2FMOA

Ala177val mutant of e. coli methylenetetrahydrofolate reductase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
273
structure length
261
Chain Sequence
QINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYGADRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGDLEMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGVNRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Perturbations in the Ala -> Val Polymorphism of Methylenetetrahydrofolate Reductase: How Binding of Folates May Protect against Inactivation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 5,10-methylenetetrahydrofolate reductase
total genus 85
structure length 261
sequence length 273
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 2fmoA00
1TJ2A 2FZMA 1ZPTA 3E2SA 3FSUA 1TIWA 3APTA 3APYA 1TJ1A 3FSTA 3E2RA 1B5TA 4JNYA 2FMOA 1ZP3A 1TJ0A 3E2QA 3IJDA 2FZNA 1ZRQA 4O8AA 4JNZA 2FMNA 3ITGA 1ZP4A 1V93A
chains in the Genus database with same CATH superfamily
3EOSA 5F4WA 1TWSA 3QGKC 4XWUA 3SAZA 3BMWA 4M0XA 4YYCA 1QI2A 1YTKA 4JQAA 4NZCA 3H22A 2XM2A 5C70A 8RUCA 1MRQA 4U4MA 3TTEA 2E3ZA 3AS0A 4CNUA 4WY0B 1OC5A 7TIMA 1XLBA 1MXGA 4XUGA 3GXTA 1W5PA 2Z2UA 1DOSA 3M41A 5HR7A 2Z1WA 2ZVRA 1EH9A 2CESA 3MWAA 1XC4A 4XKYB 3TYDA 3F7JA 1XX1A 3GY1A 3P2VA 3P3BA 1B1YA 2J9YA 1G5AA 3W81A 1CBGA 3NA8A 3MMWA 1ELSA 4AMAA 4GRSA 3RM8A 1DJYA 2Z27A 3LLFA 4RE0A 4H00A 3IIZA 1MW3A 9CGTA 3P8IA 5BXRA 2GOUA 4IJBA 3SRFA 4B5UA 4R7JA 3QPEA 1H1NA 3IVTA 2A7PA 3O06A 4O1FA 2ICSA 4GYKA 1UH4A 3ABSA 2F7FA 3WEZA 3C3UA 2PTZA 2QPXA 3NPUA 1YTDA 4PMJA 4B5SA 3W25A 1BWLA 2FHFA 1F6PA 3JVAA 3HURA 3WNOA 1E6XM 4V27A 1O1ZA 2PDLA 3CYJA 3WQGA 5FL0A 3LUTA 2ZUUA 2QVNA 3CUJA 1BXCA 2ZZ6A 4W4QA 5K9DA 2WNQA 1Q7QA 4WDXA 5K4XA 1D3GA 3R11A 1I1XA 2P0IA 4MNJA 3GC2A 4J3WA 1RZMA 1HKIA 1CXFA 1VJIA 3WX7A 4GBDA 4UMAA 4W7VA 3LMYA 3AFBA 4KERA 4F0HA 4L7ZA 4H19A 3U3HA 2YW3A 1AODA 4JEJA 1GK8A 4I5XA 1K4HA 1ZJBA 4XK2A 1QWGA 4IF2A 4JFTA 5G2HA 1TUFA 3AYVA 3MO4A 1NQKA 3HZ3A 3N73A 2ZUSA 1TYGA 3AI0A 5HPCA 3KVKA 1P48A 5DXYA 5T91A 1UC5A 3SGZA 2ASHA 4PE8A 4DWSC 2DW7A 1PEZA 4JKMA 5CZTA 1XKYA 3R58A 3THCA 1Z41A 5LIYX 4S3JA 3VIIA 3STGA 3U2EA 1JPIA 3RLHA 1SW7A 3TA6A 4GFSA 5KZMA 2PDBA 1I0BA 3R0UA 4GUFA 2FTPA 3BGGA 1FA2A 3MZNA 4Z2IA 3KL5A 4NI3A 3QR1A 4G6CA 2HBVA 1QNVA 2W79A 5I79A 3MSGA 5A6TC 2C13A 3RLUA 2PUZA 1RCQA 2X42A 5ABHA 4ALDA 3UG5A 3EXTA 1UD3A 4DAIA 1OFEA 3O15A 3VGGA 2J8FA 5CSSA 3PM6A 5I2UA 3VX1A 1GVFA 3QHOA 1G94A 1NP0A 3SIMA 2V82A 2DFAA 4HZ6A 1F9CA 1OK6A 3OZMA 5JVLA 5G2IA 2GL5A 1T6MA 2BDQA 1A3XA 1ZUAX 5CG0A 3LG3A 4Q4MA 1P43A 1HO1A 4Q32A 4FA3A 2RGLA 4JFWA 1VFSA 3RPMA 1LJYA 2OWWA 4OU1A 3TTYA 2OGJA 4JYDA 5DX7A 4US6A 3GHUA 3HBLA 2GQ3A 1DXIA 3PVFA 2YFNA 3UERA 1GQIA 2O9RA 3LGGA 1GVSA 3L4XA 1G0CA 4IGHA 3SDOA 4LJ3A 1E43A 2Q71A 4S3DA 4HYWA 3AHXA 3GVVA 2ZUMA 4HJFA 4RE2A 2I7GA 1VYPX 4RNIA 3LS9A 1V3JA 3CUXA 4XVEA 4H9XA 1GORA 3H53A 4GGBA 1M65A 5JBEA 4DLFA 2RDXA 3KBMA 4JHMA 3VNLA 2YCEA 1XQLA 3O6YX 1XRSA 2PCEA 4DEFA 4QE4A 1EFZA 3BMXA 1ZQ5A 2HWGA 5K4ZA 3KS5A 1PYMA 1PZ2A 1PZ3A 4S2BA 3AIEA 4BFAA 1W1IE 4LC6A 4KRZA 2WBGA 1HJUA 5E09A 1E70M 4MB1A 2G0WA 5CJMA 1QAPA 4W86A 5I78A 1WA3A 4YIWA 4C6FA 1J0KA 4DUVA 3CK5A 5DY3A 3WLNA 4H8UA 4DVOA 2I16A 3W87A 3PR2A 4L65A 1WZKA 2WMJA 4XZMX 3GG0A 4O19A 3WF0A 2XVNA 3W7DA 4KWUA 3QFWA 3AMKA 1FFRA 3C2VA 4Z2HA 4ZODA 1AK5A 4LQ1A 1QNPA 1EC8A 3LYEA 1BYCA 1ICPA 2HV5A 4DI8A 2IKHA 4WY0A 1XH2A 3EX3A 4Y90A 4R53A 1B3YA 2OODA 3KL0A 4L6DA 1JDFA 5I24A 4RKAA 3GW0A 3M0KA 1Q8AA 4LBUA 2Z6JA 1Q4NX 1EO7A 1LRTA 2OZ8A 1BF6A 1PX8A 1E0VA 2EHHA 2QCEA 3PZNA 1TPDA 1K6AA 2DZBA 4E2OA 3TQPA 4MWAA 4X9YA 1EBHA 1K77A 3BSHA 5D9NA 2Z7GA 1ZGDA 1U5JA 6TAAA 3GTIA 3M0VA 2R91A 1QW7A 3OO2A 3S83A 1S5TA 1XLIA 3W76A 4IMFA 2BHYA 3GVQA 4B3LA 2WO5A 2Z28A 4ZMGA 3FIGA 4HMDA 3V0SA 2HEJA 1GJUA 3B8DA 4ACYA 2J77A 3MWCA 3GHSA 2WC3A 1RCXB 4WKAA 2IKGA 2R1LA 4YTQA 3W2MA 5TQLA 2Q3RA 4FXSA 4UTIA 3T2PA 2INZA 3L23A 1U5VA 5AKQA 1HVXA 1IEQA 2TODA 4IFOA 1GJPA 3LGEA 2VUYA 3SCSA 1BSLA 3HPSA 2G95A 4W87A 2OWXA 3GU9A 1O4UA 4J3TA 1LLZA 3UWUA 1UH2A 4CD4A 4D6GA 3S1UA 1BSIA 5T9BG 4IZGA 3TW9A 3BARA 2Z4GA 1CXKA 3JU2A 4LAKA 1OINA 3EWWA 4B9YA 5E0KA 4LF2A 3CMGA 5F2GA 2NQ9A 4LPCA 2ISWA 3NFUA 4B5TA 1VEOA 4GX8A 4FO4A 5C2XA 1KKOA 2QCDA 4BWLC 3S1GA 4IQDA 3G1VA 3KOXA 1BPLB 2X2YA 3HPXA 5AECA 1U33A 1UMYA 3KTXA 2OQLA 1E0WA 5LA0A 1BYBA 1K9DA 3ITVA 1UMLA 1TX2A 2AGKA 2W0UA 1XYMA 3UWWA 3IRSA 1Q66A 4XISA 3W86A 4O0ZA 4Z1AA 1LLOA 1AW1A 3ARPA 3GO2A 3QR0A 3O8AA 4NJKA 4PRRA 1W3KA 4DBUA 1TPEA 4WX2A 1YQ2A 1HN1A 2CHNA 3CZ8A 3FX4A 3IJDA 1TRIA 4MZ1A 2OVLA 2DUXA 4AHPA 5E6YA 1RBOB 3OHMB 4CQCA 3TU9A 1V0KA 1TIWA 3AMGA 4IFKA 1AUSL 2VVSA 3G1AA 3CWHA 1UWIA 4MPQA 1ZJIA 3HM7A 2A3LA 5BOEA 4GA8A 3SQSA 2QHAA 4KFOA 3VD9A 1OC6A 4A8LA 1E56A 1EX1A 4KCVA 3ZYZA 4C1KA 3DKJA 4IPLA 3LDVA 4IMCA 3DG7A 3M0IA 2Q8ZA 3ARRA 1ZBWA 2DT3A 3DHPA 1YXCA 1YXDA 4EKJA 1MEIA 4UMBA 4Y8EA 1KCXA 5AZ1A 5I23A 1OFOA 2YXXA 4XSLA 1QPRA 3RCMA 2JK2A 3TVAA 4AD1A 2VR4A 3REQA 4IL0A 2CBIA 3K8KA 4IQEA 4IIGA 1JCLA 1ZBKA 2QYGA 4YN5A 3LY0A 1MUWA 1PTAA 2VRKA 3CBWA 1C29A 1TFVA 5J04A 1MI3A 4OVXA 1QT1A 3L0GA 3O07A 4PUEA 4E2BA 1L2UA 4JEQA 3WUEA 3B0VC 4LALA 2X0SA 3BJTA 1F3XA 2NLIA 3V18A 3DESA 2PWHA 4R9XA 4PL1A 5KZEA 3BICA 2PF8A 1RP8A 3AZSA 3ZJ7A 5DQPA 4PMOA 4XAZA 4ZGYA 3H4GA 3GD6A 4H41A 1I9CB 4MB4A 5F4SA 3U48A 4U2ZA 4M56A 2CHOA 3MPGA 3WDPP 4CN6A 4YCPA 3NQAA 4R7WA 4AVNA 4GY0A 1RQHA 3P7YA 4NXSA 2D2HA 3UYCA 2PTYA 5C8BB 3ZR6A 3N9KA 5LHFA 4NU7A 3HB9A 2FZDA 3KBVA 1AZ2A 1SMAA 3BLPX 1LRNA 5FKYA 3LPFA 2WB5A 3KBJA 4IIFA 4FSAA 1DKWA 4E5TA 2HXTA 1YPIA 3FFSA 2PU0A 1H11A 1NWSA 3CUZA 3H7VA 3EB3A 1E6ZA 3OODA 3C2OA 3U7BA 2G3JA 1I8JA 2OZ3A 2J8GA 5CSUA 4XX6A 3ARSA 3H2NA 3VIKA 2H6RA 3PJXA 4RZ4A 3FJ6A 2WKLA 4D1JA 4HHMA 4L9YA 2BX7A 3NQ6A 3STPA 5I00A 4XAYA 4NNAA 4UCFA 3CJPA 3OVQA 4MJ4A 3C56A 3UGVA 3E0IA 3SI9A 4A8NA 3GUGA 3VOJA 5EMYA 1SM9A 2BGQA 3TSMA 4WKHA 2JIEA 2GGIA 1ZS2A 2QJJA 1WO2A 1W32A 3LCHA 1DXEA 1EDTA 1GKRA 1KBKA 1B5TA 3H8AA 4ROPA 4TMCA 2V30A 1W5NA 3R4IA 2DIKA 2PWGA 1IXNA 1NQ6A 1GYMA 4DB7A 3F4CA 1WDQA 1WXJA 3MB9A 4WHBA 2CZEA 1ISXA 1PJ9A 5JIWA 3OEXA 3QC0A 4P5UA 4HBKA 3VK5A 1JRBA 2RJHA 4W88A 2DZXA 4FX6M 3LK6A 2POTA 5IFPA 1E6SM 3VDAA 5C9RA 2WLZA 4F0RA 4ASTA 1CX9A 5I07A 3OJGA 5CH9A 2E9MA 3VGDA 3AIBA 1KFJA 4PUKA 5HJXA 1GUVA 4RX0A 1N82A 1IIGA 2RKXA 3VUSA 1EJUC 3FDKA 1PDYA 1BAGA 4H9ZA 4WJEA 3PBWA 2D2OA 3U5YA 3JZEA 3BTNA 4ZOBA 4QSHA 1C9WA 1XV8A 1B30A 4D6EA 5C9WA 2NXHA 3LGDA 1DWIM 3PP7A 3II1A 3WLLA 1Q4WA 2XN2A 3GYEA 4HTBA 1HT6A 1JZ8A 3I3DA 1GHRA 3BGJA 2O55A 7TAAA 2YB1A 1W8GA 3WQFA 5DCDA 4PUWA 2UY2A 1CW2A 1QBAA 4MKVA 4Z1CA 1ODUA 3S2MA 3NUKA 5CGQA 1W1TA 4I8DA 5DANA 5E6ZA 4NZ3A 3WDRA 3EZ4A 3RN6A 4HNUA 3T8QA 3WO8A 3VMOA 5DMYA 2AKMA 3NL2A 5LHEA 4Y96A 5E0FA 3FHAA 1GJWA 1OYAA 4ATLA 1J8VA 4KQNA 1TR1A 3TSBA 4JYEA 4M51A 4K6AA 4LVBA 5IRPA 2YW4A 1M7XA 4WGXA 1BWVA 3BZGA 1M7OA 2J13A 1GW9A 1V3LA 2HPIA 4PUDA 2WMIB 5CCZA 1HNYA 1XG4A 3IJ9A 3NZPA 4GZEA 4A2RA 4H7VA 5D9MA 4J40A 1VFFA 3UJ2A 5HATA 1JI1A 4X2PA 2YA2A 4L6HA 1H7NA 1L8PA 4IMAA 2PDPA 2NWRA 2PRLA 4G56A 3WKZA 3SM0A 2VEFA 4LF1A 1FHVA 2NVDA 4IISA 2POZA 4N4PA 1JUEA 4BKNA 2ACRA 1P0EA 2DSWA 4MYXA 1GOKA 1ZZMA 3KDNA 4GK8A 2J47A 5FF7A 4UOZA 2X1UA 4E38A 2ACQA 1XYCA 2OEJA 1VZWA 3GRIA 3GVRA 3WLMA 3TOPA 4H9UA 3B8TA 3WUFA 3PUEA 2HS6A 4M24A 3UG4A 5I77A 2OU4A 2DUZA 4GJ1A 2VEKA 4QLJA 5EFFA 2V2HA 3FKKA 3K4AA 5ABTA 3CZKA 4PUMA 1K9FA 3KS6A 3H2MA 2YBTA 1AJZA 1H1YA 3MP3A 3DFTA 3AYTA 3CUHA 2VELA 1TIMA 4H6QA 4MNKA 5F2LA 1TB3A 1Z7AA 5FF4A 1D3CA 2VEIA 3B8UA 2BZNA 3PTQA 1VLWA 4REQB 4JFUA 2XIOA 3HPZA 2C0AA 1XDMA 1I2PA 3NGJA 4ICNA 2PWVA 3PJTA 2O92A 3B8SA 1P0KA 3U2ZA 3WLJA 2YCJA 2PE4A 3L2MA 5A8QA 1HG3A 1IEXA 3N2XA 4GO9A 2QDGA 3TR2A 3CIWA 2FZ8A 2DZWA 1BFNA 5AB3A 5H91A 1NSJA 4IP4A 3BG3A 4GZIA 1HKVA 1T41A 2EPOA 3CQIA 1OVDA 3BCJA 2GJXA 2FGZA 3O1NA 3H24A 3TYEA 4W8BA 5JIPA 4GYFA 1FXPA 5AHEA 3TDFA 4HOXA 3WK0A 2WHMA 2C71A 1Q7MA 1VB9A 3DI0A 5BRQA 4XAFA 3S1WA 2QF7A 2ZICA 1IZJA 3VIPA 2WV8A 1QR7A 1XLJA 1XIIA 4J3SA 5D05A 3M43A 2G41A 3MUXA 1A5NC 3CV2A 3M47A 3OQEA 3R7MA 4QG6A 1XDLA 3XINA 2WPBA 3QSTA 1Q2SA 4GYPA 4PUUA 4L9XA 3CHCA 4ZA0A 4UOQA 2BB0A 3A22A 3ZJ8A 4QR6A 4RDYA 1K03A 3VO0A 3GG8A 4MJZA 4HD5A 3LD5A 1X8FA 3GBEA 2GZXA 1DHPA 2YA1A 2RDUA 4K1WA 5C71A 4BZYA 3A12A 3WH6A 4CQBA 4OHQA 3GUWA 3GLCA 3VFCA 3S9YA 2R9RA 4PMYA 4QCEA 3DYPA 2YL9A 1JFXA 4O0QA 5CSYA 3BSMA 3BLIA 1EZWA 3AU2A 2E0PA 3PB2A 1QDSA 3BW4A 4HHPA 3WLIA 1KFBA 3WL1A 1XBXA 3P61A 2VI0A 2NQLA 3BW3A 5C9XA 3IIVA 3WMBA 2NSOA 2AMGA 3E1F1 3LU2A 4DYJA 4S3FA 3RO6A 1OK4A 2Z29A 4BCEA 1S39A 2CYGA 3MU7A 2FPVA 3WQDA 3NJ3A 1C7TA 2PGWA 1KRAC 4JQ1A 1XDJA 3URAA 2ALDA 2O56A 1GOXA 3B8VA 3KTCA 3HTWA 2F84A 2QLYA 3KWSA 4I7VA 1Q2RA 3E2SA 1O5QA 1YBQA 4BF7A 3DC0A 4JIIX 4AISA 4O1DA 4LYQA 3A9BA 3E0FA 3S5SA 1TV4A 3AIWA 2EXOA 3WQOA 5HWJA 2W92A 1FHUA 2Y7EA 3QEZA 4UWMA 3WY1A 3SCWA 5T9CE 3LRMA 1M5WA 3N9RA 1I75A 4J3XA 1TPUA 1X97A 2PCQA 1WDWA 3WD3A 2ZZ2A 3B05A 2DDXA 4UTJA 4HNOA 3LPPA 3CAQA 2YJQA 2NT0A 4M3PA 3GR8A 2QF8A 4EF9A 3LCGA 3VGEA 3TA9A 4DWSA 2Y88A 1Q6GA 1HJSA 3CPRA 2Z25A 4G7EA 3EYPA 4DXXA 2WZMA 4LRTA 4XV0A 5M17A 3OGVA 3PNUA 1XSIA 3UR2A 1JCYA 1KW1A 3UXLA 3ZWSA 3P93A 1UP2A 2OQHA 1R9YA 4HMCA 5U7SA 2VCCA 3ZT6A 4AFYA 4QP0A 4GKTA 1DTNA 1N8IA 1VBHA 2FZ9A 4Y9OA 2FB3A 1PO9A 4QDWA 5EGRA 4AVOA 1HO4A 2X09A 1RAKA 1B0IA 2G8ZA 4O12A 3ZSSA 3C2EA 1VFLA 5J5RA 3PFMA 1HL9A 2WAGA 1BF2A 4YVXA 5FJUA 1XBVA 1T40A 1AH0A 4NVTA 1BXNA 3BXWA 3D6NA 4PMZA 2CLIA 4DBEA 1NWTA 4ZO6A 4HHLA 5FSDC 3ZMRA 3ZLHA 1NY1A 1O94A 4AAJA 1EPVA 1H4PA 1PSCA 5BXPA 3L4UA 2C19A 1A3WA 4PCNA 4PUNA 1EP2A 1FWTA 2ZBTA 1MQQA 1FCQA 1XRVA 4TR9A 3VNDA 1H7OA 1B54A 3G1YA 3O0FA 4GNJA 3E49A 4MY9A 1YTEA 1JF6A 4C60A 4O1AA 1JZ6A 4E2VA 3WL0A 4WGHA 1UWRA 2CLEA 3B8WA 2TYSA 3VDCA 4IGNA 5GNZA 3NDYA 4HCDA 3O9NA 4NJHA 4C6MA 1MW0A 4FNPA 3MSRA 1LZOA 2V81A 4DWDA 4JTQA 4Q8MA 2PRMA 4DJFC 5F7UA 5B80A 2YDQA 4JIQA 3OG2A 4O4WA 5L9FA 4UFLA 4N0RA 4L1XA 5F4XA 3I4EA 3FVDA 3VGFA 1MYRA 3A3XA 1QNQA 3QV6A 3LI1A 5C9UA 1UPMB 2E1WA 4AW7A 5HBFA 4IQLA 1DORA 4YTRA 4GNKB 1A0DA 4YS1A 1D7FA 3P5YA 4RNFA 3HPFA 1TWDA 4MM1A 3NDZA 4LWWA 1Q65A 4ZSUA 2OSYA 4DJFD 3IK2A 4D1IA 3QGAC 4DJEC 2E5CA 7REQA 3CB8A 1RSCA 2WXDM 4GXWA 4V15A 3WELA 1WUEA 1R47A 2CETA 3URNA 3NSNA 3H7RA 3ZVHA 3K2GA 3I4KA 3N1AA 3LEPA 4K1GA 3N18A 1WV2A 1RJPA 2FYMA 3B9EA 2ATSA 5U4NA 2VOTA 3NZRA 1MUMA 3WBYA 2J9XA 2WSQA 3PK7A 3W4RA 1ECQA 3N25A 5JH1A 2V38A 3RITA 3U7VA 4ZTXA 2GSJA 3F2DA 3DG3A 4P7RA 2P53A 3SY8A 2QCGA 1FOBA 3NOEA 2WC4A 4JTSA 2REQA 4EF8A 3IANA 2OMAA 1HKJA 1AH4A 4C6LA 1POJA 4OV9A 1HP5A 3DKLA 1W31A 4QS5A 3MKVA 2PF0A 2X1RA 3QC3A 5MKGB 2FFCA 3AISA 4GY7A 4JKKA 5DMLA 4MSSA 1U1UA 3O05A 1JR1A 2WW5A 1RQEA 1Y5XA 3NQ7A 4PH6A 3N2MA 2X0YA 4NRSA 4OGZA 1LQAA 4AH7A 4D6JA 5DLCA 3HQOA 4BF5A 2X7WA 1K1DA 3AICA 5LGZA 1GNXA 3L2IA 1Q6EA 3TXVA 5C6MA 2IS7A 2Z7KA 3LB0A 1XPYA 3KL3A 4GMEA 2J24A 3S2NA 3BO9A 3RGTA 3WEOA 4LGXA 1DIDA 3W7PA 1H62A 3UWQA 4EWND 4HGXA 3AXHA 3Q4DA 4WSJA 1GOQA 2OWCA 1LP6A 3PZVA 4D8AA 1XISA 4EPKA 2DZVA 4DZHA 3W9ZA 1JXKA 2AQWA 4B5XA 3ITYA 5AHIA 4UCGA 4AWTA 4IUOA 3P74A 3F4WA 4B4HA 2W3ZA 2OLAA 3BK0A 3TZFA 4GZJA 1ZL1A 3NAVA 4HNTA 4MPKA 4QLKA 3F4DA 2FZMA 2BBFA 1A47A 4ZSTA 5A6SA 4IHCA 1D9EA 1T99A 1EXPA 1XBYA 1KTCA 4S3CA 3WBXA 4TMBA 1HX0A 4QAWA 2WANA 4FF7A 3NTYA 3L21A 2QV4A 4PMNA 2E5DA 2EJ1A 2PWUA 2YCKX 2AL1A 1XIHA 4LUJA 2OYLA 2GFTA 3PZUA 3LNMA 3G1RA 2A6NA 1SW3A 2BSLA 3FGCA 3W72A 2QKFA 8CGTA 3NL6A 3EMCA 4GH3A 4RV3A 1YADA 4CQ8A 4ZOEA 3QY6A 3T4CA 1ZJHA 3R8GA 3NVDA 4W85A 2HZGA 1KBIA 2PP3A 1A80A 3G5EA 1R30A 2YDSA 2PDIA 3GDTA 6XIMA 1EJTC 3FLUA 1M7PA 2OOGA 3FSTA 3P0XA 3N13A 1DWAM 2C6QA 4K68A 3VD7A 3AS3A 1R87A 2PB1A 3IGHX 4GISA 5DXXA 5G1YA 2PGEA 3IV3A 2XGIA 4XZBA 2NQ5A 3RX4A 1JNEA 3CWNA 1SZNA 4W9TA 2VTFA 2YX0A 1E40A 1TCMA 1J6PA 1GOMA 3N2TA 3NQ2A 2VRJA 4BF9A 1E1CA 3KBWA 4CCCA 3N34A 1R86A 3LQGA 4JTAA 3UR5A 1RK5A 4M8UA 1FQ0A 2D0HA 2VD9A 2DT0A 5I3JA 2VC5A 4C6DA 2VNCA 5IHSA 3W3OA 3MBDA 3V16A 5LNVA 3F4VA 5EB8A 3WDHA 4ATDA 3Q2DA 4EAMA 5BCAA 1E5JA 4CNTA 1MZHA 1F07A 2C18A 3OQ8A 1W5MA 2X8RA 3Q58A 3UR8A 4INFA 3Q65A 1O60A 1BRLB 4Z0SA 1EJRC 2CW6A 4NZ5A 1J2WA 3AJXA 4GXMA 1EJXC 3TW6A 4GE8A 4PGLA 4AD4A 3HG4A 4DYEA 1V6TA 4JTIA 1AW5A 2BVWA 4PMRA 3SW6A 3HN3A 5LYRA 1UOKA 3E96A 1OHLA 1QO5A 1YBQB 3ELFA 4NG3A 3MA8A 5JU6A 1S2TA 4K7YA 3W01A 5AOUA 4UC5A 3F1QA 3PWIA 3S6DA 4I6VA 3N12A 3WD4A 3QRHA 2IUZA 3VM7A 3VI2A 5CXPA 3OIHA 1S2VA 1UYQA 3BJFA 3INPA 3S6TA 1Y7VA 3L4WA 1P5BA 3NIYA 3WLPA 1B2YA 5KINA 3PG9A 4YYFA 1X1ZA 3GFYA 4OOZA 3BLLA 1UKSA 1SSGA 4BWLA 3IIXA 2OQYA 1Q6LA 1T5AA 1ML1A 4N6FA 4QS6A 1OSEA 4DQWA 3CL7A 2XWDA 2G3IA 4F66A 2F8QA 1EDQA 2NX9A 1BRLA 2P50A 2PDUA 3WDQA 5A6AA 2VD8A 3VIMA 2E28A 3KM8A 1G6CA 2J7CA 4JIEA 4Q33A 1R7OA 2GGJA 4KS0A 1UR8A 4I3GA 4ECLA 4AEOA 3NQBA 2W67A 2B7OA 4X63A 1F74A 3PBMA 4DY1A 1WAWA 1W9VA 2GJLA 1OGGA 1RLCL 4J5NA 2DZAA 4KWOA 4LU0A 6XIAA 1XINA 4GVHA 3VVGA 1HJVA 4K8HA 3OTRA 4MWAE 3VDBA 1W5OA 3P6LA 1CT5A 4FNTA 4DRSA 1Y5VA 1WP6A 1GQKA 1VBRA 2VWTA 1ZHAA 2QDEA 3PWAA 4HOZA 2E6YA 4TIMA 3VNYA 4K7VA 1E71M 5CLWA 3ARUA 1C7SA 1BQGA 1ONWA 3UY7A 1CTNA 4JYFA 1VBJA 3PY2A 5FJRA 4LVAA 1UH3A 5AC8A 4O1EA 3LCWA 3WK3A 2VCAA 3RM4A 3B3DA 4AUBA 4DWSD 1ESWA 3OLIA 2DZSA 3AO0A 3VNMA 1E6RA 2GDVA 3T42A 2VQUA 3BH4A 1KR0A 2PC8A 3NEHA 2WYSA 1DL3A 1L6SA 2W27A 4B15A 2CBVA 1U22A 1FWNA 1WUFA 3PPHA 1IEVA 4WLCA 1UOZA 4CKQA 2D22A 3KHDA 4ATWA 1ZPTA 1XCXA 4O1BA 5IOBA 1OCBA 2C15A 2VR2A 4RV8A 1XLDA 3MZ2A 1S46A 1JGMA 2CZ5A 4M82A 3VFLA 1X38A 1B31A 2WMHA 2EQDA 2PZNA 3QKEA 3LBCA 4G7EB 1K6WA 3QOMA 3RK8A 4GACA 4K2SA 3CIXA 2J75A 2W9MA 2VZOA 4AWEA 3WK1A 1GTEA 3H54A 3W7EA 3VCCA 4MTVA 2B31A 2PDKA 1SW0A 4XD5A 3O0KA 4ADTA 1FBAA 2HPMA 5MF5A 3SSZA 3QZEA 2GGHA 3EOOA 4KRUA 5HWNA 1OX6A 4K8EA 5D2XA 1PE1A 2PU1A 3KCJA 3PSVA 4I9AA 2RDWA 4FPSA 1UIOA 3SIZA 1YRRA 1VCGA 2X16A 2IPJA 3LI0A 4LOCA 2WKJA 4NJIA 1I6NA 1NU5A 3STEA 2EPKX 1PKNA 1H3GA 3KEHA 1XIFA 4FZIA 4G5DA 1DQXA 1IWPA 1WCGA 4ROQA 4DBDA 4N9BA 1OB0A 1R3VA 4AB4A 4C91A 4ML4A 2Y85A 4RDVA 3S2JA 1JCTA 2WMIA 2ZDRA 3BCFA 4L4LA 1OGBA 4YNGA 1OCQA 3TTQA 3WFZA 4YJ5A 4O52A 1OFRA 1J93A 1MQPA 2EPLX 2F6UA 1SFJA 1SVDA 1TO3A 3GYCA 3A4XA 1Y0EA 5D4YA 3PZ9A 2A6LA 3GZ3A 3H4XA 4N02A 4EOUA 2WWCA 1EGVA 3NO5A 1SPQA 4GJJA 1TE6A 3AIVA 1H09A 2X1SA 1U30A 1O12A 4RJEA 1XD1A 3LM3A 1AL8A 4GY1A 5K9CA 1W9XA 2P10A 1UD5A 1TTIA 4Z2JA 4CN4A 3WK2A 3CPGA 3GH4A 2G3NA 2GQAA 3QQ1A 4GIRA 3NPVA 1CXLA 3ARZA 4HA1A 4JZ5A 4QE1A 4DJDD 2VEMA 3EEZA 3UPWA 4OBRA 1DV7A 1NAL1 3DU0A 4GI4A 3KP1A 3RMJA 3CAWA 3U4FA 2WOQA 3FKRA 3ATYA 2V5LA 3VDHA 2ZXAA 3CO8A 2DP3A 1QNOA 3I68A 2W5FA 2TMDA 1JD7A 4HTYA 1K8XA 3G3DA 3W22A 1W17A 1GZGA 1GKQA 1HUVA 4B3ZA 3ATZA 5CPLA 3RCYA 3MMUA 4UBPC 1DJXA 2F61A 4JKLA 4ORIA 1UR1A 3N11A 3OVPA 4LB3A 3DZ1A 2XH7A 4GUIA 4A35A 1KXTA 4ZO7A 1SMDA 1XIJA 1L0PA 2ZFAA 4NAEA 3VD5A 5D2WA 3TTSA 4X0NA 4DN1A 2WM0A 2CCRA 2OLHA 2W91A 4B9ZA 4XVDA 4P7QA 1J5SA 1WE5A 3KOFA 3VD3A 2P8BA 4ZL1A 5C9ZA 4AF0A 2Y4SA 4R88A 3UEQA 4WXZA 2Z2BA 1TWZA 4J4KA 3GDKA 2D3LA 5FAGA 1FWAC 3E2RA 2Y2WA 3NQFA 4E8CA 3NYDA 1DWHM 1JXJA 3JS3A 4UR9A 4H6KA 2ZKMX 1WOAA 3A13A 5I3KA 4GCAA 4OECA 4P7LA 3H21A 2DVXA 1XQKA 2BVDA 1MXDA 2OR2A 3MHGA 5RUBA 4EWJA 1VCFA 3ZS4A 3DYMA 4Q4KA 2OFJA 4MIMA 3OLDA 4NILA 3LCIA 3WSUA 2CIPA 2NQZA 3M5XA 4AF0B 3UZJA 3WNKA 2X30A 3E38A 4UNLA 1I2RA 2OO6A 2ZA3A 1E4MM 3VIGA 3CLMA 4MKSA 4UTMA 1A4MA 1LQ2A 4Q3MA 3SJ3A 3B9NA 1UB3A 1E9YB 1CI1A 4KPLA 4RNJA 2BHZA 1V7AA 4QCFA 1CWYA 3W83A 4O4VA 2WPGA 2PDMA 4JFSA 1PX4A 2ZYFA 3EB2A 1UQZA 1XRTA 2XSBA 5D09A 2Z1SA 2X0HA 1K9EA 2HQAA 3AS1A 3WNMA 3NPXA 4FALA 1H0IA 1R46A 2BGSA 1LL7A 3OZOA 3PFRA 1TELA 1KXQA 3LOTA 1ZFJA 4GABA 5M03A 4LRSA 2QQ6A 1EYWA 1EOMA 3E0LA 4RR4A 4PFMA 1SZEA 2PMQA 3CT2A 3FXYA 2QJIA 4GYPC 2ZRUA 2ZRWA 2UY5A 3CQJA 3WD0A 1LCOA 5HPOA 3MYPA 1CYGA 1JDEA 4XBSA 4MNLA 3QW3A 5GNYA 4I7WA 4ADUA 1HKKA 3Q94A 2OXNA 2YSWA 4OZOA 1E6NA 3VOFA 2VFGA 1CGUA 1KGUA 2QCLA 3C2YA 4LB4A 3H4WA 4K8GA 4ZR8A 2E6FA 3QV9A 1RHCA 1KRMA 3N2BA 3HV9A 3VKDA 1QOPA 3S0CA 4CD5A 4DXKA 1E1FA 4L4MA 2P5NA 3PTDA 1KLYA 3WLKX 3H7UA 4XKYA 4OUEA 4QISA 4F9JA 1J79A 2Y7DA 5DEZA 4Q8WA 4WZHA 5GNXA 4F48A 1XG3A 5EU9A 1J6OA 3P82A 3B9DA 4RDZA 1TZ7A 1IT0A 2OGYA 1LOSA 1KFCA 4IGMA 2VX6A 4CVUA 1MWOA 1FWFC 1A49A 3W73A 4DJED 3EXRA 2OSXA 1KBBA 2VXNA 2BV9A 3P80A 4IXXA 1X1OA 3NNTA 2ZOXA 2PGFA 5CG7A 1BVNP 3M0YA 1YPXA 1IEIA 5XIAA 2O7SA 4DXVA 2B81A 1TMQA 2JF7A 2XIQA 2Z24A 4CGTA 4F0KA 2VR5A 2TAAA 4QTGA 1XW8A 2VX7A 2FFIA 4FNSA 4UQ9A 3K4DA 3OLEA 1NIUA 3G0SA 4O8AA 4C90A 4LANA 2JKPA 5CAHA 3CQHA 3MSYA 2E5BA 3N6HA 3K13A 5LA2A 3NQMA 3OVRA 1M01A 3HA1A 1VFTA 3T7VA 1Z6KA 1K8YA 1M7JA 3CUIA 3KOYA 2ZA1A 1CCWB 1TPWA 3DXIA 1JAEA 3UZ5A 1ECEA 4P8XA 3SUUA 2AAMA 4LYKA 5HXMA 3IJ7A 4DM1A 5HMDA 3H2OA 1DQWA 1RV8A 4J3ZA 1DWJM 2YA0A 3YPIA 4AQLA 2V2DA 2QXWA 4HVXA 1D8WA 3CL8A 1AZ1A 1HJQA 1R3TA 4NP7A 2Y8KA 1PAMA 4R7OA 3OHIA 5C7HA 2CLOA 2FPYA 1KM3A 1WKDA 2XH4A 1AQHA 4GI6A 3E5PA 1BGGA 3EDEA 2NV1A 1GPFA 4UFIA 3CH9A 1RVGA 1YYAA 1NOWA 3VOHA 4YPJA 3GC4A 3NG3A 4XTIA 1FWBC 2QMJA 1KQYA 4GD0A 4EANA 4ZENA 3C0JA 3M0LA 4JFVA 4I5RA 5FL1A 1XUUA 2ZTJA 3ORWA 3OG3A 3EWDA 4P8UA 1VCVA 2CLLA 3RJYA 3TC6A 3C2FA 5DRIA 1R3QA 2X1IA 3WQ5A 5JBDA 1XI3A 2Y8UA 3FA4A 1KM5A 1S5MA 3VUPA 2CU0A 3AYRA 3LHTA 1EA0A 2HBXA 3EBVA 2ZIDA 4PA8A 2XSAA 3GFXA 2E67A 7ODCA 1H7PA 1LBFA 3M64A 1TA3A 1HJWA 3W38A 5EL1A 1BG4A 1TX0A 1V0NA 1KM0A 4FXRA 1FHDA 4DZAA 1QOQA 2Q6ZA 5BWFA 2YB4A 4LCRA 5G5IA 4GC4A 4CLMA 1KGWA 3MI6A 1ICSA 2DZTA 3LTYA 3VOIA 3LHZA 3NO1A 5FEPA 2QUUA 1XJBA 1XD0A 2QUMA 1SFTA 3NXFA 1SO6A 4LT9A 3HPAA 3AIUA 6REQB 2CHRA 4U28A 3HGRA 3LERA 2IQDA 3C86A 3WNPA 4IIBA 3IVUA 1A0EA 3SN4A 3ZT5A 3RCNA 3PC0A 1XLFA 1JVNA 4JTKA 3ARQA 1JPDX 3N15A 3NL3A 3IUDA 4LC8A 3WQ4A 2J7FA 1QK2A 2ZC8A 3FJ4A 5CLTA 9XIMA 3FNDA 3G6MA 3DFNA 2RH9A 4C5YA 2AOSA 3DFYA 3EX1A 1ZTVA 4B4FA 4RK8A 4TXEA 2BP1A 3ANVA 2FDMA 3WF3A 1XYBA 1J4EA 2DEPA 3NOYA 4P7OA 3QBUA 1EEPA 2DQXA 2F2KA 5DT7A 2VP8A 1CLXA 3G6LA 3NM3A 3SRDA 3TYZA 1R5YA 1IGWA 1K8CA 1F3WA 1OT2A 4ZB5A 3QHMA 2FGBA 1L9WA 4HKPA 4Q8PA 3KW3A 2TPSA 3ITTA 4FIRA 4IPPA 1PB0A 5HNNA 5CBBA 3SEPA 1BVWA 2JGYA 3TWAA 1TVNA 3LLDA 4GIAA 2GQ9A 5HAOA 3I65A 2QDHA 4PZVA 2JALA 1OJXA 1E15A 1SQ7A 4EXBA 3QPYA 6A3HA 3T78A 1ME9A 3W7LA 3GH5A 4KEZA 2VZVA 2Y7GA 3SY5A 4Q6XA 1UUOA 3QTGA 1PIGA 3BOLA 1JPHA 2PS2A 4QX4A 4PEKA 4XIMA 4AD0A 1HZYA 4Q8VA 2D2JA 2VZTA 1H2JA 3PPFA 4XAGA 1VRXA 3LCXA 4AZGA 4LV9A 5FESA 4PTWA 4DHGA 4ERAA 4LUSB 1DEDA 3GNDA 1YXYA 4IP5A 2NVAA 3LLXA 1S3TC 3SGUA 4QDPA 1O95A 2VFEA 2CLPA 3EX6A 4LUIA 3L4YA 4UUIA 2EPNA 4JTFA 1KM2A 3CIVA 3S5NA 1V08A 4C6BA 3B04A 3KHJA 4O28A 3PZGA 4CVWA 1TPB1 4QROA 1E3XA 3SFKA 2BY2A 1EIBA 2YFOA 5FACA 4XD3A 3D3AA 4JN7A 3OGSA 4LAMA 1ZSXA 4NJJA 1ZAJA 1VEMA 3W6YA 1W3JA 2VX5A 2PI6A 1UG6A 4M19A 4OT7A 5EMLA 3C3NA 3HO8A 1ME7A 1SYTA 1QNSA 3AMLA 3GDRA 3QR3A 1XLKA 2V8ZA 3WQWA 4O50A 4DWSB 4JCLA 1B3WA 2RDTA 5ECVA 2NV9A 1IR2A 2J7EA 1CXIA 1YNQA 3T4WA 3WF2A 4A3HA 3VZZA 5FJJA 1AD1A 4QSFA 5I3FA 1DQUA 2SFPA 4ZZ9A 3MS8A 3FK4A 3POCA 5DBUA 1UASA 3BUVA 2JKAA 2C79A 1Q6CA 1VHNA 3T0TA 2E6DA 4N7QA 1H0GA 1KV8A 4G1KA 4KGLA 3TXZA 1EOKA 2C1HA 1UJPA 1WZMA 4XQ6A 1LUCA 3CZGA 2KAUC 4GYJA 1NOUA 4C1NB 1RXOB 4AYGA 5BZAA 1VF8A 1DPMA 4PEEA 3UBPC 5EKYA 1GKPA 4QJ1A 1ITQA 4LSBA 5BROA 1KFWA 1TR9A 1IZKA 3GE7A 3LTPA 4ICCX 4Q4QA 4KESA 1O5RA 3HIJA 2QUTA 1X7FA 2X2GA 4JICA 2HDJA 3C5QA 3DAQA 4NHVA 3FOKA 4DPPA 2BVYA 4HIBA 3BANA 1Z42A 5H1WA 2WJDA 4TX8A 4CQ9A 1E4NA 3KOZA 3MUIA 4GIYA 3EOEA 3N04A 4NI8A 1BQCA 3PPCA 3ZQ9A 5AVHA 2CERA 3P5ZA 3AXMA 3CLWA 4F2BA 3RPDA 4GFIA 3GHTA 4U5IA 1V3IA 1E6PA 3IPWA 1HVQA 1P1MA 2PWEA 1U2YA 5BRPA 1LG2A 3GR7A 4JS3A 1GQLA 1RK6A 1QK0A 4QQUA 1BGAA 5K3VA 2F2HA 1EHNA 2W6RA 5D8ZA 3THUA 2GK1B 1YW1A 3BQ6A 5REQB 1VFMA 1S5NA 2DW6A 4UNKA 5EPDA 5CBIA 5CC6A 1V4YA 3B06A 5E9XA 1FH7A 2BXYA 2FZNA 1ZCCA 3AOFA 1RVKA 1GCYA 4PB4A 1ZU8A 4B2DA 4HA4A 1C92A 4YU1A 3RFAA 1N55A 4US5D 1C8QA 3VCRA 4FB7A 3MYOA 3BL3A 1ME8A 3J7HA 4ZOAA 3GM8A 5A5WA 1YDVA 3S9ZA 1UJQA 4QNEA 2ZUWA 3GXMA 4KEVA 4XZIA 1IHIA 1A0CA 1V6UA 4GIEA 2YXOA 3VPLA 4U2YA 1S2UA 5DMMA 5F2MA 3RDKA 3W6MA 3OZYA 1W3TA 5IBXC 1RBLA 5EBUA 3UZWA 2HK1A 3BSGA 1MSSA 3I6TA 4HK7A 4W7UA 4H2HA 2I5QA 4HB7A 2GVJA 2GOKA 4H8NA 4GQBA 3VABA 4RPPA 1J0JA 4KMQA 1MUCA 5AYZA 1RQBA 3IV8A 4GC3A 2OZTA 3T1GA 4MWAB 2J8TA 2VUNA 3CGTA 3R89A 4J2MA 1UUQA 1PHQA 4GCXA 3M6DA 3R12A 2WJEA 5HJYA 4LYPA 2QGYA 5D04C 3NDOA 4G8TA 1LBMA 1MW2A 3A6OA 3UA3A 1SR0A 1SO5A 4KGJA 4PFHA 2CWXA 3R94A 1E0UA 4D6IA 4PR4A 5A2BA 2NVCA 2P8CA 5FA5A 1KO0A 3TYCA 2JE8A 4TUFA 1Q3NA 1B3XA 4UTWC 3G1HA 1JPMA 1FDYA 5IXEA 8TIMA 3BGAA 5FJIA 2XFFA 4LV4A 1I60A 2V6AA 4NASA 1W1PA 1US2A 2XINA 4GKLA 2YLAA 3DUGA 2E1DA 3APYA 4H3DA 3HMJG 1LDCA 3D0CA 3MMTA 2D24A 3R6IA 3BE7A 4UTLA 2BLEA 2CZDA 3AC0A 4ERGA 1CECA 3A4JA 5FF2A 2ZA2A 3F03K 3KX6A 2P0OA 2AL2B 4D8ZA 4FLOA 4PTVA 3KWXA 2A21A 4X60A 4E2DA 2YCLA 4K36A 3GKAA 4H4IA 1BTCA 3QF0A 1GZJA 2IQTA 3BLDA 4X3ZA 3W82A 3S1VA 3KRSA 1J0ZA 4H9TA 2QIIA 3TMQA 4DM2A 4J9JA 1UD2A 1C93A 4AIOA 2EO7A 1GT8A 4IFRA 1A5KC 1JL8A 1EXBA 3MV11 1TCDA 1MNSA 2Y61A 1XHGA 1JNDA 2YYTA 2V3EA 3A5FA 3W1RA 1D3HA 2WVVA 1M9HA 2B4GA 1A5SA 1UHVA 2CLMA 4M81A 3UXKA 1TA3B 3WENA 4O1CA 1VR6A 5M2FX 3OBAA 3TYBA 1FP8A 2WC7A 3VKBA 2YCLB 2YZ5A 4OFCA 3A9IA 3U2CA 1K7XA 1P7TB 3LZ5A 2G4JA 2NLYA 2PDHA 2A3EA 3CHDA 2V3DA 4RNHA 4JQ3A 1FCBA 1HF6A 2YLLA 3GWQA 4YVVA 5J8LA 1SZGA 2E9LA 2DSVA 1KTNA 4AY7A 1MZRA 3NWRA 2G50A 3VA8A 5BW6A 7REQB 3RXZA 1X39A 1E73M 3HU7A 2WK2A 1EC9A 3SN1A 3WNNA 1JG9A 2FH6A 4CD8A 5D9PA 3T07A 5H2ZA 5M1TA 3FW6A 3O6DA 4JTCA 3ZR5A 4W8AA 3AWOA 2J7DA 5I3IA 3WDIA 3Q37A 4L61A 4C6QA 2ZZ3A 2CXEA 1Q85A 2D69A 4A3QA 1VH7A 3QM3A 4AWSA 4MJ2A 3L65A 1PCWA 5F1UA 1F61A 2Y5JA 3VNKA 5TAOA 4J35A 1P0NA 1UZHA 1PHWA 2EKGA 3SGGA 3SQMA 3MUY1 5JBFA 4AZBA 4S3AA 2VYOA 5FD0A 2XZ9A 2FKPA 4UQDA 1VPQA 3I7SA 7PTDA 5LZLA 2A4AA 2Y7FA 5H6HA 1VBUA 1OD0A 2AAAA 3AROA 4M6QA 4RZBA 1AQ0A 1A5CA 1JYNA 5I3HA 4NX0A 4HQVA 3N9SA 4MZYA 1UIPA 3CQKA 4LVDA 1V51A 3S9IA 4A29A 1CNVA 1XIEA 1RPXA 3MQTA 3DI1A 3EKZA 2XVGA 1L6WA 4RE4A 6CGTA 4J7RA 3IUHA 5AY7A 1R2SA 2DY3A 3GKFA 1ITUA 3W24A 3ENLA 1VGAA 5CC7A 2FH8A 3CHEA 4DNHA 1HXJA 2IKIA 4QG9A 4EX4A 3PUOA 2W61A 2X05A 4OBTA 3EOUA 2IMRA 2XYLA 4FOUA 4I8YA 3VE7A 1XC6A 3L68A 4FR1A 1C8YA 1TE1A 1IF2A 5ECUA 3V0TA 2CKSA 4F0LA 2INEA 2QPSA 1TUXA 2WHJA 1FY6A 3T55A 4WR3A 1RALA 2C91A 3KBNA 1D8CA 1J12A 3ECQA 4PMQA 1GOOA 3XISA 1W9DM 3IJ6A 2GVEA 4AZCB 5BYWA 1FWEC 2UY3A 4KH2A 5I06A 1E1CB 3R79A 4P8WA 1AJ2A 3AS2A 5D2TA 4WIWA 2O4QA 5GVJA 4F9DA 3K1GA 1P1XA 1WNOA 1WXZA 4YVPA 2VFFA 2OCZA 4NZJA 3RM9A 1QPNA 1O5KA 2D3NA 4J2PA 1IZCA 2QGHA 3QYQA 1OZQA 2CXGA 2GVLA 2JFEX 4S3KA 1Y5WA 3FYPA 3EOLA 1H61A 2FIQA 3A24A 2FVKA 1B3OA 1SJBA 1LWHA 2NX3A 4HNNA 4RE3A 3DC8A 2MANA 2DZUA 2DT1A 1Z9AA 5G4EA 4Q4PA 3O63A 2YPIA 4AC1X 3SBFA 2Y8VA 2XISA 4AZ7A 2X1TA 1ZP3A 2VL4A 4FOKA 2ODOA 1NOFA 1L6FA 1WDDA 2Z00A 1OF6A 4Y2WA 3ABRA 4RXFA 4DBWA 2HS8A 4YCOA 4WF7A 2GJXB 1GTHA 3ZOAA 3R1ZA 5A2CA 1XBZA 4OIFA 4U3CA 1XRFA 4MYAA 3GR4A 1W2VA 1TQXA 1US3A 3M9YA 2BMBA 4HCLA 4ADSA 5CPQA 2NXIA 1FDJA 2G3FA 5D2VA 3ICJA 4GG9A 3W0KA 4FLRA 1GEQA 5D02A 4PBFA 2WHLA 3EWCA 3N19B 1V0LA 1F5ZA 4MUPA 3ABXA 3VINA 1J5TA 3H2EA 5HINA 3UU0A 4QRNA 1GEHA 3GXIA 3UFYA 3IS4A 1FRBA 2H3DA 2Z1XA 1Q6FA 3FDGA 2R8WA 3O7UA 2EGZA 4PMDA 3IWPA 3QOKA 2PDQA 2WLYA 4IMDA 1EGZA 4H8HA 3UA4A 5CJNA 3N2CA 3W1NA 3QN3A 2Y0FA 3C6CA 1F3TA 1W5QA 3BG5A 3K1DA 1YEYA 4POCA 4WUIA 4NNBA 3UD6A 1TV7A 3TOYA 3W23A 2VFDA 4C6JA 4HU8A 5TF0A 4GNVA 2A79A 1ADOA 2ZXQA 4QIUA 3FCPA 1GVIA 3NQDA 2NW0A 4H9MA 1PBGA 2NT1A 1LORA 4KF1A 3EAUA 5FJPA 3W7QA 3UP8A 2X41A 3WQCA 3LXAA 3USBA 4LNYA 4AWUA 3W1LA 2GGGA 1M03A 3L12A 2WKGA 1VC4A 3A5VA 4YLWA 4JBRA 2CLHA 2BY0A 1LL6A 3CWOX 2B7PA 2J9ZA 3N2OA 4JL1A 2VX4A 2ZRVA 4QEHA 3HG2A 4ZQPA 4J27A 2Z1BA 4LBRA 4C5ZA 3VCNA 5FJTA 1G4EA 4V1XA 4Z1YA 1MEHA 3IJQA 4O14A 3H2AA 3V1PA 6TIMA 1H63A 2XZ7A 1F6KA 2J25A 3RU8X 3HG5A 4M6UA 5LA1A 1F4AA 1PCKA 2WMKA 3AXXA 1Q6OA 1SJDA 2LLEA 3GH7A 1LROA 2CITA 1J96A 2FJKA 3L0NA 3QMRA 4LS1A 2QR6A 4JN8A 4BHYA 3QFEA 4DELA 4FX7A 1CIUA 3W7CA 1NDZA 2GJNA 2PDNA 3VDGA 1DJWA 1XFBA 3CAVA 3SCPA 3R5EA 3E9AA 3EPMA 4JTUA 3M5ZA 3N17A 3E6EA 3TQ0A 1S38A 3M6YA 1UWQA 4P2VA 2V67A 3MHFA 1NFGA 4X2RA 4UIOA 3ARTA 2FJUB 4AXNA 3TNOA 4DZIA 5HULA 1P0BA 3L5MA 1X6NA 2J74A 3U4AA 2O7QA 1UWAA 2Q02A 2V9DA 2P76A 1YDYA 2R1PA 2F6XA 3C4UA 4NZ4A 3MUCA 2XN0A 3DFHA 3GXDA 5C55A 4TV6A 3F5JA 4TTUA 2V5BA 3H70A 4DF1A 4IJCA 3W70A 3VU2A 5IFTA 3V3WA 3H2CA 4WEVX 3GIYA 2QV5A 1XYLA 2UWFA 3ITOA 3OOQA 4Z1BA 2BG5A 3OVGA 3VIFA 5FEWA 2GQ8A 3UY8A 4FNUA 3AJ7A 4J3UA 3LBOA 3IJLA 1IQ8A 3JR2A 3NVTA 2DORA 4ICMA 5I7GA 4DYKA 3HQ1A 3PBUA 2A5HA 2GJPA 3VOCA 3QVQA 1EP3A 3EXSA 1TV8A 3N6QA 4UQEA 1W0MA 4AX6A 7ENLA 3UF9A 4X61A 2PDCA 1EHAA 4GQRA 3H26A 2VM8A 3G1DA 2H3BA 4AG0A 1GW1A 3DDMA 1DVJA 4MB5A 3EX4A 2ZE3A 1ITCA 3GHRA 3E74A 3I10A 4LXFA 3R13A 3TJLA 3WQ8A 4CNOA 1HGYA 1VD6A 4E6MA 2GUUA 2QVHA 1DWGM 3VKCA 4YHEA 4CCDA 4F2UA 5A3HA 1JDCA 1Z48A 1GVRA 5IDIA 2OTDA 2FQIA 2PSNA 3EEGA 4D6DA 2NQHA 4OKDA 3ABOA 3ARXA 2QAPA 3SCNA 3MV01 3LCLA 1FHLA 4HCHA 3KRUA 4NT0A 3IIPA 2W62A 1OD8A 3DCPA 3AMCA 4JIHA 4NQ1A 1UD8A 2BY3A 5A6KA 2ZX9A 1WKYA 4Q8NA 3VOGA 3LNPA 2WNZA 2ZXDA 1GG1A 4F79A 1KFEA 4CNPA 3BAYA 3HOJA 3PZMA 4FX8A 2V63A 4XSMA 3IJIA 2DVTA 3U8GA 3ITXA 3UCCA 3OPSA 2QIWA 2CLFA 3W28A 1G4TA 3N4AA 1F6YA 3T05A 5HUOA 3T09A 3ZIZA 4MNMA 1H1ZA 3D5HA 3G0XA 4N9CA 3BG9A 2VC9A 2XPKA 3LV5A 2J4GA 1KRBC 2Q09A 4JQ4A 1A4LA 1G7VA 1UBSA 4XG1A 4JTLA 4JR5A 3WCZA 5B7YA 5HK4A 3BQ5A 4UTFA 1SFLA 1M6JA 4R34A 3AAMA 1TJRA 4L1WA 2J6VA 4AY1A 5D9OA 3ALGA 1WZLA 2QUVA 2CZFA 2Y62A 3W29A 2ONEA 4CQDA 2ZWYA 2FHCA 2JBMA 1NEYA 1WB0A 3EKLA 4UB9A 3E3HA 3W27A 4GOAA 3GNOA 4RW5A 4AD2A 1VENA 1BWKA 3A23A 2HVMA 3VNJA 5H8MA 4M29A 2G4FA 2BVTA 3LN3A 1RJQA 2O9PA 4HMEA 1FUYA 5CPOA 3V5CA 3TCEA 2D23A 8A3HA 1GZ1A 3W7NA 4HMNA 2FTYA 4ZQOA 3DFOA 1NDYA 1JYXA 3HFYA 2D0FA 3JRKA 3MI3A 1XPGA 3ABQA 2I9EA 1BXBA 3P62A 3UW6A 1MFVA 4PSRA 4MAVA 1H60A 1R7AA 2QCDB 1K9TA 4O54A 4IL2A 4PULA 1PL9A 1A5BA 3WF4A 1A5MC 1Y65A 2CC0A 4QG8A 3KE0A 1W2PA 1TVLA 1RD5A 4B3KA 2NV2A 3OW1A 3AXKA 4LH8A 2J79A 4C6EA 3OP2A 1H7WA 4JPGA 4F3HA 3A64A 3VMNA 2Z1VA 2RJGA 5CZJA 2ZC1A 1REQB 4ZB2A 3PBGA 4LCQA 3OYXA 2PWDA 1H7XA 4E0CA 1QJWA 2E25A 1QO2A 2R1KA 1FP9A 3B0YA 3C0QA 2QDDA 3GB6A 3UNTA 3Q45A 2C7FA 2XUCA 2YKKA 4BEUA 4J28A 3IRDA 4GX9A 2DJLA 1B9ZA 1LQ0A 1UZ4A 4DO6A 3MANA 4OV4A 1GQNA 3GFZA 4RW3A 1AMYA 4DIAA 5C7VA 4LS0A 3S46A 7XIMA 3CZLA 3EA1A 5A94A 3TZNA 1YNYA 5AC4A 1M53A 4M80A 2FVMA 5BXSA 5FEXA 1EUNA 4NKCA 1VPYA 1LOQA 2HE8A 1Q5MA 5HWMA 3W84A 3ID7A 3D46A 2X40A 3SB0A 2VHLA 4LBSA 1YMYA 4JAWA 1OWQA 4LCSA 1J0HA 2OYMA 2ZXBA 1QATA 4BQ2A 1CZ1A 1P6WA 4RL3A 4LNCA 3BAJA 4IG2A 1T0OA 5LNSA 1S5VA 3LHWA 3RU6A 1SO4A 3EPNA 1N7KA 3WD1A 4BI6A 4HT3A 1EA9C 4FHAA 3JUGA 4GQ0A 4X9SA 4P61A 3G0UA 4L5ZA 8XIMA 3T0AA 1F7BA 3I7RA 1W9PA 2ALRA 1QPKA 5CJ5A 1SGJA 2PWFA 2E09A 4GXPA 3E12A 2PDWA 4LAOA 2DH2A 4UZUA 3P81A 3GNPA 1UP0A 3OGRA 4H9VA 1TPVA 4Q7BA 4M5PA 4QHRA 1Q6RA 3RR1A 4PB3A 5CPSA 3W74A 4JHZA 3DH7A 3DFPA 3MHUA 3ZJ6A 3C52A 2GYIA 4DPQA 3EB4A 3QW4B 4WJ8A 5HOSA 1CPUA 1N2VA 1QU4A 4G9PA 4Q8UA 1XGEA 3W88A 4Q22A 1VHCA 3GDLA 4HA0A 1ALDA 3EGJA 4ZFMA 1EC7A 1DYSA 1IGSA 4TVUA 3GX9A 2VRQA 3KCLA 3VIHA 4GVGA 3R0KA 1IXQA 2ZX8A 3BLFA 3HV8A 4IP7A 1QASA 2EKCA 4RXGA 2WZTA 3M0JA 3B40A 4EVZA 3NQCA 2ESCA 2V68A 2ADAA 1TTQA 1W9BM 4GI9A 3R2GA 4ZTYA 1UWSA 9RUBA 4I5UA 1MO0A 1LM1A 4O13A 3POHA 3FEMA 5T26A 1ZB5A 3QV7A 3QQ0A 4J1OA 5JMUA 3P8JA 4JL2A 5G4WA 4CD6A 3KVMA 1DE6A 1WZAA 4EIVA 6ENLA 3CUFA 3SSJA 4B5WA 1CENA 1KRCC 4UTTC 3LPGA 2O9TA 1I0DA 3TIMA 3Q67A 3O6CA 1FWJC 3BV7A 1CEOA 2HK0A 3ANYA 4HN4A 3ITCA 3HGOA 5BNKA 4CD7A 4ML9A 1UD4A 4E3VA 2ON3A 1S3HA 2D73A 1S1RA 4EK7A 2GSEA 1XGZA 2NQJA 1IV8A 3WH8A 1R8LA 3N3MA 3TK7A 1JF5A 3DHUA 3GG7A 4F2TA 3CV6A 4O18A 1OBAA 2XFWA 5LKYA 1WDSA 5AHNA 4I9JA 3LV6A 3P60A 3CQ0A 4CCZA 4L56A 2BTMA 3KOWA 4JY8A 5CZ0A 4Z0JA 1MQRA 1XH0A 4PN2A 4D72A 1TSIA 1AG1O 3WDJA 3H55A 3K30A 3EA2A 4HSNA 2ZCGA 1V3HA 4HU0A 5BOFA 5I0DA 1W1YA 4TTGA 1SJCA 3KLKA 4C6PA 4QJ3B 4Y9NA 3TN3A 5K2ZA 1KBJA 2GVYA 2INFA 3G8RA 3BVJA 2AMXA 2KX9A 1V3KA 1FKXA 1RY8A 1HW6A 1FX6A 3I3EA 3L67A 5E9AA 3W1PA 3CUGA 4QFUA 3KRZA 4LTSA 2C0HA 1XKJA 2ZWZA 4M6PA 1NVMA 3HQPA 4YL2A 1BYDA 2IPWA 3FV9A 2A1YA 3QH2A 1H5YA 1X8CA 2XIIA 1OQFA 2A2IA 1CGYA 4O15A 4PUJA 5HNTA 2ISVA 3MUZ1 1GHSA 3B03A 2ABAA 1SZFA 1EJVC 4PMXA 4RPQA 3MKKA 1J18A 3AALA 1KWGA 1VS1A 3T2QA 4HYVA 5G1TA 1T96A 4YHGA 4MZ8A 4Y6GA 3S5OA 2BS9A 3CL6A 4U31A 3PUGA 5XIMA 5FEZA 1P7TA 3EDJA 3SR7A 3NQ8A 2VENA 1R2RA 4OWGA 3ZZ1A 1JAKA 1OYBA 3V5OA 3SADA 2XSXA 1M68A 5REQA 2GK1A 5E5CA 2XN1A 4Q6JA 5C2GA 4NJGA 1GOWA 1QXLA 3L4TA 3BJSA 1EJSC 2WCGA 1GQJA 1NF7A 2WNWA 3UVIA 3HQNA 2BASA 1TPFA 3VC5A 4AIBA 4F4RA 5HQMA 5FSEC 1ZBVA 1JCNA 5BU6A 5FJOA 1HTIA 3U5UA 1EWEA 5L6UA 3D3FA 1M1BA 4P8VA 4QNWA 1XGDA 4WDWA 3BLEA 1OF8A 4C6KA 3C61A 1T8XA 5KSWA 1JZ3A 2ATMA 1UQYA 1XYFA 4BA0A 4LS2A 2GVGA 4E4PA 1VFHA 3U6WA 2P88A 2YBVA 4LW7A 5DO8A 4CNSA 2F38A 4YXGA 4NX5A 4OE7A 3UWYA 4UFHA 4DUWA 1UA7A 9XIAA 2PTDA 1A5UA 1OZMA 4H83A 5C54A 1UD6A 2PLCA 4H01A 4UZSA 3WD2A 2GLKA 2Q8LA 1R6WA 4U33A 5H8UA 3RYSA 4B5VA 3T6CA 3ALFA 3C0LA 4HPXA 4MB3A 4EPBC 4XAPA 1E51A 3VGBA 5AYIA 2WM1A 4AMCA 3B97A 3TX9A 3LCFA 3HMCA 4DJDA 3ZXWA 1ZAIA 5EFDA 3S47A 3ZT7A 1QPQA 4BQ4A 4QJ4B 1VP5A 3KRBA 1S5WA 4IX0A 2DIJA 1QRQA 1R85A 3KUMA 2AGTA 3LA4A 2PLJA 5TD4A 5C0QA 4S38A 5LNUA 2BY1A 3KCOA 3PF3A 3GG1A 4CN1A 3W71A 1E55A 3SCUA 4JGDA 5AC7A 3S4TA 3I7QA 3TYUA 1DJZA 1QW8A 4D6FA 4MWAC 4E8DA 4O0KA 3K8MA 3SN0A 4UFKA 2XFRA 1R3SA 3L2LA 4GHRA 4LY8A 3GBDA 3BAXA 4JTTA 1VJSA 4D71A 5FOOA 4IPJA 5A8GA 5I3GA 1FFQA 2G97A 2RHGA 3UGRA 1JZ2A 1GYLA 1OGSA 3DHDA 5AHFA 4U3AA 4X22A 1XH1A 1LBLA 3M5YA 1QUMA 5TBOA 1CLKA 3KTSA 3FY1A 2PDGA 1A3HA 3THAA 1EWDA 2P3ZA 2CLKA 1EQCA 2GUYA 3V4BA 2GPTA 1AH3A 1X1NA 1AW2A 2ZZ4A 1XIBA 2XDFA 3R0DA 3GS6A 2RGMA 2DV0A 3GXFA 1DJGA 5IM51 3FJLA 4MADA 3AIQA 3T0BA 3DIPA 4EACA 3C0SA 4W7WA 4AC7C 5M5DA 3UG8A 4UOJA 1M3UA 1KWKA 1XUZA 1MMFA 3DFSA 1E4LA 2DQWA 1GVEA 1HIZA 1W56A 4KFNA 3SO7A 2VC6A 3WUBA 3VMPA 7CGTA 4JIPA 1H50A 3K4WA 1OM0A 3VKAA 1QNRA 2WWDA 2GWNA 1YIXA 1EYEA 2H90A 3VILA 5CAKA 4L80A 4H8VA 1WYIA 2O0TA 3CMFA 1W1VA 4HK6A 1G69A 1CXEA 1ISVA 1EB3A 2ZQ0A 5HMFA 5JUVA 1JUKA 3RNDA 1PYFA 2IXVA 5HJLA 3OB8A 3MW7A 4HK5A 1V8EA 3M7SA 2JKEA 2OLSA 2PLKA 3MCMA 4Y9MA 2G37A 4Q8QA 1TV2A 1J10A 3CU2A 1AQMA 4HA3A 4JTDA 1Z8AA 3MC5A 5LIWX 3PZOA 4HZMA 3NR0A 3IGUA 4JNZA 1PVNA 3PZIA 1L6GA 2BXZA 1RD6A 3ZVIA 3S42A 1OFAA 4MLJA 4GO8A 1KM6A 4RUBA 2VZUA 1FWCC 3AHVA 3B4UA 2HNEA 5AVNA 2KZHA 2CKRA 2WHKA 4KIRA 2IXUA 1ITXA 4GI8A 3H12A 1K3UA 5EA9A 1UP3A 1JQXA 3UWZA 1XSKA 1EJ7L 2G5WA 4S3BA 3GVWA 1ISWA 4MUZA 4GUHA 1NWRA 3W7OA 1IE7C 3B9OA 1LT8A 1WXYA 3W1MA 4ZQCA 4RCXA 1WBJA 1X7IA 3CAKA 4PTNA 4MF4A 2VKZG 4E8GA 2BOGX 2P3EA 4GWEA 4RLIA 2R6OA 1ZJAA 2I5IA 3UYIA 3I6EA 4JTHA 2A0NA 2HROA 2VJXA 3QZ6A 1FWSA 3FA3A 4CCEA 3BWWA 1G1YA 1OFPA 1IIHA 4IIHA 4MG4A 2A3AA 5EMMA 3ITGA 1ZP4A 5F1VA 5KZDA 3G77A 1K7EA 1IXOA 2I1OA 1RH9A 3AU6A 5DT5A 3LSBA 1C3FA 2JEQA 2Y24A 4A4AA 1SFSA 1OG0A 3QGVA 1MFUA 5LNRA 1BHGA 4A05A 4KKXA 1A5LC 1TJPA 3CZJA 4DLMA 4MAZA 4Q7NA 4QQ3A 2VWSA 1PKLA 4AHOA 4FXFA 3WBEA 2DSUA 5BMWA 5BWAA 5FAJA 3AMDA 3BPWA 4Q4OA 1C8VA 2DJXA 3WBAA 1V3MA 5D38A 1YHTA 5BMXA 4PODA 1UC4A 3EKGA 3W1AA 5EMKA 4QAIA 1TMLA 3S1XA 1WKFA 1NFPA 5CBJA 1KXHA 5D37A 1FWGC 1LWJA 3NL5A 3TH6A 1E5NA 2H9AB 2ZZ5A 1E9LA 3B0XA 4NRRA 3HG3A 2OO0A 1E6QM 1I2NA 2Y5SA 3WLTA 3DECA 4FLQA 4KIEA 1KR1A 1W3NA 2OJPA 1E9IA 4PMUA 1GG0A 2XVKA 3L5AA 3EDFA 1XLCA 3A3HA 1UKTA 1TKKA 1UPPA 4JX5A 4AZCA 4DX3A 3SFWA 3MP5A 3KVJA 2W63A 4PBGA 1CDGA 5DCBA 4NZFA 2DUAA 1ISZA 4A8RA 3TP4A 1TWWA 1J0IA 2PA6A 4BQ3A 3WNLA 1VLIA 2DIEA 2J62A 3DX5A 1LWIA 4YWSA 3GDMA 5E0CA 2VDHA 1O7AA 2OX1A 2EBNA 2EJAA 5JH2A 5KITA 1KB3A 5CGMA 1NFBA 2AL2A 3VKJA 4ENLA 1KXVA 3I3BA 1F3EA 2BGNE 1PXGA 3CPUA 3RUBL 3W7RA 3XIMA 1JDDA 1EF3A 3MJYA 3FA5A 2OEMA 5FCZA 3RILA 2MNRA 3VM5A 3LQLA 2PURA 3L0KA 1VRDA 2BHUA 3LHVA 1QPOA 1VFOA 1GONA 2JIWA 2VGIA 4JTJA 4R33A 3KFTA 2VCBA 1K02A 4AEEA 4A2SA 4PCTA 2C1IA 4KCTA 2ZX5A 3LRLA 1THFD 2C16A 3L4ZA 3PJUA 3R43A 2QCHA 4FOJA 3TCSA 4HNCA 3MTWA 2YZRA 1ISYA 2R1MA 4ZO8A 3FS2A 4FNQA 4JOMA 1G7UA 1C9DA 3W7IA 2ISSA 5PTDA 1NM9A 3EWYA 4C6IA 3W1TA 2PDJA 4KEUA 3GU2A 4HPHA 2J78A 1M04A 1NELA 1UR0A 1KGXA 2VZSA 1D7KA 4QE5A 3UVAA 1H41A 3KP0A 4GINA 3WMCA 3PTMA 2GUBA 1ODZA 1PWLA 4ILSA 2WVSA 4N2YA 4UTKA 1ZBCA 2W66A 1AA1B 4JX4A 3M4HA 4F0SA 5HNRA 3SCRA 4XZLX 3EMQA 1A53A 1VFUA 3UZXA 1NH6A 5CSRA 4WK9A 1K8ZA 4Q8TA 1GPWA 2J88A 5E1QA 1KQZA 4QLLA 4ACZB 1R0MA 2HCVA 3FJNA 2GDQA 2QJHA 1SZRA 4OOUA 4W5UA 3TEVA 3ARWA 1F73A 1M41A 3QHNA 1AFSA 4MJMA 4V2XA 2HTMA 3EPOA 5FF3A 2AQOA 3NEVA 4NL1A 1VYSX 5AN7A 4JXCA 4H7CA 1KBLA 1XFCA 6PTDA 2ISFA 3TFXA 5CKSA 4I9MA 1LG1A 4QITA 4GQQA 3GIQA 3UZYA 3H23A 1PKMA 4C7FA 4IX2A 1JYWA 1NJJA 3W26A 1PS9A 3WLQA 2WZEA 4UFJA 4MVAA 2FLIA 2YCIX 5A8NA 4M1BA 3UWVA 3MCNA 5HQLA 2PC4A 3M0MA 4AIEA 3OIXA 2I9UA 3FYOA 3VNIA 1MDRA 3CEPA 4J3VA 1T8QA 1JI2A 4IM4A 1V77A 1A5OC 2BNJA 1DP0A 3G8EA 4HPJA 3THDA 3IUIA 1G9HA 2ZADA 5HMEA 2OKTA 3BAIA 3WG6A 2VC7A 5LSMA 3WEMA 4B16A 3R10A 1FWIC 3GC5A 2PBGA 3ZSTA 1G4PA 2EG8A 1XM3A 5DELA 1GGOA 4Z42C 2IPFA 4PYSA 1JJKA 3AYSA 3MP4A 2PLMA 4Y9AA 3NQEA 4C6OA 1NTHA 4B5NA 2G3MA 2OX4A 4KBXA 3ZWTA 5F2IA 4FXJA 1PDZA 2V0TA 1DIKA 2VDIA 2VGBA 3T08A 4PCFA 1L2QA 1JRCA 4O11A 3DN5A 1FDZA 4EP8C 2WSPA 3WQ6A 1UWTA 3V75A 4N4QA 2ZRYA 3M07A 4DF0A 1E9ZB 1TJ2A 5D2YA 5EY5A 2XTKA 2BXVA 3MT1A 3G1FA 4E4UA 2CZVA 4QJ5B 7A3HA 4GLEA 4PB5A 2ZE0A 2ACSA 4EAYA 4C6NA 1LYXA 4JHOA 1L8NA 4LAZA 4W84A 4AD3A 3SCOA 2VURA 4L4PA 1V7YA 4DJDC 2ACUA 3S2LA 1W8SA 3ANUA 5IBXA 3BOFA 2E6AA 3KAOA 4WY0F 4AVFA 3EA3A 3CV7A 3CH0A 4HNLA 4CU7A 2Z6IA 3GVGA 5T8GA 4R85A 5TIMA 3S2CA 2AQVA 3S8HA 3QLLA 4BY3A 4PCPA 5GQBA 3VD4A 4IWWA 3TYAA 1KNWA 1JCJA 4I7UA 8XIAA 4RZ6A 1OG6A 2XGBA 2E40A 5I02A 4ZQRA 4LY4A 3T44A 1UR4A 4XO6A 2FTWA 3W53A 3S6OA 1S2AA 2ZTKA 3W85A 4DF2A 4Y8FA 3MVTA 3SUWA 5CZKA 3SJNA 5CEWA 4XZNX 3QV8A 4BI5A 2J7HA 1BKHA 1NP2A 1QI5A 1F05A 1V02E 1MVYA 3ZJKA 5DN1A 1JZ7A 3W37A 3VNZA 4US5A 4FNRA 4UXDA 2YL6A 5FIPA 5A8MA 1DJIA 4DZ5A 4H6RA 3L5LA 3ZLGA 1JZ4A 4FAMA 1R3WA 4CU8A 1VQTA 2CBUA 2CEQA 3G1SA 1YE4A 4FMVA 1TZZA 1US0A 3GW3A 3M0ZA 2XG9A 5LXEA 3VC6A 4TVDA 5J5DA 4MWAD 4ZO9A 1UZ1A 4Q8OA 4YTSA 3QJAA 2GDUA 1XS2A 4G2DA 4YTUA 3HJZA 1BVZA 3WUGA 1IEWA 2BFGA 3MUAA 2FPTA 4CEXC 3S5ZA 5CPTA 1GVOA 3UXDA 3MI2A 5BRBA 1OYCA 1DJNA 5C5YA 5EBAA 1KCKA 4XTDA 1XSJA 4DO5A 3S5YA 3PULA 3KZSA 3LPOA 3MO7A 5DRCA 1ZCOA 1HJXA 1RY0A 2ZZ7A 1WDRA 3GXNA 3ZLFA 1G67A 3AIRA 4IICA 3VZXA 2VFHA 2OSWA 3K8LA 3C2RA 4HP5A 2FDSA 3O6AA 3TLLA 4O16A 4HHHA 3M0HA 5D33A 3R8RA 3RRAA 2YR1A 4K39A 4P7NA 2QUNA 3QPZA 1BTMA 2IQ0A 2NWSA 3APGA 1SU5A 3ONBA 4C65A 3EWXA 1K4GA 1EDGA 3CZEA 1WKEA 4WRHA 5HDRA 2YBUA 1GVYA 1GOIA 1EGMA 3TAOA 5CC3A 3GNRA 3O3RA 1FWRA 1RPKA 1QI4A 2UBPC 5DBTA 4R9OA 1JUBA 3PPGA 3T81A 1J01A 5AFDA 2E77A 2A85A 3OYZA 2DVUA 3NCOA 1Q7ZA 3IGSA 3SRHA 3TMLA 4LFYA 2HVNA 4L6OA 3RO8A 5I6SA 1XLGA 2YL8A 3T0DA 2IPGA 2V3FA 3UNDA 3GTXA 2QJMA 2NSXA 1XYAA 3WBWA 4TX6A 3T9PA 2FVLA 1J2BA 2PEVA 3B9AA 2O9OA 1V6XA 4ZEPA 1IYXA 2A3BA 3NURA 2E8ZA 3M46A 3SZ8A 1A50A 1HL2A 3A3WA 3N4EA 1VYRA 3M7WA 1XLMA 1ICQA 1V79A 3EMZA 4I9TA 5AC5A 3T2OA 4KCUA 1FWDC 1SR9A 3QTPA 4TO8A 3EWZA 4NXKA 4HU3A 3PJWA 3WMSA 5LNWA 3NSMA 4OJYA 4A22A 4AD5A 4ZQNA 2WNNA 1ZENA 3GZAA 3UZZA 5A6BA 2ZX7A 1UUMA 1XXXA 4H2CA 2WVUA 3KZPA 1AMKA 1J9YA 1HFBA 4HOWA 3EDDA 3AQUA 4AXKA 1UR2A 4OBSA 4R5EA 1H7RA 4S3GA 4H1ZA 2WVVB 1UKPA 3VTRA 1W3LA 3B8IA 4UQAA 4Z08A 2PZ0A 3VZYA 1QI0A 4X0VA 2QCFA 3TE9A 5M3WA 4B2DD 4B90A 2I17A 3REQB 1CXHA 4RDWA 2JEPA 3TWBA 3O16A 2B7NA 1B4EA 1TRDA 3THQA 2EAWA 1VIZA 4IXHA 3AZTA 4H04A 3SCQA 1EKOA 4KCWA 4O10A 3CC1A 4KWVA 3E2VA 1CGTA 4YMZA 3QY8A 1PUDA 2WQPA 5KZ6A 1Z3NA 4A8IA 4UTTA 1CLVA 3M5VA 1XL9A 3A4WA 3M1ZA 2ISDA 1MEWA 3ZM8A 3LTSA 1B9BA 2Z2AA 5AYXA 1KM4A 4WOQA 2WMFA 2A7NA 4WOZA 1MW1A 2XIMA 1O1HA 3B4YA 4C1NA 4XKMA 2ZUTA 1GWJA 4EXAA 1DJQA 1NDVA 3VE9A 2VEPA 1KV5A 1XYZA 4HZ8A 3BDKA 1R38A 1J11A 1PZ0A 1LF1A 4K38A 4AZHA 1OX4B 5BXTA 2FGLA 4M7TA 2OEKA 4V1YA 5D32A 3W2LA 4WSHA 3QZAA 3A21A 2PDYA 4QGCA 3LMZA 4MFEA 3ERPA 1RBAA 3L4VA 3RLVA 1Q6QA 2FHBA 1X98A 2G96A 4XD4A 2XWEA 2PFHA 4JDBA 4IPIA 1ADSA 1DHKA 3IEBA 1DE5A 1DWFM 4WJXA 4A3UA 5A1AA 2WZHA 3SUVA 1AQFA 2AKZA 3N3TA 5E93A 4AYSA 2D1ZA 3CS2A 3KXQA 4ZCWA 1EIXA 4GJIA 2WCAA 3RLGA 1RCOB 4H7ZA 1TV5A 2VGFA 2WBKA 5D30A 1RA5A 3QMTA 5ABEA 1UR3M 1UKOA 1IXPA 1WDPA 3AHTA 1UBPC 2XU2A 2Q8XA 2NXGA 2QULA 3TNBA 2YYUA 4IOTA 2VFIA 1W6TA 3DBPA 4FR6A 1HKWA 3F5LA 3CASA 6REQA 4C1LA 4HYRA 1KC7A 2I57A 1OX5A 3HJEA 1KCZA 4GVIA 1YE6A 2V5DA 1BYAA 2PTWA 3W75A 4IJRA 3W7KA 1EO5A 1LTDA 2OELA 4GUJA 5A6BD 4KRTA 3PZTA 4JTRA 5A2AA 1Z69A 4ORMA 4E3TA 4XIAA 5K9XA 1V02A 5HMSA 1R9ZA 1OFBA 3UR7A 3CV1A 1I45A 2ZVIA 3ES7A 2XJ7A 3IAPA 4PTDA 4K37A 4BK9A 1P4CA 1DXFA 3SCTA 2PBOA 1F8IA 1V5XA 5A69A 4XUYA 3BURA 4ZVJA 4PL2A 5AYYA 5D8WA 1N8WA 1JPKA 2P1FA 4GGHA 3CEUA 3QYSA 4UMCA 3C8FA 2CWNA 2FB2A 2QCCA 4B92A 3RHGA 5MHBA 3T0CA 1I2OA 3OA3A 3E02A 3AHZA 4HNVA 4GVFA 1VAHA 1JQVA 2PPGA 5GJMA 1QWKA 1X6UA 3CM4A 1EPXA 3RR4A 3DGRA 1SO3A 4DUOA 1O66A 1XIDA 1E4IA 4WXYA 1TG7A 2GSHA 4XD6A 3SUTA 1FWWA 2VOMA 4L1GA 2VO5A 1Q6DA 4NAFB 3TJXA 1EUAA 5HANA 1NWUA 5IDZA 4AY8A 1JCXA 2BODX 3H6OA 3NZGA 3UETA 3URQA 4BJHA 1XWYA 4FF5A 3IIOA 1UCWA 3OA5A 4D2JA 4NY2A 3LSCA 2YIHA 3TC7A 1CGXA 3U57A 3RF9A 1YX1A 3WZ0E 4GH1A 2JGQA 4F8XA 1LUCB 3ARYA 3WQVA 1XIMA 1HGWA 1VEPA 3GTFA 3PN8A 3DG6A 3MDUA 5EMJA 1C91A 1XLHA 1FKWA 3FN9A 4F40A 4Q7IA 2XVLA 3WQEA 4JNMA 3DEQA 4ZQMA 4NZ1A 2FZBA 1V6YA 4FS9A 1FVPA 1QHOA 4AZ6A 3CTLA 1TV3A 2OB3A 3W1UA 4UTHA 1EJWC 1ENUA 1V0MA 2OT0A 1KCLA 1W1B1 3HGSA 2L5HA 4PTMA 3W2KA 5LIXX 1UR9A 3U0HA 2ZRZA 4FI4A 5JQ9A 1TZ9A 1TPH1 2F9RA 1PX3A 4ZBCA 1XP3A 4JY9A 4KWSA 3VAVA 4XO7A 1NF0A 3N6JA 4XB3A 5GPRA 2QMKA 5AC6A 4PMVA 1K7FA 1WBHA 3AUJA 5GJPA 3TQKA 4AX7A 3RX3A 1W1A1 2ZZ1A 4FK9A 4MDPA 1S1PA 3G1XA 3ZO9A 2EG6A 1C90A 4HSHA 4XBKA 2WMGA 3PAOA 4I90A 4JX6A 2DPEA 4M1RA 3W7GA 2EG7A 1WOBA 4LUTA 4O8RA 3FXGA 3G2GA 3P14A 2Y89A 1MNZA 3TV8A 4JNYA 4S2CA 2EEXA 2FMOA 5HUPA 2ZX6A 2DU2A 3FAWA 4UQCA 1OIMA 4O17A 3TR9A 3LHUA 4IIEA 3D47A 1O5XA 1W9UA 3URBA 4MOZA 1JYVA 4HPNA 4PBEA 4JTEA 2V5KA 3WLOA 2PDXA 4ONVA 4MY1A 3OZPA 2E68A 2RFGA 1KA9F 2WSYA 2YDAA 3GIPA 1XLAA 1CGVA 4PC8A 4M6VA 3EWUA 2RUSA 4GUGA 3UPBA 4TX9A 5IHRA 4DNMA 3CT7A 1VBGA 4Z2GA 1TREA 1VPXA 5MKGA 1VJZA 4G7FA 4REQA 5DY2A 1D2KA 2DH3A 2A7RA 4UFMA 1EL3A 1F4HA 3RAOA 1KLZA 1O68A 1W1ZA 2YXGA 3GSMA 4LX4A 1K70A 3CHFA 3QKZA 4S1FA 2XIJA 4MY8A 5CPMA 1ONRA 1AJ0A 3GXPA 3UJRA 3NGFA 3BCDA 3SCVA 3K5XA 3GNXA 2RAGA 2Z0IA 3UJSA 1QHZA 2PRHA 1JD9A 5E70A 3FVMA 1OX4A 2FMNA 1TVPA 5KMYA 3RJXA 3AHYA 1GYNA 3APTA 4Y7EA 4ZE4A 3TJIA 1WAUA 1S2CA 2HRWA 4S23A 3CYVA 3MBFA 3K46A 5DCEA 2R94A 4FLSA 4XZWA 4FIQA 4AIUA 4U10A 4V28A 1IT8A 1CGWA 2E7FA 5G4HC 2ZDSA 2NZLA 1BEUA 4NF7A 1WPCA 4Q4SA 2C14A 4C7GA 2XIBA 3TW7A 1ZLPA 2ZRXA 1X96A 4BI7A 1OFQA 3OU8A 4CEUC 3W7MA 3IACA 1OABA 3GTHA 2C8NA 2GJRA 2Y63A 4UTWA 3UJEA 2WZIA 1Q8JA 2JF6A 3UQNA 3KLLA 2CFFA 3LX9A 4ERIA 2TRSA 4PCSA 1I2QA 1V03A 2B0MA 3PHAA 2EPMX 1IT7A 4EXQA 4HJWA 4U5KA 4JN6A 3B0UX 4AU0A 2WVTA 1MRAA 3WJZA 2QCNA 3MY9A 1OIFA 4BEQA 3DERA 3BV4A 1AVAA 3GAYA 1JEZA 2E4TA 5KTLA 1QBBA 3UJFA 4LEFA 2PAJA 2GGEA 3C8NA 1OCJA 1SJAA 1QFEA 3DFQA 4LUYA 1MDLA 4XZHA 4S39A 3VKKA 4PRTA 5D03A 3M0XA 4LAUA 3USZA 4IUGA 3RIKA 3HGJA 4HZ7A 4TOQA 1XICA 4A21A 4WD0A 2XGZA 2I56A 2DSZA 2VVNA 2V3GA 2HSAA 4V33A 3M44A 1R9XA 4OQVA 2J7GA 1POKA 2PODA 4DO4A 4ACZA 2Q3OA 2ANUA 3TUUA 4L4OA 3W6LA 4IIDA 1PWMA 3GU1A 4HU4A 1XIGA 2XM1A 3VGHA 3TFCA 2R82A 1KFKA 4KFPA 3ABZA 4GZ7A 2PD5A 3VIOA 4HN8A 3TKFA 1GVQA 3CHVA 1T7LA 2HISA 1OCNA 1RA0A 3UXIA 4PTXA 2YOCA 1JCMP 4CU6A 3NXLA 4UTUA 1ADDA 1EBGA 2DSKA 3LXCA 1P0DA 3U9IA 4D6HA 5LGXA 3CTTA 1QCWA 1LL4A 4BQ5A 4KETA 4W93A 4Z1DA 5HA7A 1W91A 3NQGA 2F6KA 3BLOA 2MUCA 4L64A 1I1WA 3WLHA 3U2OA 1N8FA 5AHMA 2R14A 1DJHA 1E3ZA 4AEFA 1DBTA 2HNHA 1TPC1 2E9BA 4UR8A 3PBYA 4NYYA 5TNVA 3RX2A 5A8OA 3MKCA 3LRKA 4H9YA 4WVXA 1W37A 3KDOA 4IT1A 2OZ0A 4NAEB 3R8HA 4DO7A 4PSPA 2QCMA 2NUYA 3PS7A 1FCVA 1YDOA 3QQWA 3TJ4A 1BLIA 3WH9A 3TN6A 4Z2LA 2UZ9A 2QJGA 3COTA 4KWWA 3ZR4A 2PP0A 5EMUA 1ONEA 5FF0A 1VKFA 4O57A 1HP4A 1C8XA 3WJWA 1V6VA 4QEEA 3L9CA 3G22A 2WSRA 3WH7A 2WJFA 3UCDA 2UY4A 3SECA 5ENLA 3MSDA 1IWAA 4QM1A 3NSXA 5A8PA 4S3EA 2OG9A 2I5GA 4WSKA 3OBEA 1E1EA 4HPGA 1Q45A 1ZAHA 4PRWA 3SUSA 3N14A 5C2CA 3UESA 4ES4A 4LEQA 5BU9A 1PIFA 5H8PA 3NQVA 3RMEA 3PTKA 4NIRA 3GQYA 4DBSA 3JW7A 1KFLA 1G4SA 1PPIA 3OBKA 2J27A 4A3RA 3FAXA 3BOXA 4IH3A 4N6EA 2O4MA 3DBNA 1JIBA 5BOOA 2QAFA 1H49A 2HVOA 1BKSA 3SRKA 3W2JA 2H8XA 1U83A 2BOEX 4GBUA 1E72M 4C6CA 4DAFA 2H9AA 1LLWA 3V1HA 5JXQA 1B90A 4BR1A 3V35A 1Q13A 3WLRA 4W8LA 3PZQA 2C1GA 5AZ0A 2D20A 3W7HA 2A3CA 1I4NA 4HSOA 3G24A 2UV8G 1HKMA 2OOFA 2OKOA 1QHPA 4IFKB 4URIA 2VQTA 3WF1A 3MVIA 3LM7A 1U1HA 1LRQA 1JGIA 4MFDA 4KEMA 2XH0A 1QVBA 2CPUA 1YKWA 3NZQA 3BMVA 1ZY9A 1U1JA 3GAKA 2ABBA 3GK0A 1YNPA 5KETA 1CB7B 1DTUA 1Y8BA 2B7QA 3MMDA 1FTXA 3WQPA 3WN6A 4OTKA 3FGCB 4YTTA 3F2CA 3H2FA 5DFAA 5I3DA 4ZOCA 4C7DA 2I14A 3UT0A 2J7BA 2DZPA 4BS0A 5ABFA 1