;  5KG7 A;  4KHP H;  5KFB A;  5KG0 A;  4EGQ A;  4LF5 H;  2C00 A;  4TQS A;  3ETH A;  1Y1V G;  5F9L A;  3Q2O A;  2IBK A;  3KTM A;  3HOZ G;  4F4W A;  4QIW E;  3RBD A;  4A3B G;  4DR4 H;  4XYL B;  2W6O A;  3GTK A;  2FK2 A;  4B3T H;  3BQ2 A;  4O2B F;  3TII A;  3Q8S B;  3G6X A;  4BY1 G;  1HR0 H;  3VMM A;  2WAQ E;  3AYH B;  2C2E A;  2RF4 A;  4YJ2 F;  4LF7 H;  3VPC A;  4YQW A;  3MWE A;  4TUY F;  2W9C A;  2UU9 H;  3RTX A;  5C1P A;  4LFA H;  3HOW G;  3RAQ A;  3LWB A;  1OWT A;  5L1J A;  1V4Y A;  4HYK A;  1UC9 A;  1JKJ B;  5KX5 F;  4EYH B;  4Q43 A;  3J81 W;  1B6R A;  2YCH A;  5KFU A;  4ECW A;  1TWC A;  4ETS A;  2PBZ A;  2P0A A;  2ZM6 H;  2W8K A;  2YS6 A;  3BQ1 A;  4DV4 H;  4LF4 H;  4Q8E A;  1GSH A;  5KFC A;  2I87 A;  2R8K A;  2M05 A;  4K0K H;  2FLP A;  4UFZ A;  4MV4 A;  5KG3 A;  5J2U F;  4ECV A;  2AQ4 A;  2WB1 E;  4TV9 F;  4APM A;  1K83 A;  4A2A A;  4IHJ F;  3M9N B;  1M7J A;  5LMN H;  1JIH A;  5KFP A;  5LL6 b;  5KFS A;  4LH6 A;  4LSX A;  4ED7 A;  4BBS G;  3EYY A;  4QJF A;  4DR3 H;  5KG2 A;  1GSA A;  4FM9 A;  1S10 A;  4JI8 H;  3KAJ A;  3I12 A;  4RAZ A;  3QFF A;  4J9Q A;  4DV7 H;  3HOY G;  2W9B B;  1S03 G;  1FJG H;  4B3M H;  4B3S H;  4R8U A;  5F9N A;  2R8H A;  4JI1 H;  3JRX A;  2R86 A;  4YY3 H;  3GIK A;  5IYZ F;  5LOV F;  3RB4 A;  5KFM A;  3VPB A;  3PZP A;  2ATL A;  2W6Q A;  3OHB A;  1CQJ B;  2B63 G;  4DV0 H;  1Y14 B;  2R6F A;  2R7L A;  2VUG A;  4DL3 A;  4J9L A;  1WCM G;  1EYZ A;  5D8D A;  2FJZ A;  1BXR A;  2WAQ A;  3T5J A;  1HNW H;  4G3I A;  1T94 A;  2SCU B;  3VPD A;  1RJQ A;  3KHG A;  4RAY A;  2BQU A;  2R7N A;  3WNZ A;  4JI4 H;  2R82 A;  4YBZ B;  4J9R A;  2OLS A;  3H4B A;  1GYF A;  5FPR A;  5KFN A;  2E2H A;  4O4H F;  2W70 A;  4WBN F;  5DGB A;  3GQC A;  1TWG A;  4J9S A;  4JI3 H;  4ME6 A;  4IWY A;  5FLM G;  3L4J A;  3JZI A;  4MV9 A;  4MV8 A;  1CQI B;  3N41 B;  5IYC G;  3Q8P B;  1V9P A;  4X62 H;  3G8C A;  5LP6 F;  2AGO A;  5KG5 A;  1PX2 A;  2FB9 A;  1IBK H;  3MFI A;  4JUZ A;  3R5H A;  3T1H H;  4EYI B;  2X0S A;  3N40 P;  4C5C A;  2WE6 A;  5DG8 A;  3JAM W;  4DV1 H;  1ULZ A;  3N6X A;  1RYS A;  3PW0 A;  2R85 A;  5JQW A;  4ZHQ F;  1I6U A;  4I50 F;  3Q8Q B;  1CE8 A;  5KFY A;  3HBL A;  2DPI A;  5BPH A;  4RB2 C;  4RNM A;  1KJ8 A;  3KXY T;  3OSN A;  4J0M A;  4O3R A;  3N44 B;  3RUP A;  5KFR A;  5KFH A;  2YYA A;  3UQ8 A;  5T14 A;  1K1S A;  4X66 H;  5CAE B;  3RV3 A;  4DLK A;  2QK4 A;  3GV7 B;  2CZG A;  4QWE A;  2UUA H;  1KJ9 A;  4OX9 H;  4GKK H;  4A93 G;  2FP4 B;  2FPP B;  4RZR A;  1GSO A;  1MZB A;  4DV3 H;  3IN5 A;  2R8J A;  5H80 A;  3WO1 A;  2V4R A;  3J7A K;  2PMZ A;  2HVS A;  4JV2 A;  4X65 H;  4BXX G;  4MA0 A;  5L1I A;  3H0G A;  5C8Y F;  4J9O A;  1B33 N;  4JI5 H;  3TQ1 A;  2XC9 A;  2DIK A;  3J80 W;  5KT7 A;  4FS1 A;  1XMO H;  2W9C B;  2J6U A;  4DR6 H;  1UNN C;  2NUA B;  2R84 A;  4LMY A;  5D1O B;  1N32 H;  4TQR A;  2ZDH A;  5HV6 A;  5DQI A;  3Q1K A;  4EEQ A;  2UUB H;  5KFV A;  1E4E B;  3ORR A;  4XZ3 B;  5L9X A;  3PO2 G;  2DWC A;  2MCT A;  5LYJ F;  1AN7 A;  1BGW A;  4DR5 H;  3PW5 A;  1A0I A;  5KFI A;  1XNQ H;  1V51 A;  3GII A;  2J6S A;  5JUM A;  2BQ3 A;  2NVX A;  2JA6 A;  1IOV A;  2QYZ A;  4RB0 A;  4C5A A;  4ZI7 F;  3N42 B;  4O3Q A;  2IP4 A;  4ECU A;  2Q2U A;  3RIZ A;  4HNU A;  4FBU A;  4ECX A;  1IBM H;  4UCR A;  4QWA A;  4O2A F;  3RV4 A;  1AUV A;  4ECS A;  3GTQ A;  3KHL A;  4JI7 H;  4CC6 A;  3C0F B;  3MWM A;  2XCL A;  5L1L A;  3FKI A;  4ECT A;  4C5B A;  3GTL A;  4R8U B;  2V4Q A;  4J9K A;  2UXB H;  2VA2 A;  3GV8 B;  4FS2 A;  4JV0 A;  1BNC A;  3HXL A;  2V5A A;  2BQR A;  2J9G A;  2RGV A;  1S68 A;  4ECR A;  2I8C A;  1ZHQ A;  3E5N A;  4IR1 A;  5BPF A;  4UCU A;  3MWD A;  3GTP A;  4O4I F;  1S0M A;  5DLG A;  4I55 F;  2AGQ A;  4IRD A;  4JV1 A;  2JA8 G;  5KFE A;  4O3S A;  1Z2N X;  2UUC H;  5FD6 A;  3PR4 A;  4A3I G;  5C1O A;  1I7L A;  1PK8 A;  4NLG A;  4RNO A;  4XX0 B;  2KSW A;  4EG0 A;  4DL6 A;  4A3L G;  2NU7 B;  1VAJ A;  1S97 A;  2OH2 A;  2BR0 A;  1E4E A;  1K1Q A;  2VPQ A;  2WDT A;  3RB3 A;  4RZQ A;  4O3N A;  4DUY H;  4I7H A;  4HNV A;  4HNT A;  1KEE A;  4B3R H;  2HVQ A;  3CQZ A;  4QW9 A;  1VBG A;  1B6S A;  5BR8 H;  2R8G A;  2JA5 A;  2R92 A;  1IOW A;  3PW7 A;  1Z2P X;  3HKZ E;  3MR5 A;  1GGO A;  2C2D A;  2VQE H;  4C2M A;  2HHH H;  1O75 A;  4TV8 F;  1UC8 A;  1AUX A;  2WTF A;  3K3P A;  1XMQ H;  2YS7 A;  2C22 A;  1DIK A;  2NU8 B;  4A3M G;  2RDI A;  2V59 A;  1SEI A;  3FDS A;  4LF8 H;  4PDB A;  5J2T F;  3KHR A;  5CA1 F;  2R93 G;  3GIM A;  3GID A;  4Y8V B;  2W7P A;  5KG1 A;  3TQT A;  2ASJ A;  3V6K A;  2ASL A;  1RJR A;  3OSP A;  4YHH H;  5JVD F;  4A3K G;  2YRX A;  1C30 A;  2C2R A;  2Y0S A;  1N33 H;  2YW2 A;  1X9N A;  2WYO A;  4YR3 A;  3G6V A;  1VKZ A;  3V4Z A;  5KFZ A;  5I47 A;  2R92 G;  4A3G G;  3R23 A;  5KT6 A;  3N8D A;  3MFH A;  3EPI A;  4EGJ A;  5KT4 A;  1BJT A;  2R87 A;  3K3V A;  4ED3 A;  4LFB H;  3CVZ A;  2FK3 A;  2YL2 A;  3HOX G;  5EDW A;  3L4K A;  4L1K A;  4Q8F A;  3M4I A;  1E4G T;  2FLN A;  4YAJ B;  5K2M A;  4GKJ H;  3N43 B;  4J9P A;  4AYB E;  3M9O B;  3PW2 A;  3GIJ A;  4IRK A;  2XIG A;  1N34 H;  5GON F;  2XCP A;  4Q44 A;  2E5L H;  2W8L A;  3MJF A;  3HKZ A;  2XCA A;  4F4Z A;  2FMA A;  2HVR A;  3PO3 G;  4FU0 A;  1KJQ A;  2JA7 G;  4NXN H;  2AU0 A;  4A3J G;  3RF2 A;  1Y1V A;  5D1O A;  4MTE A;  1WH2 A;  1EUD B;  1ZET A;  2R7Z G;  3KAK A;  2UVU A;  1S0O A;  1EHI A;  4ECQ A;  5KG6 A;  4A3F G;  1TWA A;  3BAA A;  1I94 H;  2JEG A;  5FPO A;  3RB0 A;  2F4V H;  4O4L F;  4ED1 A;  5KFW A;  3ETJ A;  4UCV A;  5CB4 F;  3Q8R B;  5KFT A;  4LSA A;  3GTJ A;  2GPS A;  5JVL A;  2UVR A;  3GLK A;  1HNX H;  5KT2 A;  1GLV A;  4DV6 H;  3ORQ A;  2NVY A;  2R8I A;  4IR9 A;  1Y1W G;  4UCS A;  3BG5 A;  4HR7 A;  2W6N A;  4BWS C;  4EBD A;  1SFO A;  2YRW A;  1SCU B;  4PWQ A;  5HBR B;  4U6P A;  2JA6 G;  3GIP A;  5FD5 A;  1DGS A;  1RK5 A;  4RB1 A;  3MR3 A;  4QWC A;  4FBT A;  4RUC A;  1KJI A;  2ALZ A;  2W7O A;  3QZ8 A;  3BA9 A;  2W6P A;  5IP9 G;  4DV2 H;  5KFL A;  3GIL A;  5KFJ A;  4ECZ A;  3DF7 A;  2RDJ A;  3H20 A;  2W6M A;  1WR2 A;  2VR1 A;  3RB6 A;  2UVW A;  3H0G G;  5IWA H;  4AQY H;  2HJW A;  5BMV F;  4DUZ H;  4RNN A;  4LFC H;  3M9M B;  5EWF A;  4DL7 A;  5KT3 A;  2XGP A;  3UFX B;  1FKA H;  1S0N A;  2B63 A;  3TIG A;  4U7C A;  3JSL A;  3G6Y A;  1WSC A;  3GV5 B;  1S9F A;  5EZY F;  2NU9 B;  4Q45 A;  3HOV G;  2CKZ B;  1WCM A;  2VOB A;  1TAE A;  2W6Z A;  4HQ6 A;  3GTG A;  3PW4 A;  1JLL B;  2JEJ A;  2E2I A;  5KFG A;  1VBH A;  1N36 H;  1RK6 A;  3EPG A;  4DV5 H;  3H3V H;  4BY7 G;  1KC7 A;  2FK1 A;  3OHA A;  4UCT A;  2YU9 A;  3V6H A;  3R5X A;  5FJ8 G;  4JV5 H;  4GC7 A;  5KFA A;  3FMA A;  2VPS A;  1FVI A;  1TA8 A;  5C44 G;  2R93 A;  3R5F A;  1JDB B;  3V4S A;  2CQY A;  2DZD A;  3PN1 A;  4CC5 A;  4A3D G;  2R7K A;  3SI8 A;  5IYD G;  4DL4 A;  2R7M A;  3BAB A;  2Q2T A;  1JX4 A;  1EUC B;  1M0T A;  1TWF A;  4MAM A;  4QWD A;  3KHH A;  2ZJT A;  1SYX B;  5A2Q W;  3T1Y H;  5KFD A;  2CW7 A;  2VUM A;  4MV3 A;  5LXT F;  4X64 H;  2GLT A;  5EWG A;  3QZ7 A;  4DR7 H;  2FKL A;  3BA8 A;  4WD3 A;  1I3Q A;  3U9T A;  3MR6 A;  3JSN A;  3OTO H;  4J9M A;  1J5E H;  2W9B A;  4J9N A;  2UVV A;  1KJJ A;  1P8L A;  2JA5 G;  1IBL H;  3I4M G;  2JA7 A;  3U9S A;  1M0W A;  1HNZ H;  4IZO A;  4M9U A;  5LA6 F;  2JEI A;  1XDN A;  3RJ0 A;  4ZQI A;  4ZOL F;  1DV2 A;  2GPW A;  1E4F T;  4EFE A;  5IYB G;  1N56 A;  3JRW A;  1KBL A;  4DR2 H;  4LF6 H;  4NXM H;  4LH7 A;  3T5H A;  4F50 A;  4EBE A;  5EWE A;  2V58 A;  4MA5 A;  4UCO A;  3T5L A;  3GTO A;  2PN1 A;  3BQ0 A;  1RYR A;  1I7N A;  3K5H A;  4LF9 H;  5FLX W;  2JEF A;  1CS0 A;  4YB8 B;  1GO3 E;  3RFC A;  5IP7 G;  4DL5 A;  3PR5 B;  4YJ3 F;  5KFK A;  2VQF H;  4RU9 A;  4M7E A;  4A2B A;  4ED2 A;  5CA0 F;  1ZQ7 A;  3V6J A;  4BBR G;  5C4X G;  2YZM A;  4F4Y A;  4QW8 A;  3OUZ A;  2DLN A;  3HB9 A;  2PMZ E;  3FKI G;  1T3N A;  2I80 A;  2C35 B;  2XD4 A;  4IWX A;  1DV1 A;  2AGP A;  3BJY A;  3TIN A;  2IA6 A;  2ASD A;  3LP8 A;  4ED0 A;  3GTM A;  1W93 A;  4MTD A;  2FPI B;  5DQH A;  2C28 A;  1N48 A;  3IG0 A;  2WB1 A;  4DL2 A;  4EEY A;  4YR0 A;  5LMU H;  5DG9 A;  1ZHS A;  4JI6 H;  2XGQ A;  1TWH A;  3RAX A;  5C3E G;  2W71 A;  5L1K A;  4E4T A;  1VS0 A;  2DPJ A;  4RB3 C;  4GLX A;  3MR2 A;  2HGS A;  5KFF A;  1C3O A;  2Y0S E;  4QWB A;  5DGA A;  2VA3 A;  5DG7 A;  2UXC H;  3F8N A;  1W96 A;  4QIW A;  4JI0 H;  3PVX A;  3I4N G;  2FE3 A;  4DR1 H;  4F4X A;  5DLF A; 
#chains in the Genus database with same CATH homology
 2M05 A;  4PWQ A;  1OWT A;  2FK1 A;  2FKL A;  2FJZ A;  3KTM A;  2FMA A;  2FK2 A;  2FK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...