2FMHA

Crystal structure of mg2+ and bef3- bound chey in complex with chez 200-214 solved from a f432 crystal grown in tris (ph 8.4)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Beryllium Fluoride-free and Beryllium Fluoride-bound CheY in Complex with the Conserved C-terminal Peptide of CheZ Reveal Dual Binding Modes Specific to CheY Conformation.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
total genus 43
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fmhA00
1L5ZA 2QVGA 2IKSA 4WUTA 3URMA 2PJUA 5BRJA 3W9SA 1WETA 1ZHHA 4MS1B 1DCMA 4HNRA 4KK3A 1JFSA 3BREA 3HS3A 4WXMA 7ABPA 4HNQA 3JVDA 1Z12A 4EUKA 1FFGA 3KJXA 1VRVA 3IP7A 4Q6WA 1YMVA 3KKEA 2FMKA 4M88A 1APBA 1T34A 4MQFA 4Z4GA 1GUDA 4RY9A 4ETMA 2R47A 3CHYA 4IMIB 3CZCA 2E4WA 4JA2A 2GWRA 3ILHA 1JDPA 2IOYA 3F6CA 3N0WA 4XARA 3H1EA 1JHZA 2PUEA 3SG0A 2OENG 5EWMA 2GBPA 4D6XA 1YK1A 1PHRA 1XHFA 1U04A 4ML3A 4DADA 4Z9AA 3EQZA 2R4QA 3F6PA 1SRRA 1U8TA 3N75A 4MRMA 5KQGA 3N8IA 2JVJA 2BGGA 1TLFA 2L2QA 1CYEA 1TJYA 3KCNA 2XDYA 1ZGGA 2VUIB 1JYEA 3MQ4A 4OTZA 3GBVA 3TD9A 4MR7B 1QO0A 4N0PA 3T38A 3G1WA 3QLVC 1E6LA 2FN9A 3B2NA 4Q7EA 1TMYA 4YCSA 1A0OA 4ZPJA 3LUDA 1EAYA 4YWHA 3A0RB 5EWLA 3OLYA 3HDVA 5TQJA 3OQMA 1VPWA 3OLZA 2QR3A 3Q7RA 1ZY2A 2MSKA 4KQ9A 4Z4FA 2FMHA 1YTUA 5DTEA 3C6QA 3LUJA 1ZITA 5TQ0A 4RXTA 4KFCA 4Z4IA 1HEYA 3I5AA 5JNTA 4FE7A 1CEYA 1D1PA 3KYIB 4YV7A 2LIVA 1Z17A 2FSPA 4PE5B 4E7OA 2JCGA 4TLMB 3QEMB 1GUBA 3A3KA 6ABPA 3OO0A 3SM9A 3I45A 5IBQA 3IP9A 3ROTA 1F51E 1S8NA 2HQBA 1RZRA 4N47A 2R48A 1LJUA 3JPYA 4LZLA 3HM9A 3DGFC 1M5TA 3D8UA 3FFTA 2PUDA 1BAPA 1P6QA 5T7BA 3O2JA 3OM1A 3LUKA 2FEKA 2CHEA 2FEWB 4RK0A 3FFWA 2I6FA 3QX9A 1QP4A 1BVHA 1QKKA 2ID7A 1JDNA 4RKQA 1JFVA 5BRAA 1YS6A 5CHYA 2E4VA 1Z26A 3NNNA 3F73A 6CHYA 1DBQA 3M9XA 2HQRA 1L5YA 2HQOA 5HQJA 4PICA 4W5OA 1Z2EA 3DLBA 1SXIA 1Z13A 1VLZA 3NHMA 2MYTA 4LDZA 5I4CA 1MIHA 5EWJB 2JB9A 3BRSA 4NQRA 2IPAB 4TLLB 1KRWA 3GL9A 3GRCA 1W25A 2FMFA 3LUGA 4OATA 3LUHA 2VUHB 3HJFA 2PUCA 2V0NA 1KRXA 3H5IA 1QMPA 3HCWA 4PEVA 2FXIA 2MYUA 3GT7A 3GV0A 4IILA 5FWXA 1ISRA 3K9CA 1JH9A 3RVRA 3KHTA 3RVNA 2B4AA 1W9HA 3MA0A 1DBWA 3HXMA 1ABEA 3HZHA 3KTOA 2A9OA 3Q9SA 1NXXA 1LK0A 3LTEA 4RS3A 3BRQA 4G0MA 3EODA 4QICA 1D5WA 3FMVA 3EGCA 3BBLA 2ID9A 1XWWA 3OLWA 3Q41A 3N6VA 1JYFA 1M2EA 2HPHA 4MQEA 4MQEB 4W5QA 3RVJA 3SQNA 3KYJB 3O1IC 4FE4A 4Z0NA 1U2QA 4Y9TA 2IPLA 4RKRA 3LMKA 1TVMA 1C4WA 2FLKA 2YHBA 2LPMA 2M1ZA 3KSMA 4RK6A 4WXEA 2F8TA 2AYXA 1FSPA 3RVMA 3CZ5A 5KC9A 4Z4EA 1DG9A 1FFSA 3IPAA 4RZSA 2N9UA 4IMJB 2QZJA 1BA2A 1C0EA 3CKMA 4LX8A 3O75A 3I09A 3L6UA 3T8YA 5TPZD 4NCBA 2OQRA 4IGAA 3CFYA 4MS3A 5CNIA 4E7PA 1QO0D 4LRQA 2B1JA 3HUTA 2Q5CA 4RU1A 1BDHA 5TPWB 4ZJPA 3QLUC 4Z99A 2WMYA 4N0QA 2R25B 1ZN2A 1U2PA 3NNSA 5JNVA 1FQWA 1PUXA 5TQ0B 2FTKE 4EYOA 2NZVG 3Q7SA 3MYYA 4JOQA 4JAVC 1KGSA 1ZESA 2QVCA 4MPTA 3QELB 3QLTA 4UHJA 2PL9A 4G97A 4N76A 3TO5A 4RXUA 2NT3A 4FB4A 1OXKB 3QK7A 1EWVA 1MB0A 1K68A 3JS5A 1YMUA 2QW1A 4EYQA 4OBBA 3HVRA 1Z25A 3F7NA 4CBVA 3CS3A 3OLXA 3M6MD 3TB6A 3L49A 1ISSA 1I3CA 4YRZA 5FWXB 4KPYA 1NXVA 3A0UA 3QEMA 4EYKA 3OM0A 3C3WA 2W42A 3LOPA 5TE9A 4PZ0A 1SD5A 3GYBA 1ZVVA 1BDJA 2E4ZA 4QYWA 4KNYA 1PNTA 1F4VA 4KQCA 5DCLA 3MMNA 2LBPA 1Z16A 1DZ3A 1USKA 4L85A 3TMYA 4B09A 5BR1A 1EFAA 2P9HA 3LUAA 2VK2A 4EY3A 3GBPA 3LUFA 5C5CA 3R0JA 3H5WA 1B00A 1PNRA 2DRIA 4WZZA 1NXWA 1ZGZA 3LFTA 2VYCA 4N03A 1NTRA 1NY5A 1GCGA 3HUUA 1E6KA 4MR7A 1E2BA 2X7XA 3OQNA 2O20A 3IDOA 5IC5A 5FWYA 3O1JC 1A04A 2NUBA 4NCAA 5JNWA 2PKXA 1JLKA 2H3HA 2WJAA 3CTPA 4MS4B 2RDMA 5JNRA 4DQDA 3T95A 4W5RA 4LE2A 2IDMA 4O1HA 1AB6A 3TX6A 3H75A 2CD7A 2CWDA 3N53A 2IPNA 4IRXA 2JVKA 1P2FA 4NV3A 3EAFA 4N41A 4EVRA 4ZYLA 1DBPA 4XLTA 3HK2A 2A9QA 1DJMA 3C3MA 3UK0A 1J56A 3IP5A 3M9WA 4GPAA 1URPA 3HEBA 3DBIA 4S05A 4RXMA 1IIBA 2QU7A 3RVKA 4RV5A 1E6MA 1USIA 4MR9A 2PUAA 1PEAA 4JB0A 1Z18A 3O2QB 1D2AA 3LKBA 2LP4Y 3FGZA 1ZH2A 3SNKA 5BQ3A 2NT4A 3KLNA 1LBIA 1RZRD 1JBEA 3NNDA 5C5EA 4F12A 4RDCA 1RPJA 2PUFA 1ZH4A 3H1FA 5GQSA 1YS7A 2FVYA 5B3JC 3HDGA 2WRZA 3MF4A 2JBAA 4F11A 5CNKA 2QSJA 2GKGA 1SXHA 3E3MA 4MR9B 4XASA 5FBKA 2GI4A 2KYRA 4RY8A 1NXTA 4G0YA 1NATA 1UDRA 1DRJA 2NZUG 4W5TA 3VNBA 3N0XA 5KQPA 5IEBA 1P6UA 4Z4HA 1RXEA 5JNUA 1ZAYA 3NHZA 3Q15C 5DGCA 5TQ2B 1H9CA 4MQFB 2A9PA 1LBHA 3EDCA 4RWEA 2WWVD 5ABPA 5DKFA 4YLEA 1YIOA 2FKAA 4JASB 3O21A 5CNMA 5FBHA 3O2SB 3OMXA 3UKJA 1DCFA 1D4ZA 2MYPA 4HYEA 4KV7A 4G0OA 2PMCA 2E4YA 3A10A 5HSGA 2JK1A 2H0AA 4TN5A 1OXBB 1MVOA 2L18A 3HO1A 1RNLA 2PE5A 2E4XA 1JL3A 2FEPA 1SXGA 5FWYB 3KLOA 1EWTA 4ETNA 1QP0A 5GOTA 1QPZA 4RK1A 5KI6A 5EWMB 2HSGA 4P1ZA 4Z4CA 2A9RA 2PAFA 2YHAA 1YK0A 4MLDA 1MB3A 2J48A 3CRNA 2RJOA 3C97A 4G0XA 4MGEA 1ABFA 4ETIA 3ILYA 4XAQA 3SAJA 2CHFA 4G0ZA 1JX6A 1TM2A 4WWHA 2MSWA 1KMIY 4KVFA 4Z9BA 5TPWA 4O1IA 5F64A 3RVSA 5KC8A 3H6HA 3O1HB 3OQOA 1FFWA 5IUJC 3FFXA 3JPWA 3RVLA 4YS6A 1DP4A 1R8JA 4P98A 1PEYA 3D02A 5EWLB 3T6KA 3G85A 1Y1LA 1QP7A 3CG4A 4YP9A 2L19A 2F8SA 4H3KB 4KMRA 1ZDMA 3UUGA 4F06A 4RK4A 1AB5A 4JB2A 1DRKA 3HV2A 4MLCA 2WY2D 2FQXA 4YR7A 2FQWA 2PUGA 3SY8A 4G0PA 2RJNA 3H5OA 1M5UA 3QELA 3QX8A 4D6YA 1JFTA 4F3TA 1QQAA 1EHCA 4WT7A 2E4UA 3N0RA 1EWKA 5IUKC 5E3JA 4OLBA 1DCKA 2IYNA 5JNSA 1MAVA 3CU5A 4EYGA 2FW0A 4EVSA 3LUCA 4LE1A 3H1GA 1Z15A 3CNBA 3GWGA 3H5VA 5JS1A 4LE0A 3RQIA 4DN6A 1YVUA 3QLUA 4KK4A 4OLAA 2QXYA 3EQ2A 4RK5A 5T3YA 4EGSA 3MM4A 2FLWA 2AYZA 1BDIA 1JWLA 4XFKA 5IX8A 3RVQA 5EWJA 3I42A 4MR8A 4TMYA 1Z2DA 5B3JA 3K4HA 2P4UA 1XHEA 4EVQA 3DGEC 3JVIA 3LKVA 5PNTA 3CG0A 4UHKA 1A2OA 2JVIA 2FQYA 3E61A 3Q7TA 2LUOA 4IF4A 4MYRA 3IPCA 4JP1A 1DC8A 1D1QA 1RXIA 4LDAA 4MS1A 5D2CA 1CHNA 2TMYA 2ZWMA 5ED4A 2JBAB 4GNRA 1USGA 2WB4A 4OG2A 3QEKA 4MS4A 2MSLA 4PYRA 4RY0A 2ZAYA 1GCAA 3IP6A 5KQMA 4L4UA 5IUNC 5CNJA 2PUBA 2FN8A 3DZDA 3RVPA 3RH0A 3FDFA 3OMWA 3DLHA 3H5TA 3S99A 5HM6A 5IULC 2JRLA 3VNAA 1NXOA 3ROFA 1U0SY 1VKRA 2WJWA 3OO1A 9ABPA 4KZKA 4XXHA 2MYNA 1DC7A 1NXSA 1P8AA 2M98A 3MIZA 4G0QA 4D74A 1M2FA 3HSYA 3OLVA 5TQ2A 4MR8B 5KWSA 2L17A 4MS3B 4Q6BA 4YGXB 4F8JA 3GA5A 3JY6A 3KG2A 2QV0A 3BILA 3QLVA 4RSMA 2GX6A 1LJLA 3H5LA 3CLKA 4QYMA 4KREA 3P9YA 5TPZA 1K66A 5KQLA 1QQBA 3C3KA 4HNSA 4S04A 4YO7A 4O5AA 3JTEA 1GLGA 3KS9A 3NBMA 3EULA 2FMIA 4ZMSA 5DLEA 4ZMRA 2RGYA 1NXPA 5HKOA 4W5NA 4G86A 5JS2A 3O74A 4MRMB 4NICA 3EJWA 2IPMA 4RK7A 8ABPA 1JF8A 4KRFA 2PLNA 3H6GA 2PL1A 4MAAA 4QPJC 2HJ9A 5IEJA 1QNLA 4H60A 4H3HB 3RVOA
chains in the Genus database with same CATH superfamily
3DD5A 5B6IA 3U44A 4YJ2F 3T9CA 1EWQA 3DBHA 3W9SA 1BWRA 3REGA 1OZFA 2YJTD 3BMQA 1WSBA 5FAKA 1T10A 5F7OA 2OP0A 1P0IA 4B9EA 1TVEA 1DKLA 1V3TA 3B6EA 4O0LA 4MVJG 2I0FA 3QKIA 1F2DA 3ABQB 2FWPA 1YMVA 3JAKA 3Q9NA 1UOPA 2QTCA 3DZ8A 4M88A 3VNQA 1QYDA 1T43A 3A1SA 3JZAA 3PNPA 5K0NA 3HXLA 2RK3A 3AHGA 1E2PA 2QN8A 4U2FA 1JT9A 4QUIA 3PNOA 4KR2A 3VAYA 1TK9A 2H2IA 1A5TA 2HNAA 1KFBB 2IP2A 3QPBA 5U4QA 1KP2A 2FSVC 4BWYA 1W59A 3H1EA 2Z1DA 4WBXC 2WDZA 1IY8A 1NU6A 2Q5HA 2EQBA 1WMEA 2CVHA 1KHHA 1QH8A 1TYDE 3ITEA 3WWYA 1K6MA 2I2XB 2QPOA 2WHXA 3D2LA 3NBUA 1ISGA 4TUYB 1DCTA 1E8DA 2XCOA 4X90A 3FUUA 1PFUA 3A1NA 5J2UA 2O2DA 3DL2A 5CA1B 1VKZA 1XDBA 3I30X 3FMFA 2F43B 2E18A 1NVWQ 3ISVA 1FDWA 1L2TA 3MGAA 3SZMA 4B7ZA 1Q1NA 2GM3A 1ODFA 5DXFA 2OZPA 1ODJA 3BS4A 1VIMA 1LK5A 2FGJA 3OLYA 2D5LA 4GBED 5EWLA 4BECA 5BN3A 1FY2A 2QSZA 5F1OA 4J4TA 4KQ9A 3LS2A 4QOJA 5DW0A 4RTKA 1VLMA 1SCUB 3AZOA 3I1FA 5IH7A 3KPJA 3QWBA 3DVSX 1KXJA 1EUDB 5LA6A 1YBHA 2IV2X 2OFFA 1F12A 4F4HA 1G8KA 2XOKD 4MQMA 3W3AD 1Y7TA 3NUZA 5JNTA 4I6EA 4JJ7A 2ORYA 4KQ6A 1YZYA 1RIFA 3Q5DA 5CJPA 5TX7A 4AX4A 2DYKA 3GAZA 3IDSA 3LHFA 4JJ8A 5LN1A 4E70A 1UPXA 1TK2A 4FHGA 4FCVA 5JZVA 1M8JA 1GUBA 2JAHA 3ONFA 1ADFA 2NYUA 1CUFA 1JVBA 4GRIA 4KUEA 4ODIA 2Z8YA 3E5NA 1EI9A 1GTL1 3IUEA 1OXXK 2GPWA 5CUQA 4MYCA 4BTLA 2IYOA 3A6HA 5DFAA 5G4KB 4LZLA 4URFA 3OJ0A 5FI3A 4M9ZA 4QEZA 1XZMA 3FFBA 3GMTA 4OKIA 3EGDB 3COSA 3GWZA 2AR9A 4PLVA 5EUQB 3TXYA 5HJ7A 1D2HA 1MC5A 4RK0A 1C3LA 3QKTA 3U4DA 4C4RA 4R01A 1G59A 3EZ2A 5IMSA 3Q3JB 1E7QA 3I0NA 4OYLA 5TSDA 4RKQA 1Z26A 1P31A 4LNUA 3MAAC 3K0BA 3VV2A 4MMYB 1SCIA 4D9NA 4Q5IA 1NBHA 4QJBA 1QV7A 4IQ0A 1RBYA 4PIPA 4YLGA 1E94E 3QE4A 4JBGA 1DC3A 2BP7A 2CN1A 2ZCJA 2AIRA 1Y98A 1E96A 2EVWX 2WV7A 3JSAA 2OXCA 1BYUA 3QVKA 2GM5A 4RTOA 5IH3A 4RHCA 1KL7A 3JQ9C 4CMJA 1TA4A 1W25A 3OPVA 3WLPA 2G9ZA 4WLVA 1XVLA 2VPYA 1RWVA 4RGBA 2VUHB 1PJSA 4OIMA 2BFNA 4HXGA 4AF6A 2ZZNA 2XNDD 3DEKA 5FWXA 4PGAA 1NDQA 4LYHA 4A2PA 4YDQA 4DB4A 1YUBA 1U02A 1V5FA 2A9KA 2HDOA 1KAOA 2IOHA 3T7DA 4D9MA 3WAJA 3N2IA 3G9XA 4A0SA 1E1RA 1E6EA 1E7YA 1NMEA 4N39A 3I6IA 3S2SA 5JIBA 1L3IA 2YRWA 3ZG6A 1Z0JA 4QICA 2AJBA 1WF3A 3EGCA 2FWBA 2LCFA 1JYFA 4BZXA 5LMUB 1A9QA 4FFSA 4MVXA 1U5CA 1WMAA 4ARZA 5KJ1A 1YVPA 1W4LA 3KXIA 3CW8X 1OIVA 2J4FA 3DHVA 4MVWA 1O8CA 2HSWA 1FMCA 1VXRA 4WXEA 1ZCZA 2UUAB 4LKRA 3RU3A 1DC5A 4EL0A 1I2BA 1PZEA 4IIJF 3K31A 4WNAA 3RVMA 1QFZA 4EATA 4P83A 5CVDA 4YP1A 1X7YB 5K3CA 1U4SA 3KQYA 3OX3A 1Y6QA 4TKZA 4WKNA 4RA9B 2ZIEA 2J9GA 3FSJX 4MKZA 1H2EA 3PR1A 1I6LA 3FPCA 1DAEA 1SPXA 3JCZA 3R5KA 5KSZA 4MS3A 4A03A 1T3ZA 1SR8A 2JI8A 1HQYE 4L7QA 4WINA 1MIOA 1JG3A 1QK3A 1Z5NA 2CK3D 3G88A 4QNNA 4V1CI 4XJTA 3NNSA 2C04A 3SR3A 1KK1A 5LQUA 3SF0A 1BVRA 4PRYA 2OHXA 4F93B 3RROA 1TQHA 1TJPB 2WG1A 1E9VA 2QMOA 2AOTB 1N4DA 3L7DA 1Q7CA 4G26A 1SOAA 4U02A 5HS6A 2H31A 4FYMA 4GWLA 4MUJA 4EDHA 3QUAA 3ENNA 2HWWA 1N32B 1A2QA 3IQEA 1G8FA 2OTCA 1K6EA 4RXUA 4FC6A 5JWHA 3FUXA 2XMRA 5B1DA 5IAEA 1L5NA 3TIXB 1W4ZA 3OCWA 3NBXX 5AM0A 4NFLA 3Q1KA 4JJ4A 5BVHB 1IEVA 3U61B 2ZDQA 2ASVA 1X2EA 3AF3A 4YRZA 2YL2A 1UWVA 1U90A 2OR3A 2BWJA 3WRYC 3HCEA 2JLCA 4IJMA 4EYKA 2JFFA 3H6KA 4PG7A 4TKLA 5BYBA 1T4GA 2D7CA 3DKPA 2W42A 1MPTA 4PZ0A 2HX1A 1NX6A 1YACA 1ADGA 2E6UX 4O4JF 4LVCA 2O8FA 2MDTA 2VWPA 2VSOA 1VI6A 2CZCA 1FDTA 4KR9A 1U2EA 1RHJA 3WGVA 1ST3A 4ZI2A 1U0BB 3FPEA 1Z16A 3BGVA 5D3MA 3CUWA 1WB9A 4GIBA 3AFNA 2IUSA 2RGCA 2E85A 3O8QB 4YACA 4GPBA 2I1QA 4RS4A 1KVRA 4DRXB 2VAVA 4G3XA 1RYBA 1V47A 1H3NA 3L0SA 3OE4A 4ILKA 4M21A 1PR9A 3ONDA 3JAKB 3UB2A 5JAHA 1PT9A 2X0FA 4TKVB 1TLLA 3FMOB 4ZFNA 4ABYA 1M72A 1HZJA 3WLAA 3U9LA 1B41A 5IJ0B 4REQA 1D0IA 2WWRA 3WKCA 3WLOA 1J7KA 3GN2A 2O14A 5IC6A 2IH2A 2FEOA 3AEZA 1XAJA 3DMTA 2O20A 1X87A 4LXGA 5KIAA 3R5HA 3L4KA 2QBYB 3O2NA 1WB4A 4PR0A 5B7NA 1GAXA 1R15A 1XQYA 3EDYA 4MS4B 5JDIC 4RMHA 2NVUB 1CJTC 4ZVPA 2PN1A 4F4UA 1U63A 4NENB 1P18A 1WHSA 2HDNB 1BYIA 3HU1A 4ICIA 4E33A 1WB6A 1Y4DE 3N8DA 3K0CA 2LW7A 2CWDA 4PCLA 1FXWA 3TTTA 1DQYA 3HR7A 3MGBA 5JS8A 5LQNA 1QF6A 1Z3IX 4TKUB 1P2FA 1C7QA 3VR4H 4PG8A 3TVTA 1E0JA 1C3JA 1UBFA 1YQGA 1A97A 1DUVG 2ABWA 1U8FO 2Y0EA 4H7PA 5ALWA 2NMVA 5I3CA 2DFLA 1Y4UA 2WR8A 3MOGA 2ZB7A 1JTFA 2IFTA 3GH3A 4XYBA 4RPGA 1RM4A 5JCOC 3LU1A 3WDLA 2Z2ZA 4JS0A 5CYPA 3EZ6A 4OF4A 2PVCA 4DYHA 1T6BY 3H2GA 4OQNA 4DWVA 2O8FB 1SZDA 5FOTA 1OJ7A 4RV5A 2IYQA 4EKYA 1F5NA 1DFGA 1K4MA 1B42A 1J21A 2J5RA 1NNI1 4EKGA 1G19A 3ABZA 3PKIA 1MG5A 3B36A 4P92A 1DAMA 4PLTA 3ZD8A 1QU3A 4LHXA 3LPNA 3TQTA 5JZSA 4TMXA 4ER3A 4I66A 4DLTA 2CV0A 5ILGA 4EPRA 4OM8A 2EZ4A 2W90A 4EHFA 4KODA 4BP1A 1OB5A 1J0EA 5TXGA 4C06A 4M8LA 2BT4A 1M2JA 2V98A 3F7TA 2IC5A 2NXJA 5AO9A 2PKEA 1RABA 5EQFA 1SPBS 1SXHA 1GZ4A 1BCSB 1ODLA 3ESBA 3T9BA 4F86A 3GT4A 3U1BA 3KV3O 1UMCA 1YA4A 4RY8A 4WX2B 1OBVA 5U1PA 5AJZA 4FFPA 4D9HA 1DRJA 2O3JA 1Z4OA 1Q14A 3P0RA 1D6MA 3N0XA 4FONA 5H82A 4G5HA 1SOVA 3UC9A 4BFXA 5KQPA 1HE4A 2BHTA 3AHFA 4XPZA 4IY1A 1SHLA 2WK1A 1S1CA 4I1SA 3N39C 2OC9A 1ZOIA 2DLDA 1WDKA 3R3XA 4NH4A 5LMZA 1NBWB 4KO3S 1GCOA 5SZJA 4F3NA 1H9CA 1EVZA 1CLEA 2IEDA 2AFHE 1X7HA 2J09A 3AIIA 5ABPA 5ALIA 5HQ3A 3GCXA 1PLKA 5AKIA 5AM4A 1KR2A 1N2SA 1UBMS 1W30A 1P2VA 2JGRA 3O03A 1VA5A 3KJGA 2GLUA 4XKJA 4PYOA 3UAOA 1N5OX 4AZVA 2PKRA 3EASA 4C7OA 5ECDA 1YBFA 2Q6LA 4JR1A 3I9JA 3KYDB 4X1YB 1OFTA 3TW4A 1FP2A 2Q4RA 4BE7B 2I4IA 2O5CA 2R6GA 3IGFA 3R5JA 3UV7A 1PJQA 2DPYA 3KLOA 4TGLA 3THWB 4POOA 2QMQA 5J63A 1PUIA 3FNQA 4X62B 4LRTB 2VHEA 3DF7A 4GZLA 3ZBTA 1SOMA 5J4LA 2PAFA 4A82A 4DWWA 4FM9A 1RRMA 3OHPA 4K5QA 1ISIA 1RYEA 3DPUA 3IKLA 3D54D 4FMDB 3SQXA 1JX6A 2R8EA 2OFWA 1EE9A 1RAHA 2PLFA 4GE0A 3CLSD 3OF2A 4NP6A 2Y05A 2WFZA 4AN0A 1SOUA 4QTTB 4BNDB 1FZTA 2WOOA 1HNXB 3P9PA 221PA 4HS9A 3OF5A 3QMWA 1M10A 2EG5A 4HI0E 4WXYB 2X2EA 4XA8A 3IVXA 1JJFA 2GXSA 5F2OA 5I4KA 3SYLA 3T6KA 3QJYA 4KDFA 4TXLA 1Y1LA 3KWLA 1ZHOA 3DV0A 2ZBVA 4W1QA 1ZM4A 2YZNA 2F3QA 1XKLA 3S68A 2ZSEA 1DAKA 2HU5A 3KUXA 2GPBA 3D8HA 1CR6A 3UAXA 1HNNA 1GDDA 1S8AA 2ENUA 4CQMA 2ONYA 4LF5B 3JQQA 4PFSA 5IBQA 3PJRA 3GI1A 4NEHB 3ANLA 3NBYC 1IZ7A 2WMDA 2XOKA 2QN2A 4NMXB 4TMFA 1E5LA 1UIRA 3CVWA 2AXNA 4P86A 3PGVA 2ATCA 4I2NA 2RJ3A 2GAFA 5JEDA 1ZM7A 3D6TB 1P73A 3THWA 4KO8A 4PHCA 4M1ZA 5LBTA 1L7OA 3FKQA 5TF0A 3ZU6A 4IIJA 3OEHA 1H4TA 3NIWA 1PQPA 3SC2A 4B3HA 2EHDA 5BURA 1L8OA 2Y6VA 5ULLA 2R00C 4IMRA 4Q3OA 3L41A 1JJ7A 1VRCA 2WU3A 3O83A 4HXYA 4EH1A 3NOXA 1BZYA 2BM1A 3IEUA 3MYRA 2V9CA 4RK5A 3ZZMA 4BRUA 3KKQA 2HCRA 1Q7GA 2DKNA 1DEHA 1TE2A 5IVHA 1HE2A 2YV3A 2H3EA 3PCRB 2G6BA 3T1VA 4A0FA 5GTDA 5EJ5A 2AFIE 3A1TA 3AO0B 4S2EA 7GPBA 5DM2A 4DIDA 3BXZA 3JVIA 2ZBFA 3RKUA 1J07A 1FSSA 2BFFA 1UC4B 2DUUA 3RASA 3GLIB 2CCJA 1V45E 3PRHA 3ZY4A 2BTQB 2JCSA 3I9LA 4MYRA 1D1SA 3G8YA 1V1RA 2VUUA 1XK6A 1JUDA 4R8LA 3OQJA 4OQXA 2B21A 3CWZA 4WBNB 4JENA 2VTBA 1CNFA 2C20A 3HWWA 2IBSA 1P77A 5IVPA 2C7RA 3GUYA 1D09A 3RS5A 1JLMA 2OO3A 1KI6B 3FHCB 1JR2A 1PQWA 4DUYB 1FYFA 3MUOA 2PGOA 1S8FA 3SXUA 2AUTA 2QGZA 5ILQA 3ZCVA 3J7AC 2ZCUA 4LFBB 4XB1A 1Q1QA 3EK2A 3PC6A 4FHFA 5CBPA 4F9GA 2PZLA 1RRCA 4AKHA 4P3YA 3QTTA 4C7OB 3AEYA 2WJWA 3RUEA 4L5AA 5CGZA 3GLFE 3Q10A 4ZI3A 3M1YA 4PYJA 4JT4A 4LBYA 2B1IA 2HNBA 1VGRA 4PBSA 1YB6A 1Z47A 2ZYIA 2RB5A 4DIOA 2ATEA 3D0RA 4PZYA 5GONA 2O2GA 4MUFA 3LBHA 1JMKC 1G2IA 2O0KA 4MS3B 4YCBA 1WVGA 1JAXA 5EYPB 2HADA 3H04A 3KL4A 1SH7A 2FJ0A 3L7BA 4Q7KA 2GN8A 4FBMA 4RV4A 1J2RA 3UPDA 3D8TA 3GLHB 3HV0A 4UCXA 1CBUA 4PAMA 5K45A 1UMCB 5LXTB 4AICA 4PANA 1DBVO 2GHQA 1M2OA 4UNPA 1MQ9A 3OESA 4TV8A 1GG2A 5FPYA 4F4JA 3EXAA 4HXEB 3HBJA 1SXPA 1GZ7A 3DV2A 4MMZB 4G4SO 2XCRB 2HHAA 2HGSA 3H6GA 1VE7A 1I1NA 3IVRA 3UAWA 4B8ZA 5HRCA 5LQRA 4K6KA 1CT9A 3KFXA 4C30A 4UQLA 2WYIA 3OWHA 5IEJA 3GLGB 1GTVA 1K3TA 2PS0A 3ADOA 2ZUTA 4X66B 1GQSA 3C98A 5IBCA 3E6AA 1N77A 1QGOA 3FLAA 4FQ8A 4RE6A 1ULUA 4WAUA 3I9NA 3OECA 1BGXT 4B2IA 3B6IA 5LZ2A 2CXOA 3GF4A 4DLVA 2ZSUA 4WXMA 3IL2A 4LA4A 3I62A 2VH1A 1H1TA 3BQ9A 2GFHA 2RC5A 1X15A 1MC8A 3PEFA 3V3TA 4RVFA 1LGYA 1D7AA 2FMKA 3N8KA 1C3EA 3N5KA 1DKOA 1FRFS 1Q0QA 5AVUA 1Q7BA 1UQTA 3DFZA 3PKJA 4R7ZA 3JYLA 2HMUA 3NTOA 1PNQA 1WEKA 3OTWA 1K6IA 1SA0A 4K1LA 4ZQCB 2FPIB 2QMYA 3FYHA 4G2NA 3WISA 3LO8A 1KORA 4BV2A 1C1HA 3C48A 4H7FA 4C29A 1ORIA 4A7PA 3PZRA 4Q4HB 3SG0A 1T0IA 5IBRA 3AG5A 3NLLA 1JLHA 2AZTA 2V6MA 2EQAA 3MCUA 1RI1A 1TQ8A 2QWXA 3MXOA 3QE2A 1OGYA 4IJKA 1KOLA 3GAFA 3IEIA 2ZYTX 3V00A 3WGGA 1QP7A 5AOVA 2B6NA 3DEAA 1NLZA 2FOXA 2EBFX 1G2PA 3W5SA 2QTMA 3IR6A 1TLFA 1WWKA 1X80B 5T6MA 4DLWA 3O8RA 1F2UB 5HE8A 1TC2A 3HUFA 1JYEA 4DUZB 3KPUA 5HF5A 1WOYA 1QO0A 4RTMA 4NL4H 4PW0A 1TRKA 1BO6A 4I46A 1TFRA 4YJ2A 3LQ1A 3ONVA 3K70B 2QE6A 1UMKA 2C8JA 1KEWA 3GARA 4PZEA 3U7QA 2WWWA 3LZ6A 1SIBE 4YWHA 1R4MA 3P97A 3PNBA 3QA9A 4QVIA 3NJ8A 3Q7RA 3SQDA 5I7OA 3WNBA 2JI9A 4HPJB 2QTAA 3VYUB 3KVVA 4PLFA 3L0DA 1SG6A 2Q5IA 5TQ0A 4C0HA 3AB8A 1JR3E 4BGVA 5T4HA 1ZJJA 5D3MB 1OT3A 2A5GA 4WLFA 3LLSA 2HAEA 2VQFB 4H0NA 3ZY3A 4AKEA 4KXNA 5AOAA 3FDXA 3BIFA 3TPFA 2YICA 1QHEA 1J49A 4B71A 2FN3A 4OI4A 3TBKA 3HYTA 3MTGA 5CXQA 3DYBA 4MVJF 1M8KA 4BX0A 2CC2A 4C43A 1KPHA 1DPFA 1JQEA 2ZEJA 1X70A 2Y1XA 3JWEA 3C39A 4MRVA 3WMRA 3ZCXA 2BL4A 2NP6A 3DKVA 2GK6A 1RBMA 4A6XA 2AHOA 4GXNA 2JGIA 4Q3CA 3DL4A 1Q12A 3RVLA 2J6CA 4UM8B 1EZ4A 3GA7A 2JASA 4O8CA 4QEDA 4A26A 1CIPA 4AJKA 2F17A 1AY0A 4HWTA 1GZ6A 1BAPA 2C7OA 2CMGA 3FYSA 3O9ZA 3TW0A 3MWYW 5K8UA 1TKRA 1ZJ4A 1MGPA 1KSGA 1AF4A 1W88A 2ID7A 1MBZA 4DYDA 3K0EA 3BQMB 2ZU0C 3I32A 2CXRA 1PGPA 2WABA 3I1JA 3MRTA 4RV9A 5J5CA 4Z49A 1YJBA 2BD0A 3BTSA 1TIPA 3TEFA 1U7HA 1DBQA 1NF8A 4N6GA 2GK4A 2HQOA 4W6QA 5KAMA 4EIWA 1PL7A 2EX0A 3OEEA 2JLWA 2IEAA 4OUKX 5B58T 3VQTA 1NQOA 1VL1A 4OGFA 3A4TA 2RHCA 3E9DA 1KI1A 2OMEA 2XNJA 2X19A 2C5BA 3EXIB 2QUJA 4I9UA 4QUKA 5K4AA 1FYVA 4ZOLF 3TTUA 5BSFA 5CBKA 3PYXA 4AJPA 5BR7A 3ADKA 1HDGO 1TA9A 3LUGA 1RC8A 3QVVA 5DNWA 1PR3A 1QG2A 5JCJA 4M0KA 2GYYA 4C01A 3GT7A 5JCOA 4Z2YA 2ILVA 5D3KA 2J4CA 5TC4A 2WF5A 1QHGA 1JDBC 2XCUA 2VJBA 4LMBA 2NO9A 3I5XA 3ZWMA 2AJDA 4CKWB 2HLPA 3K16A 1F0NA 3KTOA 2L82A 4HRYA 4AJ4A 4FW8A 1H3EA 5EZYF 1W581 1QB8A 1N2OA 2E37A 4QRDA 1SVNA 3GG2A 3H8WA 1GN9A 3PGA1 4WACA 1VJTA 2Z3VA 2B9EA 3QX3A 4L27A 3I8OA 3N6VA 3TW6A 1B8OA 2XB4A 1J24A 1NTOA 5IM4F 3D6VA 3NFRA 1QOQB 4CQMD 4PFQA 1J0CA 4KRGA 5BSWA 1Z73A 1KGDA 4LZOA 4F0JA 3A27A 1WD5A 3JR7A 4AG6A 3GZJA 4AY2A 2O05A 3GLVA 4FSHA 4A0GA 1ETUA 4O4HA 1XCJA 1GG8A 3E1KA 2O4UX 4OLJA 4R3WA 3M1AA 3RNLA 2I1WA 4BO3A 1ZEMA 2YZGA 3FHOA 3K6JA 1C0EA 2IYRA 4RD1A 3O75A 3WIOA 4AJLA 1XPRA 3T8YA 5D3QA 3M6UA 5ARDA 3N2EA 3AEKA 1CUDA 2Q5OA 2EFCB 2B1JA 3CCCA 3FAKA 4RU1A 4W5HA 3KYBA 1FFXA 1X8JA 2IYPA 3PGJA 4KNVA 4KO4S 4KVZA 4O4JB 4YUWA 2CV1A 1Y34E 3HA7A 1WW8A 1XZEA 4MDEA 3L05A 1TEZA 2Y76A 4Y2GA 1YA6A 1P0CA 4K9RA 5ERXA 4CKXA 4DARA 1V7CA 1PLLA 2QJTA 4QG3A 2FI1A 5CX4A 1ZESA 4RJTA 4B4VA 2CLLB 1EZZA 3EG9A 4KN6A 3OWXA 2IOQA 1OH6A 2BV3A 3I9FA 1Q5PA 3S8MA 5A6VA 4YPVA 3V7WA 1GQQA 2VOJA 4NU6A 3UMFA 4WEQA 3W6PA 1YMUA 1VMAA 2ZE6A 2C4TA 4L22A 3DVAB 1C1DA 3TOVA 3C7AA 3QXJA 4QT0A 2NZWA 2WDPA 1XP5A 1N5DA 2PH3A 4G67A 1JHQA 3NAZA 3QPUA 5FTJA 2P5SA 2F3SA 4M0CA 2H08A 1OKKA 2R7MA 4W7IA 2ZITA 3K0KA 1GNQA 2Q0XA 1K0UA 2WSBA 5BORA 3MB8A 2CMKA 4X7RA 3F6BX 3H9GA 3V97A 2FNAA 3THRA 3U3DA 3W6OA 1V43A 4IINA 3HJCA 1G16A 1RYHA 2K87A 2V1UA 2REBA 4EG6A 2HLNA 4IWXA 1UBSB 1V8BA 3QLJA 3AHDA 4JQSA 3U7GA 3MSCA 2A59A 4YHBA 3YASA 1UKCA 3UJDA 3ABRB 2EWVA 3LKZA 4NS4A 4PZLA 3JATA 3SOZA 4R1QA 4C0LA 1GZDA 2RCNA 4ZHQB 2CNLA 4QREA 1T2CA 1CUVA 2AEJA 3AVQA 5AVOA 4NDNE 4L76A 2HB6A 1OLUA 1ZGZA 4MWOA 1K5PA 3QXXA 5GJVC 3RK4A 3JQAA 1L1RA 4QUDA 3PXDA 3K09C 1E6KA 2FQQA 3EUWA 3NPAA 2D54A 1X7GA 1V8FA 2KMLA 1P5RA 1L8XA 1CR2A 1WY5A 1F0KA 2BMWA 2OD2A 2PY6A 1TM3E 2XR1A 1L4HA 1WKVA 1QZZA 2BFEB 2P6PA 4UEWA 4ZV7A 3RO7A 4HNUA 1NE7A 4BBJA 4JSYA 5TMPA 2I6QA 4OUDA 4PZZA 4QGHA 4DEYA 1GPLA 3BD6A 5L6LB 3CB4A 3MBKA 3T4UA 1FNNA 2JEZA 3IQGX 4ZJUA 5B2EA 2DWPA 3D0OA 3N53A 4W7SA 3EVNA 1DC6A 2MTBA 2CUKA 1EIWA 1NW4A 4E5MA 4ZYLA 3FI0A 4ZU6X 1R88A 2FPRA 1DWUA 1OI7A 1XCGB 1M7GA 3E4DA 3ECAA 3L0YA 3KKZA 2OQVA 1T13A 2VR1A 4ZAZA 4OJTA 1LF5A 1XD2A 4D46A 3IQHX 3UG6A 1GTZA 3OFVA 4WKCA 5ESWA 3PHLA 2XUGA 2D06A 2QSUA 3SIXA 3SNHA 3T5CA 1UP6A 2NO6A 3HL0A 5JADA 3JQ9A 4MVJM 2Q2VA 3LTNC 2VDOB 3E0QA 4MR9A 3WRXC 1I1QB 1Y82A 3IBYA 4JB0A 3EZ7A 1KO5A 1ONSA 2QTBA 4CIWA 3TG8A 3PI6A 3X1JA 2Z98A 4E6PA 3W5AA 1SXQA 2LP4Y 1KO4A 3R5TA 5EEGA 4NV1A 3E9CA 4W5JA 5DU2A 3SYTA 1Q3TA 4FT4A 1H3FA 1NKVA 1U7UA 1CQJA 2Z08A 1RYZA 4FN4A 2BZ1A 5GJWC 3RU9A 1W2GA 3WG9A 3EPKA 1Y8RB 3OZFA 4HFRA 1SCDA 2PSHA 1TAUA 3QF7A 5CLGA 1CUSA 5B37A 4LWQA 3ZDQA 4UMDA 4F2PA 4QPDA 3CUKA 5FCDA 1NPYA 4XASA 3QV2A 5FBKA 4AL4A 4CGZA 1EH5A 3GLKA 4IIUA 3ASVA 4D0RA 2GPAA 4BMNA 5TB5A 3BULA 1J0AA 2KWIA 1XZCA 4JL8A 3CNNA 4NBLA 2ZI9A 4JLSA 4QECA 3PE3A 2GSWA 4UXIA 5ILOA 1NYLA 1R10A 4GHWA 4D4IA 1AA9A 4FMDF 3NHZA 4RD2A 5C4GB 1CK4A 4Q7MB 2UYHA 2NADA 1E2EA 1KP9A 3ZLBA 5CH8A 2AZ4A 1XXLA 1U0HC 1YIOA 3C6ZA 2ZKIA 2PXAA 3V1YA 2VRCA 9ATCA 3OMXA 2C58A 3S40A 1WJGA 5TT1A 5TNXA 2AF3C 2CYAA 2F1HA 3WP1B 1EUYA 3P4XA 3A10A 4MW4A 1GTSA 5B36A 1GCUA 3PXAA 4BQIA 1QG4A 2FEPA 4C5BA 4WLUA 1RAFA 1XZGA 2ADOA 2X8AA 3C0KA 4IP0A 5DHPA 3R41A 2O8CB 3ORQA 1LSOA 3V34A 5LU8A 4S1OA 5JJ5A 3QNWA 4XM0A 2VRBA 5KTNA 2HIMA 1ZISA 4KUHA 3ZV7A 1SQ6A 4X44A 4RK1A 4KQEA 1Y1TA 5A3JA 1ORTA 1QPZA 3I72A 1J1IA 4TV9A 1W36C 2WINI 5K01A 4XTRA 3QIVA 1WXHA 1GY8A 4XH9B 1DZIA 4UARA 5K3FB 1ABFA 2B9VA 5T4FA 1N0WA 4X5OA 1DQNA 1QK4A 3PUJA 3CT6A 2GAJA 4TV8F 2JAXA 5HKKA 2YV4A 5F7JA 5TPWA 3VO1A 3LX6A 1FFWA 2QTZA 1U8UA 1SU8A 3RWOA 2IZ1A 3B3JA 4DLKA 3M5PA 3T9EA 2P9CA 2LCQA 4YS6A 1XZQA 2WIJA 4I9FA 3IUQA 4N1AA 4NOLA 4NOMA 4P98A 2L0XA 4GKBA 4YBRA 3RRXA 3GEBA 4Y9UA 5J4YA 4RENA 4AP5A 3DDCA 3GFOA 2IODA 2VPIA 3LHDA 3NX4A 3R75A 4F72A 1ZD8A 5CDHA 1O0BA 2IVZA 4B9AA 2A0WA 4Y9SA 4QUGA 2IS2A 1DL5A 2AD1A 1N57A 2HA7A 3QE3A 2PSJA 1NVKA 3DBHB 3GFTA 4PXYA 4UDNA 4YUYA 3I04M 4MLCA 1LXCA 2TS1A 3HYSA 4LN1A 5GGXA 1XOIA 4Q7QA 2O2SA 4NCNA 3IIJA 4GP7A 4ZV4A 4L4SA 5JSFA 2KBEA 3D7NA 3H5OA 3IESA 4KE8A 5IDXA 1R9NA 4L5BA 1Z8FA 3QVUA 3LBAA 3HPRA 1H2YA 4XWYA 3DMHA 5DM4A 2QJFA 5TVKA 1ZH0A 1MF7A 2DJIA 4GR5A 2R1VB 2DUMA 3HYLA 3W2HA 2X4DA 4HZUB 3TIVA 3WDKA 1E99A 4LE0A 5CLQA 5B1SA 4DLNA 1P2DA 2FJPA 5CX1B 2ZJ4A 5E2AA 5LMNB 1MU0A 4EPTA 2VUSA 3QFRA 4IQGA 2P6RA 4G5QA 2RGXA 3DW1X 1EXMA 4K8RB 4BFVA 3LC1O 4KL8S 2G8LA 5DE3A 3TTWA 2M9MA 3WYFA 1SBIA 5B1HA 1KK2A 1JJAA 2J3QA 3LVQE 3K6SA 5H80A 3I6BA 4AAYA 2XADA 4TT3A 3VKFA 2IZ0A 2W6OA 2IL1A 1P7VA 3LUBA 3RRNA 3ZI0A 2V7EA 4OJYA 5MN4A 3U1VA 1PS0A 1TPYA 3F71A 1EVEA 3T7RA 3FHJA 3Q8LA 3HUEA 3LK6A 5LPNA 1CHNA 2WWGA 3DEJA 2FZKA 1FTGA 1U0FA 4UUBA 3EIEA 1USGA 2C7GA 3LKDA 4BQOA 3FPKA 3COVA 4LYYA 1KYYA 3QVGB 3TQRA 2JIQA 4RY0A 4KIGA 4A8JB 1RCUA 4B79A 5JSZB 1Q74A 1AURA 2Q9BA 4QBIA 5FUXA 2FG6C 4GOMD 1G8MA 4ZPXA 4DZRA 3QHPA 3DEIA 3OMWA 4LPSA 3AHIA 4QYIA 4XYEA 3H2KA 3RT1A 5HRAA 4IZ6A 1SC9A 1JHOA 4CIXA 3PT5A 3T61A 3UANA 1GYQA 3ZGZA 3N2YA 4S1WA 2VYND 3MCAA 1GZHB 3FDZA 3VNUA 1Z4NA 4J16A 4HHEA 4ZT2A 1V35A 3HGQA 3PSAA 3PC7A 1F1JA 3IPXA 5GY7A 5K0LA 2I1VB 4RD6A 1NRJB 2MSCB 1HQCA 1V4NA 2M98A 5FYDA 2OKCA 3BYZA 3VGPA 1L5SA 1AIPA 3BFVA 3GYGA 5CT8A 3ZE2B 1SC3A 3IQZA 5LD2C 4US1R 1EB9A 3Q0TA 4Q6BA 5CCBA 1AXGA 3E70C 1ZK1A 1SUFA 3QLVA 3K96A 1U2RA 4HAUA 4PTLA 1AQIA 4RGQA 1M3SA 1HPLA 2OCKA 1IY9A 3T7KA 3PTZA 4FMCF 3CX3A 3ZHZA 4C05A 4BATA 1SK9A 3MD0A 1H0SA 2IEZA 4FR2A 2A35A 1K8RA 1UJ6A 1XDWA 3MWDB 1UDXA 2GT1A 1A8SA 3F0TA 3RCBA 3TGWA 1KSHA 3FCAA 3FPBA 2ZWPA 3VR0A 3TOSA 5TEVA 2ZPUA 4U00A 4PX2A 3TPCA 2JFUA 4M9UA 1W6UA 4LI0A 1N78A 3B53X 4DSNA 4H60A 1I14A 3K1ZA 4ZT5A 2Q49A 3C3AA 4QPNA 2W2QA 4QUHA 4WUTA 1FFCA 3URMA 4DGQA 3UAYA 5A3VA 4Z51A 4MAMA 3RI3A 1BHJA 1UJNA 1ZHHA 3OBIA 1DG1G 2CDBA 4L15A 4IVQA 5L4LA 4U7FA 1DCMA 3C8UA 1A8UA 1P7ZA 3KOMA 1Z0IA 3DMPA 3F8WA 1ZO8A 5EZYA 2B36A 2G63A 1OILA 1KMQA 1CQIB 1OWLA 2YVAA 5LZ9A 1ZD5A 1ZX1A 4CKCB 3KKEA 5A04A 5ICGA 3T7IA 1P9OA 3FI9A 3G2OA 1APBA 4CMKA 1N2GA 3VYVA 1E2KA 1GUDA 1J09A 1U94A 2IW3A 4RY9A 2WWHA 3UJ6A 3ZJ4A 2BKEA 1NVDA 4NPHA 3VU0A 4PVCA 1KQFA 4JWTA 4DJEC 1OI3A 3ZUPA 2IA5A 1CS4C 5AM2A 4I1PA 2DFTA 4IVNA 4Q34A 2IOYA 4ACBA 4TTPA 3PNMA 4WIAA 1H2FA 5EWMA 3JW8A 1UPCA 1DELA 1PZFA 4PV7A 2X0RA 3F3YA 4HQNA 3F6YA 3HQ4O 5CA0A 4EKNB 1SRRA 1ESMA 3DBRA 3NUGA 4JYBA 4L0CA 4DW8A 3LSYA 5ALFA 3OJCA 2ZDHA 3N8IA 1JR4A 2JVJA 4G8BA 3CH7A 2AA3A 3SS7X 1U2SA 4BJ6A 1ZL2A 3F3MA 3VPHA 5AW2A 2W00A 1EFUA 4B5KA 1P0FA 5C1BA 5JCPA 3JWGA 4IUBS 2BJWA 3DP9A 2NLOA 1T1GA 2V7GA 3ZJ5A 5DK4A 1Y5MA 3QLVC 4K6GA 1QV6A 2XMCA 1FE8A 1BH6A 1Z4JA 3H5AA 3K5WA 4BYMA 4X6YA 1OXTA 2B30A 4JSTA 4MVCA 2H85A 5BN5B 3RGWS 3VFDA 4DFDA 4QM7A 1Z3CA 2P6UA 3I2KA 5BSUA 2N46A 1OTHA 4YMTA 3SK0A 1PEDA 3NDBB 5B6PA 4B75A 1M6VA 3IIEA 4Y30A 1Q83A 121PA 3DBVO 3OZXA 4EB6A 1W94A 3L1IA 3UMJA 5JSHA 3TLKA 1WLYA 4D41A 3QBJA 1R0ZA 3FPSA 2R11A 3JWIA 2MU1A 2YRXA 2JCGA 1YC5A 1GSIA 4P4TA 5DN6A 4TLMB 4BFYA 1GPYA 4WOKA 3ZLTA 1SNYA 2CMDA 3QFFA 3JXEA 3RIHA 3PC8A 3IERA 2WTMA 4YO8A 2GYUA 4KR6A 4KFRA 4P38A 2HQBA 3GNLA 4R0VA 4BQQA 4YRSA 4RULA 1RZRA 3AVWA 1O54A 1LJUA 4BFWA 2NTJA 4DBLC 3MMZA 5JSKA 3ZW8A 4OHVA 3CONA 2W6ID 4PPQA 3HMKA 4WASA 3KC2A 3TSAA 2RHMA 1AMNA 4JYAB 4EW3A 4Q18A 2I3ZA 1AN0A 3T4PA 3QYPA 3LA8A 4M0LA 4POAA 4F3CA 1GL9B 2FUKA 4P81A 1BN6A 1BVHA 3DAGA 3X1ZA 1JDNA 4PG5A 3A04A 5LB4A 1YS6A 4HGYA 1RWMA 1OMOA 1MJNA 1M6HA 4QDXA 3S2FA 2BF4A 3T35A 4XWOA 3F73A 1UZNA 4RHFA 2FFJA 2WHPA 1IK6A 1Z2EA 3B82A 2OGTA 5BP7A 5C3UA 3LC7O 5IDYA 1BGWA 1PBTA 3CJRA 1EUCA 2ZSBA 1YZQA 4QOIA 1KS2A 3MD9A 1M6VB 1CF9A 1IN4A 5EIBC 3R7FA 1ODKA 5B7PA 1G3QA 5JAQA 3R9WA 2XVYA 5DTRA 4A8JC 1KVTA 2ZJ2A 3KQNA 1B2RA 2XTMA 3MMSA 4K9KA 3TD2A 2XI4A 1HRKA 3U48A 2G0NA 3I0ZA 4BX9A 2MYUA 3RK0A 1ISRA 1NVEA 4I7EA 5LA6F 1HL3A 1U2ZA 1XRNA 3WIBA 5AT1A 4D4HA 3OIUA 3TB4A 5KOHA 4PAWA 3IE1A 5DYIA 1P1KA 3PTAA 2NN3C 2A9OA 1IVYA 2JH8A 4IO0A 3IDFA 3ZXYA 1YR1A 3V7FA 3W4IA 1G20B 5LQJA 5LSAA 2C0CA 4Y0NA 4JLUA 3AI7A 1GYRA 1QVWA 2IT1A 3AX6A 5CTJA 1HR0B 3ETHA 4TWJA 1Z28A 3HH8A 3H2JA 4CQNA 1EJ2A 3L0OA 3QYFA 1CJCA 1X77A 2QYHA 5AXCA 1PUJA 3SQNA 1X3LA 1FRNA 2FXVA 4FE4A 4GI3A 1ID8A 3FNFA 3VSDA 5KNCA 3FWKA 4OY3A 5J2UF 1G3UA 4Q93A 4BUZA 4QDKA 4RK6A 4ZQIA 4HN9A 4ERXA 5KTPA 4CKWA 4TTVA 2ZTMA 1ZGCA 1IJBA 2BMVA 1BXRA 3VBEA 3CVOA 2CLDX 2QZJA 2J08A 3FWZA 1BFDA 2QD3A 1T4BA 1U7PA 2GCEA 2ZXFA 4FQ7A 2WUEA 4I9NA 3C7CB 1TT5B 5TPZD 4NCBA 4PG6A 4EB3A 5EIOA 3CFYA 3RAGA 3VU3A 4DMRA 4QLBA 1I94B 1G5RA 2NTNA 2QRHA 3NHYA 4LRQA 2P0EA 3I4FA 4XX0B 3WKBA 5KKNB 1SRQA 1LTQA 4HEA6 4Q9NA 3HO6A 3D2CA 1HQDA 1XEFA 3JQEA 5JNVA 4Z8YA 3SZUA 5HPYB 2NVUA 5GONF 5LBIA 3P2IA 2HRCA 4LPKA 3UMRA 4FZ3A 2Q3EA 3MN1A 1VLVA 1EESA 3NO4A 5L45A 3DMGA 4WKPA 2FPPB 3UT6A 3HXQA 5CB4A 4AN1A 4UHJA 1D0VA 1E3WA 2I4TA 3SYRA 5H8WA 4PRKA 1KE2A 2A3RA 3EAQA 4M2LA 4M87A 5CG2A 3RTGA 4CODB 5E1MA 3HB4X 1E0KA 4WDQA 7YASA 1Y9EA 1U11A 2GTIA 4UTXA 5DGTA 3UGTA 1E66A 2XF8A 2YR0A 4GC5A 5A62A 3L49A 4C2UA 4RLSA 4QT4A 1PGJA 2XVAA 3GQBA 1FX1A 2HV8A 4AZSA 5A4IS 2PFKA 2H52A 5G2OA 1DGQA 2H4YA 5SZIA 3O47A 4ENUA 3HVIA 4ND4A 2AJ8A 3HKEA 2XIQA 3BGSA 1H6AA 1XLTC 3GIWA 1E2NA 4GF5A 4O29A 5CGQB 4ZCRA 2FLVA 3PUWA 3FLBA 5B7QA 4TL8A 2VTVA 3S5JA 1H2WA 4JELA 1W0CA 2EU8A 1UK8A 2W6ZA 3E0XA 3SSNA 5HUQA 2OCIA 2Q45A 1NIJA 4HS4A 3V8PA 4PQEA 4RVSA 3WGMA 3EPHA 1AKQA 2HFJA 4F9TA 3PD7A 1NF2A 2ZSJA 1RKUA 3SZRA 1GU1A 1JKJB 1ISJA 4LC0A 4O8ZA 1UC5B 4Q9IA 4BC0A 4DRXA 5L8VA 4CTKA 2X7XA 4JXZA 4I5IA 4CM7A 3E22A 1G8PA 1EA7A 3FWYA 1YB2A 5IC5A 2I2CA 2NPOA 4WJKB 3UCEA 3WBBA 3A11A 4QBTA 2YMMA 3WSTA 4DDMA 2YHUA 3BK1A 1FSGA 1U9IC 3DEYX 4OYRA 1TU3A 1XRRA 3EA4A 4ZKEA 1Z56C 3U3KA 4XYGA 2LKCA 3UA3A 1YV9A 2X9VA 1U2DA 2JFZA 1Z0DA 2VDWA 1EYZA 1TOAA 1ZIPA 1VLHA 1ZNWA 4TYPA 4YMUA 4H6XA 4M98A 1BQEA 5EP2A 4K40A 4QRIA 3KXDA 3NIFB 4RH1A 5E7MA 3P32A 4XLTA 1DINA 3T9DA 2O8DA 1FVOA 1MRSA 3A9UA 1I7DA 2G1JA 2V0GA 5A7FA 4CI0B 3UQYS 3QFTA 4OD0A 2GVDC 4AQYB 4NYJQ 1J56A 3L1HA 4NFSA 5EHZA 3B7PA 2BMFA 1T26A 4K0RA 2ATIA 4CGYA 3ZWWA 4HNAA 4F6CA 1IRIA 4BFUA 2CDAA 5JQWA 2F64A 1IIBA 3P0JA 3OKCA 5BXYA 4IOMA 4ZT3A 1Z7YA 2ZB3A 3IRUA 1LDYA 1M8PA 4DQXA 1KFKB 3EF1A 5DM60 1PO7A 4ENWA 2JI7A 1T24A 4HMOA 4S1VA 2YHIB 4BN4A 5KHOC 4GZ5A 5F9FA 2F2TA 1J90A 1USVA 5KQSA 1GTRA 5CYGA 2GZSA 4OUDB 2GK7A 3L01A 3LOQA 3VJLA 4PLCA 1JFFA 2QM0A 4Y2JA 4KLRA 4NLLA 2OESA 1DIBA 2AK3A 3ABOB 1XXHE 2C4KA 3H65A 3WQBA 4ALLA 3EXG1 5JQGA 3M33A 4XD2A 2YYYA 1LU9A 3JASB 3IUJA 1S3FA 1VHJA 2QSJA 4UCQA 3R9IA 4BNVA 4EGCB 3LX5A 4F11A 2ZYSA 1P7WA 2WVJA 5HF9A 1U0GA 4M0DA 1P2SA 3THXB 1HT1E 4RLHA 5DM70 2HHHB 5ALOA 3MOSA 4TZ6A 1AHIA 1RRVA 1W52X 3BTVA 2O2YA 3NH9A 1I7LA 5EG5A 2EKQA 2XTJA 1W19A 2CEKA 1M8GA 4NAUA 5KVSA 1QG6A 1DT5A 1DT3A 3G2LA 3CBGA 5DN6D 1KEEB 2QR2A 2HDWA 1MZVA 3FSRA 4EW6A 2WWIA 5TQ2B 1ZAYA 4MV0A 3QSGA 2A4MA 4WOJA 5FFNA 1TAQA 2H2HA 2H7YA 3A4LA 4I4LA 3B1XA 4MGIR 4OQDA 5FL7A 3RQSA 2DGDA 1ZBDA 4K88A 4TYMA 1W47A 4LCEA 4O1MA 5DKFA 3ZWPA 1K06A 3ZDEA 3ZZ1A 3MQFA 5AW1A 1IZZA 2A67A 4YRMA 3ZBPA 1R12A 1ULSA 4FK8A 2QQEA 2VWGA 1C7IA 4U63A 3NKFA 1PDWA 5DRYA 1F8GA 4TN5A 1ZK3A 1S7GA 1T4DA 2OILA 6GPBA 3G17A 1MABA 1Z7BA 1X1SA 1Q92A 1NUSA 4B48A 3PQ4A 4AF7A 2Q28A 4G84A 5FV7A 6REQA 1KEPA 1M34E 4PCAA 3LWBA 1GM5A 3AM1A 4M0MA 2A1UB 5FNVB 1JKJA 2IY8A 4L1KA 1V2GA 2O7QA 4R3UC 2HSGA 4P1ZA 1HH4A 5KI6A 4KIFA 1X7ZA 3SU8A 3M4NA 2JLBA 2F48A 1OYVA 4YRLA 1ZD2P 1Y1SA 1VBFA 6Q21A 2Z9CA 3SAJA 1G4AE 2CHFA 4YV2A 1GA6A 1WMSA 4YCNA 1IMOA 3AQ4A 3NVAA 2O2CA 4FVTA 1NRIA 1V9CA 1VG8A 1I6MA 1YQWA 2BFFB 2QW0X 5DZSA 3RVSA 2VQ3A 3OE1A 2J9YB 4DA9A 2P9EA 3ANTA 5EQTA 1HOXA 1XVVA 1SVSA 3K8ZA 3EEYA 3OCVA 1AKWA 1DP4A 4ARSA 5EHXA 3T3NA 2ZRGA 2Z2IA 3E5RA 4C0KA 4EAQA 2JHFA 4HGNA 3JU3A 5EJ4A 4QXOA 3TCNA 5P21A 4HLQB 4F06A 1WU7A 4RK4A 4YRCA 2GHRA 5L4SA 3ACBA 4GECA 2QRUA 1KMHA 4OHXA 3W8NA 1X42A 2RIRA 3C8ZA 1AS3A 3WOHA 3ZE7A 4Y6LA 1EE1A 1KZGB 2WY2D 4KDCA 4DILA 3K1JA 4IKPA 4I9GA 4EEXA 2N1MA 2YUTA 5I9BA 2W6CX 5ALEA 2VK8A 1DLIA 1D2CA 5GMOA 3IT3A 3TE7A 3VNSA 1BW9A 5BPFA 3H19A 3WGYA 1X19A 3BXOA 3RS3A 4G24A 1KVUA 2D8AA 3OUUA 3EZGA 3L9XA 1AUXA 2DT8A 1Z15A 3DQPA 2FUCA 1COWD 2WFAA 2B8EA 4J90A 4TVBA 4G01B 4JU8A 4MWEA 1YVUA 2NU7B 3EHDA 1Y7PA 3QLUA 2BEWB 2Y0BA 1O94A 4RHEA 1T6XA 5HFNA 5T3YA 3EMBA 3LXUX 4ZZ3A 1O6ZA 2FPIA 2C97A 1ES9A 3AF2A 4D44A 4XWKA 5BR8B 3E4CA 1T9HA 4ZQEA 3MC1A 5CLIA 1L7NA 3L4EA 5L51A 2POCA 1Y3DE 1NQUA 1NQXA 3A36A 5FA8A 3WMWA 3DGEC 4RIGA 3HFRA 3P4UA 4V2IA 4A23A 4KQIA 2XGJA 1E0DA 4QASA 5C0OE 4BHTA 1N92A 5HUJA 3GCDA 4C20A 4ESOA 3GMSA 5CEEA 3PDWA 1PK9A 3IPCA 4JOSA 1Z63A 3PXBA 2JLVA 4PAQA 2NZ2A 2TMYA 1BS2A 2ZJAA 2NZXA 2CVPA 4HC4A 5JH7F 5K6AA 2ZUEA 3H4IA 5KYGA 1UDBA 4MRNA 1LA2A 2VSQA 3BMNA 5FT9A 2FUG6 3UYKA 3FD8A 4PCUA 3DAPA 2MSLA 3EW9A 1LZLA 1ENZA 2M6SA 2E4AA 2FW7A 1XCBA 2XRFA 4UPVA 2QPTA 5AVVA 3K9QO 3VH2A 2G5PA 1NSFA 4LZZA 1SBYA 5AHRA 5EY5B 4MLZA 5JZ9A 3H5TA 3V1LA 2QTGA 2XUOA 3AEUA 1SN7A 3PL5A 4UHCA 1C50A 3AIOA 2H63A 3O91A 3PDUA 4FOSA 1T8RA 4JP3A 4L5JA 1NXOA 2A5DA 5DWVA 3RS8A 4DVJA 3V9PA 4Z4QA 3OOWA 4AKSA 2EARA 1A1VA 1ZLYA 2JKVA 4KZKA 1LNZA 4FD3A 1H6CA 2VSNA 3M4YA 2XUPA 4N7JA 4G0QA 3UIEA 3U4QB 2ARKA 1T1SA 3C3EA 2NV2B 3L0CA 1MHPA 4QQRA 4P32A 3GEIA 3RYHB 1TQ2A 4EMBA 2X0IA 2H1CA 3W04A 3EUEA 5ICCA 3NAQA 4Y0VA 4TMTA 3OAAA 1SHKA 3C3KA 3MJCA 4N54A 1NG9A 2ZSHA 2BR3A 2PGNA 2KM1A 3GRKA 4JROA 1FP6A 3DTNA 5AJTA 2ECKA 5GIPE 3WLRA 5DASA 5D84A 1DTEA 3AONB 1OHHA 1XAIA 3OT1B 5EIBD 1Z0AA 2XSZA 3BOSA 1AF7A 1PN3A 1W35A 3QUBA 1OIWA 4PC6A 1J39A 4V0QA 1XA4A 3UJ9A 1RQ2A 4UJ5A 4J6EA 2PLNA 4IUYA 4G4SP 4DUGD 1WHTB 1NW9B 4JVNA 4ZYUA 4IIYA 2P9JA 3KQPA 4FKMA 4JBIA 3GK3A 4IDAA 4AB1A 1O03A 2QOEA 4J75A 5H3LA 3CUVA 1QYRA 4MI6A 5MN6A 3LQYA 4L3OA 2B7CA 4GBJA 4C4OA 1BWQA 1G64A 3H2IA 5T4EA 4RVHA 3WC4A 4QJ3A 3RKRA 1SQ5A 1F8YA 5KNBA 4HNQA 1YB1A 1Z22A 2A94A 4P35A 2ZSAA 1MW9X 4FDMA 1Z34A 4GSYA 1MOPA 5IK2D 3FPJA 4Q6WA 2GCOA 2EC5A 2IYXA 2LWIA 3RFVA 5DI3A 2H1SA 1GV1A 3EEBA 2QPAA 4H0FA 5CJ2A 1KMNA 2P8SA 3LLCA 4JUCA 2R47A 3TAXA 4HCJA 1G7TA 1Q21A 4HZUA 3P2OA 3E5MA 4KXXA 3U37A 5K0JA 3BWYA 1H2RS 1VCOA 2XBMA 1U7XA 1C5KA 1GWNA 2QV7A 2HGZA 4M7WA 1DKMA 3H2SA 3L0IB 4MROA 4DADA 1YR8A 1R0WA 4I36A 3VISA 3P9XA 4R1OA 4UKDA 5JC8A 1DIAA 1TW3A 1OYOA 3H42B 1KI3A 3GUHA 4Q3AA 5EJGA 3GRFA 2QT1A 3PFWO 2OY0A 4QXMA 1GXSB 3VTFA 1XO1A 3GJZA 4YAJA 3H3JA 3U09A 1OIXA 3TLBA 2H4WA 5JJCA 3ZI4A 5BYJA 4F9EA 1R0RE 3VR5A 4LXXA 3QQ5A 4J49A 2NUPA 3HY6A 1U5BA 5C8VA 3TXAA 3B2NA 3KKKA 2HK8A 4MCIA 4LHZA 3VU9B 3WQSB 1I5RA 2F1JA 4B3SB 1E9EA 2PS1A 4I50A 5CIQA 3TLYA 2YMPA 4ZEMA 1FW8A 3HFGA 1DO2A 2BZGA 2RBEA 1R7RA 3IQWA 4XIJA 4YJ3F 5HILA 3VGJA 5T57A 3ZDDA 3HJAA 4HRXA 4MZXA 2E7ZA 2O52A 3OZBA 1QLHA 2ZLBA 5HCUA 1UDWA 5A1TA 3F4KA 2R6ZA 1KI2A 2OAP1 3F5FA 1Q2XA 3LXMA 2WZCA 5LVAA 3QSYA 1JECA 1KY4A 1IOWA 4OSOA 5KOJB 1D7OA 2SCUA 3UUEA 4BZQA 4CFZA 3OO0A 3I45A 4MWBA 5EMHA 1RM3A 3A3NA 1DJLA 1JEQB 3RC9A 4L78A 3ROTA 3SPXA 4CTMA 2WZQA 1XZKA 1BXGB 5KYYB 2Q4BA 4L2IA 4YASA 1P6QA 4JB8A 4H6VA 2ZXUA 5J4HA 3TIFA 1UBEA 3H1AA 5BMOA 2QT9A 1GA4A 3KTAB 3LLVA 2OE2A 3MTAA 3DLIA 1CDZA 1GGHA 4ZOCA 1SHTX 4PRZA 2X0EA 3KLBA 4DLAA 1JFVA 3GLIE 2GHIA 2EF1A 2VF4X 1E79D 2REQA 4DYVA 4WK0B 1EFTA 4OXKA 2VLBA 3WB1A 3R44A 4YUZA 3V4SA 3AC0A 3LLMA 2H00A 1CPYA 3IBSA 1LFAA 3P8ZA 4Q0MA 1CUGA 3EF3A 3O1LA 3HADA 3IPYA 3UF0A 4TLLB 3DTVD 4DXAA 3RC3A 3TL6A 3I9V6 3SC3A 1PBNA 1ZINA 2FMFA 4XX0A 3JYPA 3HNOA 1G5FA 4W5WA 4AWAA 3RUAA 1ONBA 1HYBA 2OO5C 3IMCA 3OCYA 3UVEA 4EPYA 3DWGA 4IILA 5DM1A 2R4UA 2XNKA 1HLDA 1R6DA 3GH1A 1O6CA 3CEJA 4EPVA 3OTOB 3HXMA 3R3VA 4LWZA 4AY4A 1VTKA 2ZB4A 3K6KA 3LBNA 1LK0A 1N7GA 1WDLA 2WTBA 3DG9A 3QXSA 3QVLA 3OF3A 3EODA 3RYTC 2NM0A 4CKYA 2GBFA 4B6SA 2JLRA 3BBLA 5G53C 1HWYA 1Q2UA 3RVDA 1WNFA 4MQEA 4V1CB 2D13A 1X7WB 4GFDA 2JEOA 2XMQA 3CH5A 1DQSA 4LF4B 4O4IA 5K09A 4IFEA 3DOHA 2BI8A 5KWIA 5HKBA 1PRYA 2OBLA 2H1VA 2V7QD 3MW8A 5AJXA 2XRMA 5H5JA 4EECA 4Q1FA 5ALLA 2FUEA 1FFHA 4M0EA 4IS2A 3FTEA 3NHAA 5IDVA 2RI1A 3A9WA 2DERA 4QWMA 4U9UA 1TQ6A 4PHTA 3EMVA 5BQPA 3I01M 4TRMA 3TZHA 4IMJB 4DDTA 5JWOA 4LF7B 2XTNA 3CKMA 1TUEA 3K09A 4LX8A 5ALQA 2D6FA 1GZSA 1BTOA 1J8YF 1TUIA 1VE1A 2J5QA 4HNAB 1CSEE 3WDSA 3WNCA 1IPFA 4FDLA 3H87A 4L6IA 5JDCA 1XNRB 1B43A 5T8KA 2X0NA 2RHGB 4IIDA 4Z99A 3A9SA 1QJCA 4ENSA 2I7DA 4J0CA 1RAEA 5K8CA 2CFIA 2DSTA 4L75A 3QUQA 5DTQA 3ROZA 3ZTTA 4DR3B 5KMGB 3L8GA 5JO0A 2X8BA 2PQ2A 1CE8A 1IY0A 5CRIA 1E1KA 1OWOA 4BVBA 4CF4A 1E2QA 2HCJB 1DC4A 3OQHA 1RI3A 4GLJA 3WMEA 1WZEA 4IF6A 4X1YA 1HEIA 5I45A 1T91A 5IXSA 2IWHA 2FQ1A 3GEDA 1TT7A 5H83A 5JALA 1I3CA 4N3NA 3B1FA 1OU4A 3KQMA 2R751 4GOXA 1KI7A 3RBVA 5KNDA 5B53A 1RQPA 2YV1A 3EDMA 5B3LA 4YRDA 1VI2A 2Y1CA 2FRDC 3HB7A 1QGYA 1J0BA 3NYQA 1PCXA 3TTSA 5EXEA 2FE4A 3EC2A 1P1RA 4V3BA 2ZE5A 3BFPA 4BGIA 1VKHA 2LBPA 3EGVA 1R9GA 5E0KB 2V4ZA 4J6FA 1P91A 2NZJA 5F4BA 5IT0A 3H2HA 2VP4A 3OEYA 2XGOA 5B5SA 2VA8A 1FRZA 3NC1C 4QQNA 5DHTA 3QWHA 1H0KA 2OQIA 4JY7A 1A8HA 2K7ZA 2Y92A 2ZR8A 1PR5A 2PD6A 3U60B 3WL6A 2G1PA 1P1BA 3V1UA 4G56A 1RXSA 1GFWA 2Y4OA 4AS3A 5I51A 4UTZA 3N3BC 1WXWA 1Q57A 3IILA 5FKJA 4A0RA 3GJQA 1AXEA 1C8BA 1Z29A 4FEYA 1JIIA 1E7MA 4QXAA 4WEOA 2GKSA 4GBMA 2PRYA 5JMOA 1BE0A 1YIDA 2J0UA 4RGVA 1E61A 4C89A 1TEXA 3UCXA 5JXJA 1F14A 4P7KA 4C04A 1YBAA 2BGRA 2QIPA 4JEUA 3JX9A 2HOQA 5TY0A 4LVUA 2IWRA 5C1OA 1VDMA 5DH9A 2CVFA 4HQKA 4KWTA 1Q77A 1QE3A 1WLSA 2OHJA 3R77A 1XTQA 3AXTA 1JLSA 5HQTA 2DHRA 4CIDA 1HKUA 2X3YA 5EMKA 2ADFA 2O7SA 2P2ZA 2XQKA 3C87A 3ZBUA 5ICEA 1M54A 2XW6A 4HAZA 2JLUA 3QXHA 3ZNPA 4M9CA 5KU7A 5EINA 4IHJA 5F5NA 2FK7A 3KUUA 3PGLA 4K87A 1E20A 4L4YA 4ZAYA 4C6HA 1KDOA 4M3NA 2H6EA 5B4TA 4UBNA 2HWUA 2VEOA 2OO7A 1I2AA 4S05A 1ISPA 2ATVA 2NXWA 4HUTA 4V02A 5BSHA 1BXRB 1AN9A 4IIEA 2PUAA 1A9XA 2ZZMA 4BVFA 2NU7A 2P75A 2O1XA 4OSPA 3ZD6A 5BNZA 1CTQA 1CUUA 2GNAA 2GRJA 3MT0A 4Y2PA 1F8XA 1LPAB 1E89A 2XUZA 4R40A 4LDPA 3GRUA 1D4AA 4R84A 5HJ5A 3OX1A 5HIAA 4JV5B 1JBEA 1RI5A 2AN3A 5H02A 2QAGC 1NNSA 2IJGX 4RDCA 2XBLA 2FFRA 2M1XA 5LUBA 2JLQA 1X94A 3V4ZA 4BMXA 3ZY6A 1MV8A 1NWCA 2VJDA 2XY4A 3KZ1E 3VSCA 1CE8B 5FUQA 2OSBA 3MBOA 2QJWA 1HI9A 4QC2A 3I9MA 2BRUA 3KZVA 4I5FA 2A0XA 4HDSB 1ZVJA 4X1KB 4EG8A 1WUYA 3PSHA 3LZCA 2Z83A 1NUUA 4L6AA 2EGGA 1YS2X 2FHSA 1VCHA 3OICA 4GEKA 2P4SA 3WX0A 4BMSA 1TEVA 2NIPA 4DDWA 2IX3A 1EGMB 2QRKA 2X2FA 3DV0B 4M9RA 3SYNA 3L4JA 1ENPA 2EERA 2HWYA 2WSSD 4FDTA 4FFWA 4IHJB 2ZUWA 3BJEA 4P4NA 5DULA 3B5EA 4MVJE 2O6LA 2EKLA 1O95C 2CZGA 1K4YA 2P2GA 4HF7A 2QJOA 4OEHA 2Z56A 1DJQA 2H2WA 3QWAA 3PP8A 2PGLA 1C1YA 1YJCA 1O08A 2DLCX 5K0EA 2E4YA 1ZD9A 3IAFA 3L4BC 3GX1A 1PX2A 4OX9B 4OXQA 2R87A 2X4IA 2VJYA 5T5QA 3WIDA 5TDHA 1WXDA 4O4IB 4D9JA 1CUZA 4HAWA 4NBRA 1PP4A 2AN5A 1IBRA 4GVLA 1Z6YA 4B6PA 1H05A 1LLFA 3FN4A 5DP2A 3MT8A 3KEGA 4C7MA 4BX8A 3W5CA 2EKPA 3ON5A 3SJAA 4TSFD 1J25A 2YUIA 3VR4D 1UODA 1C8KA 1MB3A 2GASA 1M1YB 1GNTA 2Q6KA 2Z4TA 1W7AA 1QPBA 2C95A 3PQ2A 4BFTA 4HNVA 1G5PA 1BHSA 4G0ZA 4BO7A 3EWAA 1KDZA 1MHTA 1EDDA 3A4VA 3FNHA 1Z4KA 2VT6A 2F1RA 3C5HA 3CMCO 3Q7PA 3O1HB 5KNBD 2FSFA 3GZTB 2QRZA 5CA0B 4HADA 1FDIA 5JXIA 4UREA 2FPMA 1UM8A 5FWAA 3V8EA 4ROTA 1KWGA 1XZNA 3FOWA 1AKNA 3GHYA 3PXGA 3ENWA 4CV1A 1A69A 5I7SA 2R0QC 3SQLA 3FVQA 2O2EA 1BWPA 4U7PB 3CG4A 3HJNA 3LPLA 2QY9A 4MVJI 3R0QA 1V25A 3VR3A 1CUIA 1UK9A 4KMRA 4ZEVA 4U6QA 4DCMA 4QOSA 4AKIA 3DCJA 3DNFA 2WHQA 1MEOA 2D5CA 2B98A 2CJXA 4MMXB 5ALKA 5A0FA 3BEDA 5JI3E 3EUAA 1GOTA 4M36A 2QE7A 4X3PA 4B7UA 5HUHA 2GTHA 5CM2Z 1HSZA 3OFJA 3C3JA 4JLPA 5G02A 5K3DA 4YR7A 3BIOA 5AIBA 3WL5A 1YQTA 1C2TA 4TVOA 3S29A 2OB1A 2BTEA 2H1RA 2W6QA 3C70A 4WT7A 3LFUA 4Q4HA 1NONA 3QEAZ 5I4IA 1L4MA 2RAFA 2IP1A 2KS6A 2RHHA 2GZ3A 5DHUA 4EYGA 2FW0A 5FOQA 2A9FA 3EEOA 3AU8A 4J7CA 4QU0A 2WJIA 5A9TA 3LA6A 3UT5A 1NHWA 5FI1B 3AI3A 2OHHA 2ZYGA 3ZJYA 1GDTA 2GJAA 2VJAA 4HAVA 3MM4A 3KWMA 1FDVA 4BNNA 2XX3A 5ESRA 3VR6A 2O1SA 4X63A 5KYVA 2XGGA 4L5YA 4BXOB 3OIYA 1KEZA 5FADA 3X1XA 2BOVA 4OGLA 4HWSA 3LSTA 4X8OA 1EB8A 3DTVA 5C7OO 4XW2A 3VU9A 2GS9A 4I8IA 3L1VA 1JIJA 1V6CA 4C76A 2H2FA 4EJMA 2I8AA 2P40A 3QWFA 2W98A 1VHLA 2Z6VA 1Y3CE 3DBOB 3EQ7A 3PGXA 2ZYHA 4HNHA 4NPCA 4TL9A 1L7DA 2M6RA 4G4IA 1XZPA 3L07A 3NATA 1PJ8A 3A14A 3RTAA 5EPOA 3PNQA 4GE3A 5KAPA 1A9SA 1ZOSA 5BSRA 2RHRA 3UMSA 4B80A 4L4UA 5HSGA 3PBKA 2QVYX 4D80A 4J0EA 4MP3A 3FSGD 5KSYA 3UK7A 2DR2A 2FN8A 3K2BA 1T2AA 2QRPA 2EAUA 1JHMA 2VJNA 1ZOOA 2ZROA 4PC7A 5K2MA 3ZHXA 3ZV6A 2C4MA 1WZUA 3RHZA 1VL5A 4EF6A 3DLHA 1FP4A 2HMYB 2FP4A 2Q1TA 2FH5B 3MJRA 3WGOA 2Y71A 1NM5A 4QATA 2A86A 4A5OA 5GINE 2OHGA 5LJIA 2MYNA 5GWXA 3TZKA 4KQMA 4M0PA 5HKLA 2RE8A 4RZXA 1O7JA 1SURA 2XAUA 1M2FA 1P29A 3DH0A 4X97A 3E7WA 4Q9JA 1ZK4A 3L0ZA 3BJIC 4HYTA 1ISHA 1FU8A 1U7WA 3H1BA 2VXBA 4EY6A 2EKDA 3UICA 4PNPA 1U3CA 4GSKA 1FQKA 1L0BA 4JN6B 4BFCA 5IKXA 4LW8A 5L3SB 4MH0R 3P9SA 3JARA 4GMGA 4U7DA 4Y1RA 2V55B 1J23A 2VHCA 5DLQC 4A0QA 4CKBA 5A9SA 5A9RA 2PD3A 3CLTC 1PFYA 5CTAA 5GM1A 4BNJA 1G2QA 1SM4A 2PO5A 3MK31 5BN4B 2AK2A 1FTQA 4JX8A 1Q44A 3TE6A 2CLSA 3O74A 3OURA 8ABPA 3JD3A 4F5DA 3U39A 3T5DA 4AJHA 1RLIA 4R2HA 4Z1OA 2R84A 3ZHCA 3D6FA 4KXUA 3ROXA 1JW9B 5JY1A 3ZWNA 3LM8A 2FPOA 4BOYA 4QJ5A 2BSQA 2JAQA 2BW0A 5BRJA 2HO5A 4QOFA 3C4QA 1KJIA 3W1WA 3JALA 4R5HA 2Q0SA 4DV5B 3DLTA 1PYGA 1DFHA 3GC6A 2P77A 3UKDA 4EHHA 1ACMA 2XCSB 2JJ1D 4TN1A 2W6NA 1MH9A 1NMXA 1QYWA 1U7TA 4WLOA 4M22A 4FI3F 4CTJA 2YWXA 2H7CA 2J3DA 1HZZA 1YB5A 4PS0A 1VRWA 2QP4A 4UBIA 3T54A 3K6SB 4XYLA 2IDZA 1C7ZA 3P20A 4B44A 3BA1A 1XPJA 4LCJA 4CG0A 2ECOA 4Q3DA 1TU4A 4CM9D 2PR7A 2V5AA 1J7JA 4RDHA 3CR8A 3IDAA 1L5OA 2X7JA 1JDPA 3TIGA 3F6CA 4MHTA 1KMMA 1BJRE 4JIGA 3LIPA 1NBME 4KN8A 5AXBA 2JA2A 3VPCA 1ZOPA 2A1TR 4R16A 1YT5A 5KJ6A 2BTOA 1TDJA 5H70A 1Q0SA 1UPUA 1UZLA 3CT4A 2VWHA 3E9NA 4C14A 1KO7A 3RC8A 1MD9A 1KAHA 2QHXA 1X9IA 1QIJA 4HRVA 5KS2A 1Y5RA 3E8MA 3Q3GE 4DAEA 3RF6A 1U3DA 2PX0A 5TEWA 4CIYA 1G38A 2B0JA 3ZDRA 1UKAA 1PTJA 4LQDA 4Y2XA 3TTYA 2YZMA 1ND6A 3WMGA 2Z3WA 1BX3A 3OPYI 2W2KA 3BSYA 3TW8B 3AESB 4KE7A 4FGJA 5IG2A 3DE6X 1T8WA 1DMRA 5DF1A 5E3IA 3OQMA 2HEGA 2R8ZA 5D00A 1E4OA 1T2FA 1J2EA 1RI4A 1QVRA 2GN1A 2RG7A 1YD7A 2W4MA 2HT6A 4P2GA 1U0RA 1CZLA 1JA9A 4WLNA 5HEKA 1C9KA 4B7AA 1ZITA 3KAPA 4CMEC 4BNKA 3KV1A 2PTHA 3I5AA 4QYSA 5JW6A 3IKMB 2W71A 3C6BA 1IXZA 4J9VA 1WKCA 4FE7A 4PS1A 4URWR 4EPWA 4S2UA 1R5BA 5BVGB 5IDQA 4D25A 1M66A 1VYHA 2H8GA 3NP7A 4LZWA 4JQOA 5EOVA 3MS7A 2R1TA 1WMFA 3ANXA 2UVDA 2CNBA 4GX0A 3SM9A 4AO8A 4D8WA 2HM7A 5IAOA 1GKYA 1PYOA 2ZR7A 3AUYA 4OHKA 4WY5A 3SBOA 1AMOA 4H7EA 5A02A 1S8NA 3IJ5A 3ED1A 2LVBA 3PFFA 4J3FA 4JH0A 4JI1B 4LVOA 4I4IA 5E7QA 2I4NA 3V1MA 4Q37A 2BEUB 2R2GA 1EK0A 2VJOA 1V1JA 1E79A 1DHRA 1LV7A 1C8LA 1DXOA 1SU7A 4NIMA 4REQB 4WCFC 1R6AA 2GJKA 3EIUA 2DBRA 2LD4A 1PS9A 5AI8A 4H17A 1CETA 1FNCA 5ERGB 2B25A 5FTMA 2AZXA 2DPXA 3UBTA 4RJ2A 1E3QA 3LDUA 3Q8MA 4N5HX 3TJMA 4TSKA 3SQWA 4RC9A 1IU9A 2MYTA 1BROA 2F3UA 3BBPA 3NHJA 2QRNA 1DTWB 5I7UA 1C30A 2PWYA 1AK1A 3ZE1B 4CIAA 5HZGA 2JBHA 1KRWA 2I1LA 2HQ1A 1EDOA 2Y77A 3T5PA 1NI5A 1RM5A 5HS4A 1U8CB 2ZWOA 2NV6A 2HKIA 3ABSB 3WAGA 4LYGA 3GJ8A 4G1UC 3O4GA 4X20B 2ET6A 3GV0A 1TTPB 3TQHA 1K5GA 2CHVA 5F21A 4RNCA 2APJA 3FTPA 2EZ8A 2QUAA 3MA0A 3ZWAA 2GPTA 1G6Q1 4IWNA 4LY0A 4UPDA 2IDJA 1S9HA 4UZFA 1O94D 5BNTA 1K6XA 1MO6A 5K8LA 1FP4B 1LTHR 1Y7LA 2M6LA 4BGEA 5KYXA 2GCPA 1E3WB 4X92A 1Z2CA 2H18A 5LZ8A 4BLPA 4C7BA 5HFJA 1S2MA 3TSWA 3TZ6A 1A9ZA 1G21A 5GADl 1RWXA 3ZE0B 3F4BA 3KXPA 1RYDA 4BX2A 2R96A 1VZ2A 3UHFA 2GM4A 4D0LB 1NMZA 2J7PD 3W3AA 4Y9TA 1NULA 3RARA 1TF7A 3EXHC 1JT2A 4KGVA 3UHPA 4ZICA 2BLNA 2WOJA 5JG7A 2EL9A 2JIZD 3ZGXA 4CN8A 1AX9A 4P4GA 4B6GA 1OVGA 2XVMA 1RWNA 3BAZA 1CZUA 2FPWA 4E4RA 4R71A 5A03A 3L6UA 4EY7A 3UK1A 2VHXA 2OQRA 5KNDD 1FJ2A 3AY7A 1U3GA 4KBYA 4E7PA 1RT9A 3B1VA 5AW4A 4HLUA 4Q4JB 2B2CA 1RLJA 3BC1A 1A5AB 1U81A 3CV3A 5J4VA 1YRLA 1VPTA 2PXHA 2YX1A 1Z6GA 2DQKA 2XCLA 1R3UA 4WCDA 2C2YA 1NUQA 4DUPA 4UM7A 1WAMA 1E5DA 2Q8PA 1KZ6A 5HXAA 1CG6A 1P5FA 1XNGA 2I6TA 2N1BA 3FJOA 1B0UA 1I30A 3KHKA 3P2EA 2FSVA 2Z5FA 1U1CA 3R6GA 2BBOA 4FFOA 3LOUA 2NU9B 2Y2UA 3PUHA 4RIHA 3MRXA 2WAMA 5ALPA 3MILA 3QELB 4N7MA 1LC0A 2ZPTX 3HCNA 2XIJA 3ZHBA 2NTEA 3L4BA 5DYYA 1PFQA 1EWVA 1E5QA 1EVKA 1MB0A 3EVZA 4HEJA 3BD7A 2QW1A 1OPXA 3UAGA 2X15A 4FJ0A 2CD9A 4HNTA 2R7LA 4LXUA 3WS7A 4TL7A 4YONB 1XMVA 2QTTA 5JZBA 2W93A 4TT3D 5EIAA 1RCFA 1XYVA 2J0VA 3LBYA 4RVCA 1R0LA 1FMJA 2CE2X 3OM0A 4WZAB 1PK7A 2O07A 3C3WA 2ZJFA 4YT5A 1A76A 3NV7A 1FEZA 3L93A 1NI3A 4OQEA 3ZWYA 4BNFA 2O8BA 1C0PA 1Y80A 5IFKA 1FMFA 2P5YA 2I33A 2RGEA 2Z6AA 4M76B 4KNYA 4GYJA 2GN9A 4B09A 5BV7A 2RHWA 2W8BB 4Q1CA 3PHCA 5J3JA 3EMDA 4JJZA 3NWBA 1YZUA 4QFDA 4QKQA 1BMTA 3HVKA 3M5CA 4B3FX 4MIKA 3NJRA 3R0JA 4RDXA 3D6NB 3BG5A 3H5WA 4DZZA 1IXSB 1U6JA 1L5HA 4AJIA 2D0PB 3FMGA 3KPVA 2L69A 4DC0A 1NTRA 4R05A 1FDSA 2Y9PB 3AOGA