2FMTA

Methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
314
structure length
314
Chain Sequence
SESLRIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVAELQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRREWFVPGNRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FORMYL-METHIONYL-TRNAFMET2
publication title Crystal structure of methionyl-tRNAfMet transformylase complexed with the initiator formyl-methionyl-tRNAfMet.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Complex (methyltransferase/trna)
total genus 78
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 2.1.2.9: Methionyl-tRNA formyltransferase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 2fmtA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 2fmtA01
1RBQA 4ZZ0A 4ZYXA 1RC0A 4ZZ1A 5J63A 1JKXA 1MEOA 4ZYTA 5J9FA 4TS4A 4ZYWA 4ZYUA 3GARA 1C2TA 1FMTA 4EW1A 3KCQA 2BW0A 3DCJA 4IQFA 3AV3A 4PZUA 1MEJA 1CDDA 3N0VA 4YFVA 4DS3A 4ZYVA 3O1LA 2GARA 4EW3A 1ZGHA 3TQRA 3R8XA 1GARA 3W7BA 4NV1A 3NRBA 3TQQA 4QPCA 3OBIA 4TTSA 4ZYZA 1ZLXA 4ZZ2A 1ZLYA 4ZZ3A 1MENA 4S1NA 3AUFA 2YWRA 4EW2A 2BLNA 4QPDA 1NJSA 1CDEA 4YFYA 1RBZA 2CFIA 3LOUA 2FMTA 1RC1A 3Q0IA 3DA8A 4Q12A 1YRWA 1GRCA 1RBYA 4ZYYA 1RBMA 1C3EA 1S3IA 4R8VA 5CJJA 3P9XA 4TT8A
chains in the Genus database with same CATH superfamily
1UPUA 1KY5A 5FLXA 1T9AA 2WYVA 1WZIA 3HL0A 3MCZA 3R8CA 1LY1A 5I51A 1AUVA 3R0QA 3F98A 4NH4A 4RHFA 1KYQA 3FF1A 2WFAA 4R7GA 1LNZA 5FBLB 3TLKA 1A4XA 4NCHA 3NM5A 4BVHA 1S2DA 1IFXA 4BMZA 4BMSA 4TMZA 5I45A 4M21A 3LGXA 1W5FA 2JJ2D 1TKAA 2FDXA 1ZN2A 1ZM9A 3IIMA 3KEGA 1YCGA 4KLAA 5G0WA 1IXSB 1ZMXA 1NHWA 1WR8A 1PWHA 4GR5A 4HAZA 4KDCA 2A1TS 4YDHB 5JUWA 3RC8A 4Q7MB 3OM8A 2DRIA 1E79D 3ROTA 4UDOA 3FAZA 3LDFA 1CY8A 4KOEC 2ZUTA 1YIAA 5FT9A 2B9VA 1BN6A 1RXWA 1DBWA 2AUTA 2OC9A 5B7PA 3PNPA 1Z6YA 4Q03A 5H3HA 1QF6A 3ZWYA 4Z53A 3HBFA 4LHXA 2FSVA 3HNRA 5IASA 2ATCA 3GFVA 1H42A 3NUQA 4GBMA 1Z2OX 3KTDA 3NC4A 1WDLA 1KYYA 4YPFA 4HNTA 5KTYA 1USIA 3JD0A 3E35A 5D3MA 3IX7A 3FFAA 1S4MA 3OCYA 1QX4A 4G3XA 1YKFA 3UG6A 3H3JA 1MMFB 1VRVA 1JR6A 4P3XA 4FBLA 2W6CX 3FLEA 5BOSB 5K8LA 4DQLA 1UPBA 4JIMA 1E1QA 4PPYA 2IPXA 1WCIA 2C5LA 2ZUUA 1HT0A 3AL0C 4M4SA 1ID8A 2AZ4A 2NTVA 4RS4A 3JD2A 4RMIA 2AOUB 2A3RA 2JAPA 1V3VA 2HJSA 3EBPA 3L8ZA 4NESA 3N2NA 4NYMR 4IYJA 2P6UA 5K3EA 1VXOA 2AUMA 2GHIA 1VDMA 1O95A 2VCYA 3ACBA 2B8TA 3IT1A 3OX1A 2V1UA 5ALJA 2P4HX 1AKRA 3SZGA 3EASA 4GZMA 5F35A 3KSZO 1G20A 2IUUA 1NBMD 4I8IA 2FJPA 3NBKA 4ZDJA 1L8LA 4A73A 1WP9A 2C2OA 3HM9A 3RYIB 2QENA 2IDZA 1A7JA 2QBYA 4LJ5A 1PT7A 4NLLA 1BD3A 3IUNA 5E4JA 2W0SA 2Q9CA 2QX7A 3IQGX 1GGHA 2KQUA 3D4NA 3KTAB 4GS5A 1X7YB 1YQEA 4BGEA 4EW2A 3ER9A 4QA9A 1QV9A 1JE1A 1E6EA 5JJKA 1I80A 3W2EA 6ABPA 2ACKA 3UMYA 2OZPA 3LYAA 4G56A 4UUNA 1M7HA 2FI1A 1XX6A 4KLZA 3LY5A 1X1QA 2ATXA 3HDYA 1V41E 3R4CA 3CGWA 3GLKA 5ANRB 4ILEA 1KDRA 4KFCA 3NOQA 1S01A 4TYYA 421PA 4J76A 1UJ2A 2QPTA 2H4XA 4LAFA 3FJ1A 4GSLA 1CLEA 1CQPA 1DO8A 3O95A 3PQFA 4HSGA 4YAUA 4NICA 3P0HA 4F71A 3JQ6A 3T4PA 2IHKA 3ENWA 2QN7A 4HEA1 4AKEA 4KPFC 3KM0A 4DEVA 1XMSA 4ETMA 2RGRA 1OKKA 2NXCA 2B3TA 3V8VA 5A0TA 4D57A 2YZNA 1MN6A 3OE7A 5REQB 1YS4A 1MPXA 4F9EA 3M6FA 4YA6A 1J70A 5KOYA 3TNDA 1DC7A 3KUDA 3OCCA 1YH3A 3QI7A 5K3AA 5JNVA 1YR2A 2F1IA 3D59A 3LJKA 4FKMA 4YCJA 4KWEA 1RJEA 5BSTA 3K1ZA 1RM3A 3K2EA 1C3JA 2ZBDA 2H2WA 3ANMA 4ZYXA 3BSFA 2V5VA 2YZGA 3DWFA 1QJCA 2GBPA 4M22A 3G2MA 3OJEA 2GESA 1GZUA 3FB4A 4RHYA 3VNQA 1HLPA 4BJ5A 1U1GA 3U2QA 3ZWOA 4D6PA 5HVNA 3RLIA 1YFJA 2PUDA 4I5EA 2AHRA 2K7ZA 1C0PA 1IN6A 4LVUA 1BXZA 2K7FA 5K03A 4NPCA 1AVTA 2EZUA 3ETCA 4C22A 2PM8A 3DTVA 4OQEA 5HM6A 5LUAA 1J5XA 1A5ZA 1UKAA 5CDHA 1AKYA 2Q07A 3P4YA 2LCIA 1DX6A 5FPKA 3WDKA 1NG9A 2J3IA 3AM4A 3SF8B 4E09A 3ELYA 3WIOA 3EGWA 2IUTA 5K01A 1KZ9A 1DU4A 2LTAA 5JLJA 2GEFA 1U9YA 1VI6A 3SS8A 2G72A 1YVPA 4ID3A 1P2DA 1PD1A 1E7RA 2XE6A 3RC1A 4KXUA 1K7XB 2XTJA 3OKCA 4RC9A 5EXPA 1JT9A 2XAUA 4N0EA 5BN1A 3U39A 4E7PA 3WP1B 1X7HA 4TYNA 1XJWA 3RO7A 4MW5A 2I76A 4YFVA 3HO6A 5DNAA 4ZYVA 4MPRA 5K6TA 3PFWO 3NANA 2OMKA 2EBFX 1JX6A 4HT3B 3PFCA 4ROTA 5TT1A 3OIUA 5EIOA 1YDGA 1ZGHA 1ZX1A 4TLCA 1SM4A 4NENB 5F7ZA 1X42A 1JDPA 1GU1A 4RVOA 3P2MA 5JQGF 1V8OA 5JXWA 4YCMA 3P9PA 3QVVA 4ZVPA 4GECA 4DIBA 3ZBTA 1FQJA 2O2ZA 4B4KA 4DIKA 1PTJA 3IT2A 1WQ4A 5IH3A 1EE9A 1KBQA 1UWVA 2ET6A 1OLOA 2QL5A 1I0IA 1YJ5A 2M9MA 4UCQA 4R7TA 3H0EA 3FOBA 3ZWDA 1N2IA 3BXFA 4FINA 2K2QB 2BGKA 1C7RA 1PFVA 5DP2A 1N3BA 3LWNA 3TINA 5CHYA 3FDJA 3VZDA 2OESA 2J0VA 5KPJA 1KHHA 2GEDA 2WYWA 6REQB 4ZDKA 5C9ZA 4J0DA 1WA5A 4PSDA 4RVSA 1XQWA 2H4YA 1VL0A 1GVNB 2GBLA 3UEOA 1AB5A 1SBTA 3KCNA 2NXEA 3HVJA 3O26A 3H75A 4HJXA 1IM5A 3TCXB 5BOSA 2ZTUA 1XTRA 2YWHA 3CY6A 4DBLC 4FP9A 1WUYA 3INNA 1SJ9A 2HRCA 3S2SA 2WYHA 4B46A 1H85A 4CPDA 4RTSA 3WGHA 4ALMA 1V5EA 2Q0HA 4Q5IA 1T5BA 3FIJA 3NI2A 4V2UA 3KKEA 4YB8A 1A69A 1LVHA 5FCDA 5FB3A 2CUZA 3Q0IA 3E9RA 4YMSA 1Z47A 2XXJA 5DX1A 3GR6A 5HDBB 3DH0A 4Y6RA 3WIVA 3DOHA 5KVCA 1VHQA 1YR3A 1NN0A 2C4KA 5CT9A 5HDQA 3MZ0A 4D98A 5JROA 3BH7A 2VP0A 1N32B 3NR2A 2X1MA 2XMDA 4MKZA 2XKKA 3QJYA 1OYWA 3HACA 3QP9A 4TS9A 2A59A 3AV0B 1K2VN 2RGXA 3I6ZA 3QOFA 4FYKA 3L6OO 1PR6A 5FO0A 5L3RA 1IY1A 1Z6TA 3FCCA 5SYMA 4GR9A 3RYIA 1AM4D 3SQXA 1RMTA 4PFSA 5T41A 5LMZA 2AQ8A 4YP6A 3KTAA 1EVEA 2OXRA 5GMOA 4PLTA 1X7YA 2GT1A 4Y1FA 2WYUA 4ODIA 5JATA 4QTUB 1W87A 2YMLA 4L95C 4NF2A 1UEIA 1WCWA 4PHTA 1ZUWA 721PA 4UM9D 2HWYA 1PZEA 3C70A 5BMOA 1VL2A 2CZQA 1G5HA 3G7SA 3R6DA 5KTSA 3KYCB 5A0FA 1KMMA 4RD0A 3STWA 4FM9A 4GP7A 2OFFA 3R5KA 5EWJB 2AJLI 1F3OA 4L02A 4R7ZA 4OAOA 4AECA 3O4JA 1H6BA 1KRHA 3U4DA 4BZPA 3AR5A 4LRSB 4WNIA 4ZQEA 4C4XA 3BGDA 4JN6B 3QEJA 4PO3X 3EISA 5IAKA 3S27A 2DBZA 2GCOB 4BLRA 2I6FA 4LC9A 2H16A 4KAAA 2I54A 2I6TA 4W7SA 5REQA 4TM7A 1QV6A 4JEUA 4B7CA 2NP6A 3COVA 2Y71A 2FVYA 4TQAA 1ZOLA 2ZJBA 4O08A 4F11A 2JFQA 3BZWA 1R0WA 4G1CA 5AKJA 4MSUA 5I01A 1KMQA 1GDDA 3DO8A 1Y6ZA 2IYYA 5AW9A 2QRMA 4MAAA 2X7XA 3IPLA 3DZBA 3ND8A 1ISHA 2H48A 4MAFA 5FHQA 3X44A 4A26A 2YRXA 4PRZA 4IMPA 5HIIA 3ANYB 2OEPA 3EXFB 2VZLA 3KL4A 4R9VA 1JJIA 3R7LA 4P7JA 4PSKA 2XX3A 2ZTLA 1NXWA 1MPTA 5A7FA 1G0NA 3G1UA 1KQOA 1JFRA 1RCTE 1XD9A 2OGTA 4IHKA 4JNKA 4QKQA 2GR9A 5L51A 2GN8A 2DMRA 3B6ZA 3V33A 4AS2A 3CRW1 1M2GA 2Y68A 3PC8C 3CEPB 5IZCC 2QE7D 4M89A 2VPZA 1KGSA 1DAHA 4ENRA 3IAEA 3H9JA 2Y77A 3K2BA 4OO3A 3WWEA 3AJEA 3SF8A 3L7BA 3GWZA 4OHCA 3G02A 1VJ5A 2WINI 2HR1A 3GLVA 2JBWA 1PQ4A 2HF2A 5DGHA 5F2EA 2ZRLA 1MABB 3I39X 3CH5A 5FTNA 1H5UA 4L7VA 3V1MA 5INTA 2IXFA 1KI9A 3LCCA 4MQ4A 5BR1A 4TX1A 2XB2A 5JJLA 2X7JA 2WVGA 3BJEA 4F45A 1DKQA 3S3TA 2C92A 2OQ2A 1N9ZA 1NATA 2J3EA 2W6MA 3H83A 4DMKA 4BPBA 1QVVA 1QLJA 1TU3A 2LDXA 3GGCA 3IVAA 1JSXA 4NENA 4V2IA 5JAMA 3Q2IA 3DV0B 4HTFB 2EKDA 1EJ0A 1RLOA 2FSPA 1OGJA 4L5YA 4PYLA 4UU1A 2C9DA 4FVTA 4RTKA 4K0KB 2WIFA 1R3UA 5PNTA 4E2WA 2QZZA 1JDUA 3PKJA 1EWYA 3TS1A 1RWQA 4HN2A 3WRYA 4K9KA 1DOZA 3H4MA 1XQXA 3FNFA 4HY3A 1JUDA 1YCFA 3I5XA 4TTAA 3ZLBA 2CUKA 1A96A 1M7GA 1YCHA 4NYMQ 4WJKB 2VF7A 5IX8A 1TZKA 2ZJ2A 4JV5B 2Q5FA 1J0XO 1GKLA 4H1HA 4OQFA 3G6WA 5TR9A 5EQFA 1KDOA 3HYNA 3JQAB 4IVRA 4WNCA 6REQA 2FZ5A 2YVKA 3C15C 5KNCD 3R76A 1GCAA 2ACWA 2R97A 4IDFA 3OPYI 3Q7IA 2DHRA 4PCLA 3GLGE 3VR4H 1CQWA 2ENWA 2WT4A 4Z9FA 2ZIVB 1ETUA 3B1KA 4ZAGA 5JZOA 4P3YA 1Q1ZA 1NXXA 1SB8A 3T12A 4O6VA 3K5WA 4Q00A 4IIBA 3DR3A 1GO2A 1LZLA 3L3BA 3AUYA 3GUHA 1YASA 2WIGA 3HDGA 3MWEB 3PUHA 3HA7A 4GZLA 2GPJA 4XIGS 5CA0B 1EI9A 1NKTA 1OBCA 1USKA 1IZ9A 1C9NA 4UDYX 4DHEA 1I5RA 1PKXA 2PVCA 4FHGA 3PZRA 2OOSA 3P0RA 3HABA 1A5TA 2ETVA 1PZNA 4UFOA 5FOSA 2ANCA 3TD2A 2K4MA 4CN9A 3LI2A 2EP7A 2PMFA 4MVJE 2WIBA 5HF6A 2V6JA 5KYXA 2YINC 3V48A 2LKCA 1QJ4A 1XLTC 2V8OA 4IV0A 4AMZA 1SO8A 2VPIA 2X5OA 2CKDA 2NUPB 4FGZA 4W1QA 4Z4HA 5BWNA 1U7XA 1E18A 3NZEA 4L74A 1RAHA 4C4OA 1NLUA 2C2ZA 1KYTA 2IEDA 5DF1A 3CINA 3NBZC 3D7NA 1GSAA 3PFKA 1GCIA 1C5KA 4KSYA 5KWVA 5FL7A 1AJEA 3OG9A 4F4CA 1QO0D 4C30A 4X6XA 3ZV7A 1Q16A 4AMYA 3URMA 1NKSA 5D7BA 2AF4C 1E2KA 4WX2B 4QG3A 5TGZA 2HJVA 3RTAA 2VDQB 4IS3A 5EJ5A 3KYCA 3FLAA 1B7GO 3FKSA 1XMJA 2R1VB 4F12A 3WV4A 2GLUA 5CBKA 3OF5A 1UXIA 3P45A 3KZMA 5BRNA 2PA0A 4ZCPA 2O4CA 3ZYZA 4XUGB 4O1IA 2GJ4A 5CNJA 4MLPA 2VL7A 3TKYA 4HDKB 2YMMA 2AUNA 1NIPA 4M3NA 4OQ4A 3C4JA 2BFEB 1NVBA 2E6UX 1KO1A 1SCBA 2PZJA 2V7BA 2KPOA 4NAVA 4U9HS 2VZ8A 4JLOA 5KTNA 2OAEA 4RZ2A 3USCS 2GCOA 4IIHA 3HO1A 3HVUA 1ULTA 2JGLA 3OOYA 1D2NA 1L5LA 1T1GA 5FL3A 4DQKA 4E33A 3DLBA 1NLMA 3EDOA 4RJIA 1KI6A 3LLVA 1QYCA 3KTOA 1R9MA 3RFTA 1GYPA 2ZDGA 3I9V6 1RE1A 4FXPA 3SLGA 4DQVA 4EF5A 1P6UA 2O2XA 2I7TA 1XEAA 2RH4A 3G5TA 4UOEA 3FHOA 4GU5A 1J2YA 2HDOA 1BWRA 1SFRA 3HVRA 1II8B 4C06A 1B26A 3ENNA 3PYLA 5JECA 1E79A 4X66B 1B8VA 4EHLA 2JS7A 4R1LA 3UGTA 1T1EA 4LQLA 3W8NA 5C8DA 1U99A 1GILA 3EXFA 3OWOA 5E1BA 3A3YA 1PUIA 3KJEA 4ED9A 2ZIAA 1UWCA 3IB3A 1KFKB 2VI5A 5BOVA 3DEZA 4PLPA 4I1VA 3DDSA 3OM0A 1PDOA 1LVUA 3OIVA 1WV1A 4FR5A 1Z26A 4Q4JB 4AZWA 4DV5B 3IUSA 2ADOA 1AQUA 4HEA6 1OPXA 1TRHA 2ZRPA 1J42A 1Z74A 2ZI6A 3PIIA 1CUJA 5AKKA 3DUFB 4EBBA 1NBWB 2GD2A 5I9LA 1ZCJA 2ID4A 3N2IA 3S0JA 4V39A 1MAUA 3IQEA 5DK4A 4U2DA 5JPDA 4DN6A 3HB7A 1MABA 2KHZA 1UQUA 3CLUC 1JBEA 2VNAA 3OJCA 3QFRA 3KQKA 5LD2B 4UHBA 1AS0A 1XPJA 2RHWA 3KB6A 3UV3A 4DWOA 2C4HA 5D1NA 1KOFA 4EJMA 4AF7A 2GFHA 3L8DA 3O21A 4AUKA 3EA4A 1TT7A 5JJIA 2JFYA 3E9MA 3IL2A 4CQLB 5LMNB 3HZOA 2GQ0A 4PGGA 4NNOA 3CS3A 1MW8X 1R0YA 2P2ZA 4OHMA 5BUCA 2PL9A 2R6R1 3LHIA 2IBMA 1OAOA 1UMDB 4EGCB 3OU6A 1YFLA 2PDAA 3NHPA 3DV0A 4HTFA 4YQEA 2XA1A 5CA1F 4B3CA 5IDQA 5CPBA 3DR5A 3E7WA 4BKOA 1GCOA 2INGX 4N3CA 1OF1A 2IUSA 2FUKA 4GYWA 3RFFA 4ZYWA 1JKIA 4IRUB 1W59A 3K0CC 4GVPA 4YRAA 2KM1A 1AOXA 3L01A 4UM9B 3ZE7A 1Y3IA 4URFA 4J0EA 3SR3A 2NIPA 3HP1A 4MQFB 4C2TA 2ZRQA 4R40A 4JR2A 4BWYA 4IG9A 3RFXA 3UAGA 2I0FA 1VHDA 1GV1A 2CLCX 3T9AA 5GIOE 2O7RA 1XIVA 5L7TA 3LQFA 2JD2A 3H16A 5BR8B 3GGOA 2IP1A 4BNLA 3N3BC 1ORWA 2PGNA 1YDFA 2PZ8A 4H1TA 2HXGA 1AO0A 4KR2A 1QYRA 4JI0B 4BVFA 4QYXA 2CXOA 4L6CA 4CR6A 1I4TD 2RG7A 1YZUA 1E92A 3MWEA 1EA5A 4B71A 2PKWA 1QYWA 4HWKA 5CA0A 2O20A 4ZVLA 1IPHA 2F8LA 3OOJA 1E2EA 3TLBA 4CF5A 1TQ6A 2VZ0A 5IEJA 3MPUA 4B6FA 1CRQA 2XBMA 3C6XA 4NAHA 1K63A 4QVGA 4ZU6X 4B35A 4RABA 1USVA 1QKIA 2JCGA 2DSNA 4OSEA 1ZU4A 3GEIA 3KT6A 1B8OA 1XZIA 5E0KB 3HZZA 1RZUA 2NUPA 5LA6F 5C18A 3AVWA 2JLBA 3AWIA 4YV1A 3IAUA 4D41A 1ZJZA 2VWGA 2IITA 2JJQA 4EJSC 1JEQB 2H51A 1KE2A 1AQJA 4EG6A 4PC3A 3HB9A 5AVJA 3OM9A 2Y9PB 5AW7A 3AU9A 4RUKA 1UK7A 1N57A 4MUFA 5AJWA 2WC1A 2NZJA 2P62A 4N41A 4QJIA 5WRFA 1ZZEA 3K73O 1WF3A 2R1VA 1U2TA 4MUNA 5EA2A 5IS2A 1QVAA 2CNLA 3WFZA 1VE5A 4Y2XA 1PW7A 4JA2A 1V5GA 1SVNA 2PBZA 4G0OA 1ZD9A 4HDKA 2RGYA 3I76A 4KRXA 3UK7A 4EY3A 1EVZA 3FRIA 1D2AA 1W88B 4PGFA 4Z0TA 1KQNA 3RVNA 5LB2A 1YBMA 2J08A 2HA4A 2WG1A 5DBEX 3TRJA 4F7DA 1A4UA 1K86A 3MXOA 2FWBA 3AG5A 2XTNA 4ZMSA 2HMYB 2E4YA 1P8AA 1VA4A 1QAMA 2ODPA 4I3FA 1H5NA 1S1CA 1I5EA 2ICAA 2V97A 3NWJA 2JAQA 3S1SA 3DDUA 3HR8A 1IOWA 2PZLA 4HZIA 1I30A 1XMQB 3AIIA 2DWOA 1E5TA 1CWUA 4PBSA 3X1MA 4OATA 3P0EA 2PT9A 1PR3A 1Z17A 1E6CA 3L9XA 2QM0A 2II6A 3IPAA 3M6WA 4GKAA 4XPZA 4HPXB 2H11A 1M75A 2P5SA 3CLVA 4JFAA 2ZPAA 3WKBA 4B6JA 4GYJA 4B83A 3SYTA 3VR5D 1KGDA 3KEQA 1HK7A 3MBOA 4E2FA 3DHYA 2FSFA 4N4AA 4CCSA 5M2QA 3N86A 4FT2A 2C94A 5FI3A 4AYXA 1FTGA 1CERA 4JJ6A 2G6TA 3QPAA 4CI0B 3UCFA 1SQFA 3W7AA 2B5OA 1DG1G 2X76A 4MB2A 4Q4JA 3WQBA 5LZ4A 2OAQ1 1VGQA 2GXQA 2FEKA 2R62A 3ABRB 5DGXA 1EGHA 2QIPA 2WJIA 4DREA 5T3YA 3I2KA 3OE1A 3DUFA 4G2NA 4MV4A 3M1YA 5JTUA 1HKUA 3VTAA 4PO8A 2EFHB 4UQLA 3EVAA 1X92A 2QVCA 3L1HA 1RAGA 3KBOA 3PGVA 3IEVA 4AKIA 1R0CA 5FTKA 2FPWA 2HA3A 1YHYA 3F96A 4OL0A 4RORA 5EE5B 5BV1A 4WBNB 3MUEA 1IMJA 1P1KA 1QNFA 1XVIA 2M1ZA 4RLSA 3NHAA 2HJ9A 2C7VA 2OA0A 3PFFA 4JELA 1W93A 1M1XB 4PPNA 4CQLA 4CIVA 2FGKA 3GBVA 4IVPA 1Q17A 2Y76A 3ZZUA 5A0VA 1RYNA 3SD7A 1I01A 1QE0A 1XZJA 2XZPA 1UBKS 2BVNA 4FD3A 5DI9A 5DYYA 4DNPA 4WGFA 3K0SA 1ZESA 4NS4A 4YXWA 1UMDA 4TGLA 2MYNA 3W3ZB 4AY4A 4PFKA 1V4VA 3TTSA 3CVXA 1Q22A 2QKYA 4LMAA 2I7DA 2LZ0A 4DSTA 4B7ZA 1XEWX 2XDWA 1E1DA 4JEHA 4UE6A 1SVUA 1YT5A 3DAPA 1GGMA 4UVDA 4URWR 1CS0B 3DD5A 2OXTA 1J9EA 1BXGB 3HXLA 1Z6ZA 2G5CA 3P2IA 5FI1B 4LXIA 5ILQA 3SF0A 4N5LA 4KSCA 4MQFA 5DYWA 3KB2A 1D2CA 1OU0A 1YQQA 4FZJA 4L72A 1QQ6A 4MYHA 3B9PA 3GAFA 1MV8A 4HQFA 3LHFA 1H2RS 3A04A 3KT3A 2HY7A 4V0MA 5FHRA 4D0NA 4YRKA 5LZ9A 3K9LA 1NJ8A 1NONA 4R2IA 3RTCA 5FORA 1F6DA 2AFIB 3L43A 4LJRA 2ZE5A 1G20E 4O8CA 3IILA 5E9WA 1PYGA 4TWJA 3HCAA 5JJ5A 2OYCA 1OT3A 3DDCA 2LBPA 1O0SA 3EZ7A 4ID9A 2WUFA 2BHRA 1W19A 4K9MA 3OIWA 1Y7TA 5DM0A 3EEOA 3T6KA 1YS7A 1YO6A 4A5OA 1ZGZA 3G9QA 5G3ZA 1KR2A 3V7UA 2E1PA 3HZHA 1EBBA 1WXIA 5EHQA 4WOCA 5COAA 5EXXA 4EB6B 1PT6A 4ADSG 4E5UA 5FWNA 3D6NB 2YN2A 1HEIA 1P7PA 2I3DA 1YJXA 2WT9A 4AG3A 1GRQA 1SQSA 2FW9A 4DZZA 4MYUA 5K0CA 2I2AA 3L0CA 3WGQA 1JHDA 1TJPB 3W9UA 1TM4E 1D8TA 4FT4A 1P77A 4NMWA 4C14A 1JEQA 2WIJA 1EQ2A 1F3LA 1Q57A 2V58A 2G06A 3B82A 1CEEA 3GLFB 3ILYA 1PFWA 2QE7A 3QVLA 4K6GA 1JJVA 4DSZA 1P9LA 5FOVA 3AF4A 1L9KA 1MVNA 1YQ9A 1W73A 2F9LA 5AK4A 4Z3KA 2AZMA 5BV2P 2H0RA 2M6SA 1Y1LA 1ZD4A 1AU9A 1NAHA 2AOTB 5AK5A 2R9VA 2KBEA 5ESDA 5JAQA 1PEAA 3WHIA 5LPNA 3IJRA 1MH1A 4RM3A 3L7LA 4GWLA 2NSHA 1U0TA 1KNQA 3ZDRA 4HP8A 3I5MA 1PG2A 2D5LA 3LLUA 2NUBA 4LNAA 4YRMA 1W88A 1BFUA 4FGSA 5IU6A 5JFOA 3K8YA 2OORC 1TJNA 3FWPA 4GLLA 3WRWA 1USWA 1JQAA 1DAGA 1ZK0A 4HQOA 1FFSA 4WLVA 2PS3A 2RAFA 4U0KA 4JKYA 5H9WA 1NLYA 1SMKA 3ADPA 3VI3B 5CB6A 1CZKA 1CUEA 2AFHB 1PQWA 4RF2A 1SCDA 3PTLA 5JR3A 3VKFA 4J94A 1KSJA 1NTOA 3CX4A 1TUIA 3BJRA 1VL6A 4WFQA 2YRWA 2QJTA 1YA6A 1V9SA 3PXEA 2ODBA 4GRAA 4LECA 4W1PA 4U9UA 1X70A 2Q5IA 1LW7A 2J5KA 1J1IA 3UK2A 3BAZA 2W9XA 1GGFA 5C5DA 3JAMA 2JFPA 3X1JA 3BMOB 2PYZA 3D6FA 3ICVA 4PCUA 3N3AC 4RGYA 3C3YA 4EZIA 3B3FA 5G1OA 2QX4A 3VSDA 5KNCA 2WVAA 3AUTA 3CCBA 3RRMA 3TMYA 4KAXA 1N5LA 1N0HA 2ODWA 3UAXA 1PR2A 1V2GA 1DEHA 2WG2A 1YA8A 3V2IA 1FFYA 2A3NA 2FPKA 3LZDA 3LBYA 4QBTA 3ZD6A 1X6VA 2Y93A 4JKOA 2NZ8A 2GZHA 1WW3A 3TSCA 5L4NA 4MI1A 2NPIA 1VSUA 3DQQA 2VQEB 1K75A 4MARA 1BRMA 4JUCA 2WWXA 3ENKA 4EVQA 2L19A 5E1DA 1M1YE 3HWWA 1JVNA 5DEIA 3TYXA 1M34B 1Z4PX 1Z0DA 1A4IA 5JYBA 2IU4A 4O3MA 3DAYA 2JIZA 4GC5A 4IH1A 4W6ZA 2R96A 2Y05A 4RK5A 1NL3A 5F1YA 2NWQA 2VF5X 1J7KA 1JHUA 3CPJB 4QUDA 4XJXA 4A0HA 2Q62A 1E2LA 3MJSA 4NOLA 4B40A 3U3MA 2CVQA 5B3JC 2WUVA 1E9SA 1U1EA 5KVQA 1JH8A 5KQGA 5AUNB 1Q74A 4K9OA 1JKMA 5IZCA 3EWAA 1OCEA 5DB4A 3ONDA 2FPRA 2ZTHA 2B92A 3UOGA 2VHVA 4R1QA 3M4JA 3R3HA 3C87A 3HKDB 1T0BA 4S1PA 2R60A 4E15A 4EAAA 1LLDA 1QO0A 1SBZA 3JR3A 1XR3A 3NWPA 3QFSA 1CS0A 1NZJA 2FWRA 4FDTA 1BXGA 4JI5B 1PHPA 4Q7JB 1NXSA 4LY0A 1C0EA 5DLYA 4UD6A 2PSHA 3T3EA 3ZVLA 3MFQA 4YRZA 5BVGB 3V8EA 4AJ9A 1ESEA 1GZVA 1UJ5A 4GGMX 1PR1A 2B3DA 4PCAA 1A04A 2JH9A 4BKMA 3MGCA 1O3YA 3U17A 5DNYB 2X0JA 2Z57A 3H1PA 4Z4GA 3T7CA 5CT4A 1QHEA 1Z2PX 4RJLA 5D8DA 2CVOA 1O6ZA 4NARA 4BP8A 4GE3A 2E3JA 4OGWA 1LTKA 1C50A 3E1SA 1MJHA 2AH5A 5HF8A 1H66A 1TK2A 4IAOA 1ODJA 1K3FA 3WL5A 2RHJA 4MX8A 4OHXA 4QRIA 1ORDA 2CNWA 2ZI4A 5H68A 5KSZA 4XIJA 1NDQA 3BB1A 3JYHA 5LU8A 2JAUA 2FPMA 2I78A 5I7EA 2HQOA 4H31A 2G04A 5EL0A 4QIHA 5EKXA 3RI3A 4F4DA 5HFAA 3VJRA 2FF7A 1A8HA 1TECE 3GDOA 3OT1B 3PXXA 4TRMA 1UPAA 2DPHA 4QNNA 3L1UA 1SUWA 1C1YA 2VDVE 2ZRAA 4EI2A 5JS1A 2AWOA 3PG5A 3TKLA 3C3AA 4EB6A 2PGJA 3NFYA 1LPAB 3WLKX 4U7PB 3UXHA 5I3CA 3VZSA 2AW3A 4RDXA 3DE5X 2C5HA 1EXVA 1CUBA 4AP5A 2JI7A 3LP8A 4ROSA 2IEYA 4KE6A 4L85A 5HQJA 2WHRA 2FW0A 2QP4A 1RLIA 2MOKA 2HA6A 4MVJH 3VOBA 1WF6A 2GILA 3D7MA 1LRLA 2QP9X 3LBIA 1T6YA 5CU7A 3SYLA 3C14C 1WW2A 5THXA 4BFCA 3H9GA 1LSOA 3PXCX 5EJFA 4JI6B 3GLFA 1NA5A 3TL3A 1LFDB 4P0QB 1PCXA 1I7NA 1N2JA 3NHBA 3SVZA 1T9CA 3UA4A 4EGJA 1OLUA 3VH1A 1MEJA 4LJYA 1BHJA 1POXA 1SOMA 2AOTA 1KZ7B 3P27A 5DLEA 1YONA 4JR1A 3AL2A 2J3LA 4CYMA 3RVPA 2TS1A 1WX1A 1XLTA 2XCOA 3CX6A 3P0IA 4IIFA 3QA9A 3GVCA 3NWOA 3IOYA 2Z56A 2GZ1A 3GDFA 2JLZA 5J40A 1F0NA 3PDWA 5ALNA 4H08A 5CYPA 2VNJA 1IM8A 4US0R 4WBNF 3I09A 4B6GA 3UHAA 4HBGA 3EC1A 3PICA 5ALIA 4BYGA 4EJSB 1BE0A 1NYTA 1QWSA 1SKAA 2OHXA 3QKIA 4J3JA 4OJTA 1ZMOA 4N48A 2DKFA 2ZVJA 3D54D 3QOWA 1KJWA 4L6AA 2AFHA 2EQBA 4MNTA 5G0TA 3V1LA 4C5CA 5JV5A 5IP5A 1IUNA 2IBTA 1M2KA 3QOXA 3B5EA 4W5NA 3AOGA 4C5BA 3OUTA 4V02A 2IDMA 1P1FA 4FOTA 3GJXC 1AS2A 2I80A 5LB4A 5JAOA 2FB9A 4KFUA 3SX4A 3PGJA 4KAFA 2GBCA 4TMWA 4CG1A 2OZLB 1DUIA 1M66A 3O1IC 5F64A 3R41A 1RRCA 4OQQA 4K88A 2BD0A 3DFIA 3CHYA 3QK7A 4EGAA 1O7JA 2X9QA 2HU8A 5E38A 1GPWB 4YMIA 3EX7C 1R64A 2HMSA 1J23A 3CKLA 1KK2A 4YBRA 5AYVA 4F5YA 3ZLUA 4CLDA 1Q0UA 1I4LD 1XRJA 1ODCA 3NRCA 1AZSC 3LCUA 5LQUA 5FBWB 1PQUA 4B3HA 2FDRA 2VZ9A 1ZIYA 5CDTA 3GGPA 5KWSA 2WZDA 3BEOA 3QLTA 2DFVA 4D46A 3IJPA 4XQGA 1UBFA 1XC7A 2IHJA 5JNLA 1UOPA 3GYBA 3NYRA 1P7VA 3R7NA 4IDCA 1MJNA 3MCWA 5L7WA 1GKYA 3ZHZA 4OMUA 1P17A 4WA8A 4D0LB 4EYOA 1FNCA 3I58A 1QF9A 4LHZA 5JS2A 4TLLB 3UWKA 4ZO4A 3WNZA 2QD2A 3FTDA 4PC2A 5BNZA 3DVAB 2JFXA 2DFNA 4YP7A 2C5FA 4R9SA 5H02A 1C9EA 3KKPA 1Y9DA 1G9XA 1YOVB 4EY4A 1QFSA 4GM4A 1Y8ZA 1NXOA 2YVAA 1RPNA 2OB2A 3FSGA 2I22A 2B2XA 1XEXB 2XJ9A 5DTRA 4UMDA 4ZZ1A 1NUSA 2FN3A 1Z5WA 3HKDA 3W5DA 1ZU5A 2P3SA 4OLFA 3PIRA 4KPEC 2H4HA 3GWGA 5HZMA 1J8VA 4B17A 2NO6A 1N9KA 2QM7A 1NURA 2XHZA 5C8YB 4PTZA 1XRMA 5TLSA 2P9QA 2C9ZA 2WWRA 2I7CA 3YASA 5B6JA 4DPKA 3OAAD 1ZRMA 4YAIA 3OZEA 4HEHA 1Q92A 3PC6A 1JLLB 3MS7A 4U2BA 2ZBFA 5LMUB 1V8ZA 1N0WA 2BJHA 3PFBA 1RXYA 2PFKA 4JEMA 10MHA 1G7RA 1XTPA 3BS4A 2HNBA 1NF3A 4NBLA 3V2UA 4PYJA 2DECA 3CJTA 5KNBD 2X15A 3HTXA 3RVMA 4QQ8A 2EOAA 2CB0A 5D2CA 2O8BB 3HCPA 1L4UA 5CB4B 4MW2A 4L15A 2A88A 2J5XA 3EMBA 4FHFA 3WAJA 2WRZA 5TPWB 3TUJC 2JB9A 4P31A 3FTQA 1EAMA 4TLDA 2AKYA 3PQCA 1KP3A 4IDHA 3A6HA 3UJ7A 4JL5A 5KHAA 1GYRA 4B7AA 1XK7A 1UIRA 2N42A 1FRNA 2ZAOA 4DLVA 2VF8A 1H2ZA 3OT1A 4PO9A 5H8WA 1H23A 4BVLA 3E7XA 1COZA 1HSOA 4HDAA 4A1OA 3CKYA 1AGNA 4IJMA 3ZHVA 1JGTA 2XWSA 3OKPA 3RVKA 2VPYA 1R10A 4RFSB 4CVNA 2L2QA 3VR5A 3A27A 4I08A 4BO1A 4A27A 3PWSA 1IC6A 4EFKA 3A6ZA 1U8EA 3LVRE 3CQ9A 1O0CA 2BY4A 4ETIA 1T5SA 2OSVA 3ZYCA 4XD7D 2IRWA 1ST3A 4EH1A 1HT1E 2XOXA 1TQHA 3D81A 5F5LA 4F9FA 4ZHQB 1UZLA 1A98A 1R74A 1EFHA 2J09A 3B2EA 3BCSA 1UT6A 5B58T 3CVWA 2D2EA 1EA7A 3MTJA 1U2GA 2OECA 4FC7A 3D6MA 3UXEA 2C4UA 1UZUA 2RB4A 1EFTA 4QM7A 1U2RA 5AKIA 4UM5A 2AXNA 2QXTA 2VQFB 1K6MA 2OCDA 2OXCA 2VDKB 4DDVA 4QFDA 1DTEA 3I8OA 3LUBA 5K8VA 4YHHB 4G5YA 3QEMB 1QQTA 4QDTA 1M33A 4DJ5X 5K99A 4D25A 3B9RA 4JCCA 5F9HA 2QT0A 2Z2XA 4OTZA 4RPGA 2KLHA 2A78A 2OCPA 3ROGA 2VJYA 4DMUB 2O3JA 4GOMD 3BRSA 4Z86A 4AJOA 4O33A 3TI7A 2CXUA 4UVGA 2W42A 4NBRA 1X9GA 2JLAA 2NV2B 3NGMA 4EJSA 2OHHA 4BFXA 4N3AA 2VP9A 2C5SA 1R16A 4A16A 1VP3A 4GPTA 3OLYA 2EQAA 2Q3HA 4BAZA 3O9MA 2XNDD 3D7KA 4I50B 4OQZA 1GPNA 4MCJA 4O1MA 4EECA 4GGOA 5M29A 1GRNA 1EHYA 1OQAA 3NOOA 2V0CA 3AYXB 2CSUA 2EG5A 5C37A 2XGJA 3OQ6A 4PAGA 2QLTA 1BDJA 2O50A 3K5HA 1IQUA 1OWOA 2E5WA 2FZKA 3PGMA 9ATCA 3RS3A 3FPCA 4RNDB 3K2QA 1W9HA 4K0RA 1E2FA 2X40A 2AR0A 3IKJA 4HTAA 4LYEA 1TTQB 1RTKA 2HTEA 3NTUA 3Q3GE 3MT9A 3DZ8A 1F60A 2J32A 3MMSA 2JNWA 4C0LA 1NRIA 2WJYA 3UF0A 2OK7A 3LKVA 3LNCA 4MWDA 2I29A 1MO2A 1WSBA 1XTSA 2XUIA 3A6FA 4KOAA 4OBBA 4R16A 5FDFA 3BICA 2CVFA 3HBNA 3FBTA 3JQBC 3UMCA 4LSMA 2HRBA 2WPNA 4PHFA 3FCSB 3BKWA 1FP4A 1HETA 4ZO8A 4EG1A 3U61B 4OIFA 4M0LA 3WGGA 2EGGA 2HYIC 1IY2A 3G0HA 2NAFA 1JHXA 4QHYA 3PV0A 4ZQIA 5JPIA 4UMVA 2UZ1B 3WWDA 3NIWA 3X2FA 3LX8A 2OYSA 2OHVA 1B2LA 3ORHA 1QQ5A 3NEYA 2GAAA 1KY3A 1YRBA 1PSWA 3DVAA 2J9YB 1ESMA 4XYGA 2DXIA 1E0DA 4OJYA 3V8RA 5DVZA 1IMOA 1JZQA 1QFXA 1TF5A 3L0DA 1TVMA 1YOVA 4QO7A 3FPLA 4CM7A 3SMQA 2VHUA 4DY4A 4EG8A 4RZSA 2X0DA 1R1DA 1XEXA 2QTAA 3OCZA 1GKKA 3V2HA 3WTCA 1WUHS 3TBFA 1TEHA 3PQ5A 3ZJYA 3ZY6A 1DBRA 1QTRA 5ISMA 1IN4A 5C8YA 1KZYC 1FS6A 4ND2A 2C5AA 5EUBA 5HF9A 3ZS9A 4QM6A 3U7JA 2ZANA 2YFYA 3AESB 2RDMA 1QB8A 1IHPA 4DA6A 4JJAA 4I99A 4V1CB 3LFUA 2ZRGA 1IU9A 3IOBA 1NASA 2QSUA 2QMHA 3CF0A 2FPPB 3OQNA 5CLLA 5CDFA 2ANBA 2QDKA 4YRTA 3LF2A 2D1SA 4L3VA 4PM4A 3TDNA 3ZWPA 5I4KA 4BWVA 4CF7A 2O8BA 1W1IA 2FG6C 2RFLA 4P4UA 5CB4A 1DO0A 5BVHB 2QI9C 3H99A 5T6MA 4YJ2A 4Y6PA 3O3CA 2AR9A 2GN1A 3CZ4A 5CRIA 2D00A 4OQPA 4YCBA 3ZC3A 1ABBA 2J48A 2Y1XA 4CMIB 1DAPA 2QTZA 1H9AA 2Q9BA 1V5IA 1N8TA 1A0OA 4YV0A 5F2KA 1T5TA 2DP4E 1ENYA 4K87A 2CFRA 1WNFA 3CV3A 1BKDR 3GG9A 3JX9A 4KJZA 1K2WA 4QUBA 2PJRA 3TNFA 8GPBA 3IAS1 2VYVD 1LBEA 2B34A 3MJ4A 4I9NA 1NXVA 4KGVA 3I72A 1ZJWA 1I2CA 2V65A 4I2VA 2HCJB 2XT6A 4ATNA 4IGIA 4YCLA 2YWXA 2NVOA 4Z7QB 3TL6A 1CJUC 1AHNA 3GT7A 4BB9A 1COWD 1KJNA 2A5YB 1M8GA 1YRAA 1CXZA 2GCIA 2OV3A 1C7JA 3VJMA 3WBJA 3DE6X 3VA7A 1FFHA 2GB4A 3KZVA 2J6BA 4X6UA 4CMBA 1IN8A 4MIEA 4DV4B 3AR6A 1H69A 2A8YA 1FCJA 3ESQA 1TQ4A 2HMTA 3L79A 4QZVA 2R1UA 4HVAA 3MLBA 2LXNA 1P39A 1M6HA 2C2WA 1E3DA 2VJMB 2XF2A 4G0YA 3WR5A 8ADHA 1TVCA 2R65A 3Q1KA 3SFZA 5CT5A 5AKEA 2PGXA 3JQFC 7MHTA 4DCPA 4DNQA 4Q4AB 3UYLA 5B3KA 3PR1A 3QEMA 3VO8A 2WTNA 4HWSA 3TRIA 4RD6A 5K8TA 2QNBA 2W4QA 2RHBA 2VJBA 2W7TA 5BXQC 5ADVA 3PNVA 1LS6A 2J9RA 5D84A 5HJ2A 4Y0NA 4ZGBA 3KOOA 4BV8A 4KLRA 3H7IA 3REQB 4QLOA 4B76A 1FTWA 5TGDA 3IP8A 1UFQA 2FRDC 4N5NA 1VBNA 4OU5A 3R7BA 1JG7A 4CM6A 2F55A 1F9EA 1HC7A 3WMGA 4RSHA 4BIIA 4H7FA 4ZYUA 5DZSA 2V4MA 1GPAA 1XCMA 3I37X 3S44A 2ZZMA 3LE8A 5CG1A 4I50A 1YBVA 5JH7F 3QKSB 4IIGA 5IMSA 1C7FA 2HIAA 1BMDA 2W83A 4TTJA 3RSQA 1MAAA 4HZUB 4EZEA 1KOGA 2GNOA 1DRJA 1P0FA 4OREX 3ROPA 1SUAA 4KFSA 4MKHA 4PTLA 5IKMA 2Q4DA 1L3CA 2IE0A 2YRFA 2DT8A 3GJ7A 3KXIA 4DWWA 2DUMA 3AJDA 1VIYA 4E5VA 4B3RB 1G9TA 1VIMA 1ODIA 4K1LA 3T0FA 4CM9D 3AJ8A 4FCTA 3LVQE 1SWVA 3ABSB 3GFOA 3FX2A 2HSGA 2GYWA 4FDAA 3JRNA 5EIFA 3E6AA 3H2GA 1VYTA 2I62A 4MJLA 4R54A 5LBIA 3RSFA 4D3YA 3KWJA 4FYWA 2KBFA 3H4TA 1MOSA 2GARA 2YYZA 1WXWA 5JD3A 3SS7X 4B74A 8AT1A 1C4KA 2H2FA 4IEIA 4JJGA 5KKCA 4WADA 1UEXC 3WZ2A 1JLMA 4H17A 2QUKA 3BORA 5C8VA 3QX3A 4G0UA 4O2AB 4ZCLA 3OJOA 3PWTA 1DQNA 3PA8A 1FYXA 3NTVA 2Q7OE 1JDBB 3GEGA 4Y6LA 3UC9A 1E3MA 1UJBA 2AB0A 3WSVA 1PR5A 1TTPB 3F9RA 1FBNA 3LUKA 3NATA 1RXIA 4EKDA 1TJ5A 4C88A 2GPNA 2NO7A 3MELA 4FQ7A 4G5OA 4JLWA 3QEAZ 3IIKA 4DDHA 1QDEA 4CMHA 3QEKA 3I04A 4FE3A 3KYIB 3F71A 4QEKA 4TVKA 4ZICA 1XJ5A 3KLBA 4I9GA 3QKWA 4MEAA 1RWVA 5JDCA 4G0QA 1VMKA 1GQYA 4K40A 1ZITA 1TXGA 3MMXA 1E61A 3EIOA 3AESA 3GNSA 4QU0A 5I9MA 4JBIA 2H1WA 2FFBA 2FWJA 4KN9S 4F2GA 4ZHQF 4V1CA 5LOVB 1I33A 1K5PA 1P7ZA 3BL8A 3L77A 3ZUPA 1U8XX 2FPPA 4HDRB 2NMVA 3THSA 3THRA 3L1IA 5B3JA 4KIUA 4E5YA 2QRKA 2V7TA 3EVCA 4OKSA 4TN5A 2XYHA 3ZVMA 1P4AA 1IUKA 1QHSA 2AKEA 2Q3BA 5BVHA 1Y0BA 4B1FA 4XWTA 5HOQA 3ZHBA 5IZ4A 4DJAA 1EFAA 4CQNA 2E4WA 4P58A 3G9TA 1MG5A 3CVJA 1XELA 4QDOA 1MX5A 4ZQGA 1SPXA 4ESVA 4CMIA 2H85A 4OXQA 2JATA 1N7GA 3G0GA 5DHPA 3NKFA 4UFPA 4DLPA 3TDKA 1I4DD 7AT1A 1W48A 3G5AA 4OLHA 1R8SA 1LPOA 2XQJA 3SQWA 3T3OA 2I3AA 4O4LA 1JJFA 3DD1A 2F67A 1YZYA 2ZAYA 3Q2OA 4D02A 4OPMA 1YS1X 2AMJA 1EVIA 1LDNA 3SNKA 2IYVA 2ZVDA 4I50F 3UTCA 3VSBA 3PDIB 3ETNA 2Q99A 2DPXA 2EWWA 1BGVA 3LQKA 3M7IA 3LM8A 1JSLA 1FLVA 3IURA 4DV0B 3R0VA 1N2CB 2IPNA 1CB7A 3QX9A 4PFQA 1AMOA 3PCRB 3KOZA 2E82A 4QGFA 4AIIA 4YRLA 1XD2B 1GGKA 4W5HA 3B36A 4J0KA 4JT9A 2BM0A 4UTRA 2DR3A 3WYCA 1VMAA 2YNMA 4EWLA 3HN7A 2XYVA 3WYEA 2D7DA 1X1CA 3HGMA 2VJMA 2YVQA 2QM8A 3B1YA 3VYSB 1ISFA 2XJ4A 3A1CA 1YJ8A 5BPFA 4HFJA 2LIPA 2CFSA 3DL2A 3OECA 4RMGA 3T3GA 3G59A 3GP3A 4BB0A 3C97A 4DCMA 3LYHA 3EGDA 2BHSA 5KJCA 4I6EA 2QE6A 2JLQA 3ODPA 2WP0A 3LPLA 3PC4A 3GRRA 3QFHA 3ZS8A 1ZJ6A 1JDTA 1KYWA 1TIKA 3H97A 5AW4A 1IOVA 1B93A 1YF3A 4WW0A 3AM1A 2AQHA 1MVLA 1QE5A 3LKZA 4J75A 3GLTA 5AJUA 5IAGA 1B3RA 1Z0IA 3K1TA 4MWOA 4XVCA 3CW9A 2ATIA 1OXVA 1KY2A 3H19A 2GEUA 4ZARA 5HFJA 3ZHRA 3U3JA 4OQNA 4EUKA 4YV7A 1DL5A 4M1SA 2OCLA 3EZXA 1Q1EA 2NW6A 3H1TA 1XTBA 2XE7A 5EKUA 3QKSA 2QD1A 3TEFA 1TT5B 3HL4A 2VBFA 3CNHA 3A4MA 3D1JA 1WLSA 3FPEA 5G4LA 3CJQA 3I01A 3MQFA 4HZUA 4AMVA 3OAAA 3CC8A 3RVLA 1Z82A 1U8YA 2D0OB 1V35A 1RQLA 3PD1A 3QRWA 2GEBA 4OA8A 4WLFA 4BP9A 5IJWA 5L4LA 4CKEA 4F5DA 1Z56C 4LOKA 3PQ4A 1FFGA 4A23A 1PD0A 3R44A 1OAAA 3NCTA 1BXRB 4JLKA 4E22A 3HEBA 4B3JA 5KNBA 4E4RA 1KMNA 4G36A 2ZRKA 1JV2B 5LNK6 4K46A 4OP2A 1T24A 4NJOA 1FUIA 1TQ8A 2J5RA 1XWWA 2Q8NA 4QJ5A 2CEKA 4UVIA 2NNWB 4II3A 4EF6A 2ZB4A 4RL6A 2IYXA 1RC1A 3F7NA 1S8OA 1GPBA 2GYUA 2YC4C 3D8NA 3HLTA 1PUXA 4KYVA 4O2AA 4TROA 4EGQA 4CNBA 4TYWA 2PFSA 3JD4A 4HGNA 3CF6R 1YHNA 3AIOA 1G6KA 3CR8A 4LHVA 4KU4A 1XCPA 4HMPA 4RZ3A 3VJLA 1OZ0A 4BKQA 121PA 1SQGA 2AFIE 2Q3LA 4QAJA 4QGBA 5PGMA 5BWLA 2IYAA 3OJXA 4G37A 4HUJA 3ZHOA 2QRPA 2V3CC 3UNXA 3D6HA 2P5UA 2R6CA 4CEHB 2PZEA 4TXLA 4E0BA 5CFQA 2H1IA 2CNNA 3KK0A 1MB2A 2ZUSA 2NPFA 4XD7A 2J33A 2MMCA 1IG0A 5KNDH 4LY9A 2G80A 3WRVA 1LWOA 1E2BA 4QBFA 3QPCA 4B32A 4CFYA 4FLFA 1S89A 5HSGA 2QTRA 1FNMA 3KUCA 4QQFA 2ZYAA 4MRNA 3CF4G 4EUSA 5LOVA 2YIVX 5JS8A 4I55B 1TVKB 1CVRA 1CR1A 2CHUA 1T8RA 3HBMA 4HDRA 1DIGA 3G0OA 4Q02A 1KY4A 4KQHA 5ALYA 4BCCA 3Q3CA 4XWWA 2XQVA 4JI3B 5A4JA 1C9KA 2C20A 5CJPA 3VU0A 1VPWA 1BXKA 3KAQA 2PEYA 3LHSA 4L08A 4G65A 3MRXA 1QQ7A 1HXHA 1SVMA 3BBLA 3FVTA 4HVCA 5HZGA 5GV8A 3ZK7A 4IW3B 3SFVA 1DAOA 1PO7A 3P96A 4J1NA 3DMTC 1T13A 1X86B 5ALTA 5C81A 4P3OA 4PNHA 4MR8B 4HGRA 4BEJA 1UMBB 1MP0A 3LAWA 2DLCX 5I4IA 2BFFB 2FP3A 1LXCA 5EJ6A 2XNDA 3O31A 4W8HA 1EBFA 3C3XA 3L4EA 2RG1A 2GF9A 1TZBA 4J49A 4YJGB 3SBEA 3HSYA 1C8BA 1DQPA 3KLNA 3M4ZA 2YS6A 4UUPA 1MRZA 2D62A 3RM3A 4ZK2A 1MA0A 3PDIA 1Q2UA 2ZIXB 4NBTA 4UEKA 1UDWA 2AKAB 3WGLA 4F86A 2NYVA 1J22A 4M9CA 1T2UA 4EW3A 2IV7A 5HRAA 1RXVA 3OOWA 2CNKA 4L5BA 1N2CA 4MAMA 3PL5A 4ZZIA 5HNKA 1FFDA 2I66A 2QJRA 1OBFO 1MB3A 4KW7A 2XYPA 1TYEB 1V1MA 3LL7A 3NVKI 1NP7A 3Q4GA 1L1RA 4LZWA 4OMCA 5IVIA 2AZTA 3TK1A 2ZVQX 3R6GA 2UAGA 4JLSA 2QV7A 5T67A 2FX3A 3OTIA 1H2AS 5DYGA 1PJRA 3IA7A 2Z6AA 3E5NA 3QNMA 5EPUA 1C29B 2XVYA 1I3KA 2YBDA 3A26A 1ZUIA 3FCUB 2UZ3A 3K05A 1KTVA 1VKZA 3WLSA 4QFBA 5LM3A 5AD1A 1JHRA 2QWXA 2Z2ZA 4QPJC 1WPGA 4ARCA 1B43A 3T7AA 3G2KA 3IAS6 2AMFA 3AP3A 3RNLA 4U6SA 3TNLA 3HVKA 4KB5A 3CGGA 4JCOA 1OAKA 1C14A 4YJFB 4JXXA 2GD0A 3Q9SA 1YNSA 1LZKA 2IYSA 2P35A 2V8BA 4I14A 1GQQA 3OCXA 4KO2S 4FS3A 4YR7A 4LSWA 3O8NA 5DNUA 1YOBA 4FQ8A 1WEHA 4UOZA 2X7HA 3CN7A 1U8UA 3I9OA 4U7WA 1Z15A 1M34E 4U0JA 2B8JA 5DW0A 1BWQA 3G2NA 3K7EA 5FH9A 2ZE6A 2QUAA 5BSWA 1G7SA 2A5DA 3FYHA 3QHQA 2IOYA 1GFWA 3G8YA 3D6UA 4PN3A 1T5IA 1UR5A 2C77A 5CCEA 5MGNA 3BBPA 3JQEA 1BXRA 3WNBA 4AT1A 1QMGA 4J43A 2ZZNA 4TTQA 5CBPB 1SBIA 2OUIA 3PA6A 4H2DA 4BDTA 2TMKA 4D97A 4RTNA 4JL8A 1A2BA 4YCAA 2AGVA 1O08A 1Z22A 2GCGA 5U1PA 5LP6F 1J8FA 5C5EA 2ZB3A 3ECAA 2CC2A 1H1LB 1HOXA 3CT6A 4LXXA 4JQOA 4UULA 1OIXA 5E2AA 3EIQA 1WB6A 3RRYA 4J6FA 2Q2NA 2OKGA 1VLJA 3BL6A 5IG2A 2VEOA 1Z7WA 1UEJA 1CRWG 1DDGA 2Z6QA 1KO4A 3ZU4A 1W1WA 2QRLA 3ADBA 1R6DA 2VYVA 4RVGA 4WPGA 1CUCA 2DT5A 3C3KA 5DNCA 2GM5A 2YJ3A 3LHDA 1NN3A 3T3HA 4YRBA 5MN6A 5CFOA 3P9QA 4L6IA 2CJXA 5JADA 3IQFA 1COWA 1EAYA 3CTMA 1XMPA 3KRTA 1XF1A 2QB5A 4G0ZA 4H3KB 4CEHA 3CW2A 3FBWA 3F4LA 3VKWA 3OMXA 2XMRA 1FJ2A 3EEYA 2CZCA 4HWRA 4BEWA 5BRAA 1XL0A 3H86A 4OLJA 3ZZNA 5A9SA 4WKGA 4MV0A 5B1EA 2AMLA 1TEZA 1G60A 5DBHX 5FKJA 2WFZA 4ZI3A 1ONSA 3RT1A 2C3MA 1ZVQA 4B4OA 2QX9A 4Q34A 2HB6A 4KBYA 1U31A 3PEWA 4I55A 1TVKA 3H13A 3VR2D 4EEXA 2R84A 1CQZA 3S2ZA 5LIRA 1ISSA 4LUCA 4YN3A 4K6CA 4RTOA 1PJSA 2WMDA 3DXXA 1PF7E 1QS0B 2XMBA 2BDTA 4ZI5A 4DUYB 4BFLA 3IERA 5EXDA 4BTLA 1AX9A 2ZBPA 4YLGA 1R6VA 5C80A 4KQCA 1SVKA 2HADA 3KQVA 3SDBA 5JDIA 4EHAA 5KQSA 2BE9A 5FIUA 3GJQA 5ARDA 5ALSA 3IKTA 5CNKA 1SXIA 3IV9A 4MR8A 5FQNA 5AOAA 4G23A 3SC2A 4QASA 4DJEC 2QLLA 1NVUQ 3D0KA 3TSYA 4L4RA 2H08A 4G25A 5IFLA 1G38A 1T4GA 2YJ4A 2IEIA 4YJGA 3BA6A 2EW1A 5LQCA 1JBQA 1GQRA 2WOJA 3H1GA 3K9BA 5A71A 3UENA 1HX7A 1AMNA 5KU1A 2FMUA 1S0UA 5G0SA 1ESZA 4BFWA 5BQFA 4DWJA 2EGUA 2ZIXA 2HSZA 4C0XA 4LBYA 3NB0A 4KUGA 3DEAA 4GI1A 4OSOA 2BMWA 4OP3A 4L3WA 5BN5B 3GPLA 4CM9A 1E3QA 3I9KA 4EITA 5JZMA 3X1KA 3C39A 1JHYA 3HXPA 3GZTB 2AG8A 2ZT8A 2I9PA 1WQ1R 2AI2A 2ZBEA 4ZI7A 2WWFA 1YTUA 2XKJE 3TN7A 1FFEA 2Z08A 1F8YA 2WE7A 4N7BA 3QFTA 3C74A 1KFBB 3O2SB 3WRXA 4A2QA 4HJRA 4YWJA 4E6PA 2QZ4A 3EZNA 3LW7A 5IKOA 1VKHA 1DHTA 4CEJB 5H0IA 1XROA 5HIJA 3M3DA 3VVBA 5B7NA 2WE8A 3WB0A 5F7JA 3P2EA 3H65A 5L3ZA 1FDUA 1T15A 2VKTA 4MGKR 1F14A 3MUOA 4K05A 4CKXA 3CVYA 3P9XA 1P29A 2BGIA 2IU3A 3RUAA 4AF8A 1MRSA 4LN1A 1WIWA 4M0FA 2IY9A 4C89A 4K3VA 5JD4A 1NVWQ 4YJFA 3GLSA 4IDGA 3E58A 1LQTA 4OHUA 1A9XA 4Z4FA 4TKZA 5LMCA 2ZAIA 4PZAA 3I61A 1FDSA 4ENPA 1H3NA 5EKDA 3JQFA 5JVDF 2HSDA 2ZTSA 2F4NA 1KPIA 4S04A 1U63A 4OX9B 5K0NA 1K3TA 3E5MA 3OEHD 1NW3A 3DZFA 3NHLA 4MS1B 3WMRA 4BB5A 4DGQA 4DILA 1H2FA 2HIGA 2NQTA 4ND1A 3U13A 4AO8A 1PTKA 1GWNA 1ZISA 3P4XA 1T3GA 3Q0EA 1O0BA 1E2HA 2ZWMA 3OU2A 4Y2JA 2WVJA 4CUZA 2JLXA 4IKOA 5SV2A 3HA3A 1Y6JA 2CNOA 5DCLA 5CBPA 2CVZA 3IE2A 4WI1A 4IL5A 1ZCFA 2WUWE 4OYLA 5JAPA 2IUEA 1CLUA 4HAIA 1EB9A 1MNAA 5A3QA 1BDHA 1RHMA 1YRYE 4A7PA 4F3NA 1A8PA 2CFTA 3L8FA 1P3DA 1R6UA 1H1LA 1SXJB 4HADA 3H1EA 2XMSA 3EUEA 5K3BA 2FZ4A 4R68A 1NYQA 3WQRA 4LYYA 1UADA 1XRPA 1DT3A 2BFNA 1I7QB 4E30A 1W94A 3DFFA 3MTQA 3N7UA 4XWGA 3HQ4O 4EEKA 3SXPA 1NNLA 4RZUA 2QN6A 3PXGA 3PI6A 4FKBA 2HX1A 4XXHA 1AK9A 3PT5A 4R1PA 4N49A 3LIPA 4PGMA 4OHVA 2VTBB 1OVMA 2FGJA 3ROFA 2HDNB 5A9TA 4DNFA 1IEQA 4Q18A 2A0KA 4MMXB 1BFDA 1Y3CE 2VUIB 3DQPA 3ZHUA 4QPCA 1P8JA 1YRHA 2A9FA 4M60A 4Y9TA 5BW8A 4ZCQA 2O6HA 4J7UA 1OX5A 4BUCA 2JLVA 2Z04A 1CY1A 1AY0A 1DXOA 4LYFA 4BNHA 1E64A 4JT2A 2IOHA 1YFKA 1YMQA 1QIFA 2A92A 4X93A 2ZCUA 4B8YA 5DGIA 2VN8A 3ONWA 4ZAVA 2PD3A 4I4LA 1AXGA 4MKGA 4U8HA 1KSHA 4URYR 1ZGBA 4YFYA 1OH6A 4B48A 2YMQA 2A58A 4QQKA 1IEWA 2PV0A 1FVFA 4QRHA 5C4GB 4O29A 3CF2A 4PX5A 1QS0A 4X7BA 3QXHA 5KAMA 3MK31 1BJKA 1V6CA 2I7VA 2JKYA 5ESWA 1CULC 4EK9A 1SZJG 4EPWA 3IUJA 2YVLA 1ZD3A 1DOHA 3EVTA 4KI0A 3QE2A 3SVTA 2A0UA 2FZEA 3GBSA 3MG9A 3R09A 4CM8A 4U7HA 1QP7A 4AQDA 1CQXA 5KWEA 3KR0A 4RK0A 3I8SA 4U3JB 2DKNA 3AONB 1IXZA 1OXTA 5C7LO 4H59A 2FEOA 2LCQA 1EVYA 1G19A 1D2MA 1WVGA 1SC9A 2OD9A 2WUGA 1F8UA 1NU8A 4XTCS 5EI5A 4BN0A 2OZEA 13PKA 3SC6A 3B1WA 4MRAA 3L6BA 2RD2A 3ZGZA 5L7YA 4NG5A 1W4AA 1VCHA 2O9JA 5BN5A 4QU9A 2WTUA 4H18A 4EY8A 2QOEA 2BGWA 2OFOA 2BGUA 4RF5A 1UT5A 9LDBA 1PS9A 1CUZA 3CLTD 2YJGA 4QD3A 1YVEI 3I4LA 2ADMA 1MO4A 2WF7A 1X8JA 1KI1A 3GP8A 2L17A 3Q40A 5JC1A 1XZHA 4LKOA 1RHQA 3FOAA 1RKQA 2HCTA 3VPXA 2OQIA 1CETA 2RHRA 3MEQA 2KJQA 4AQ7A 1R8QA 3UWMA 3ILSA 1E2DA 1USUA 2FN4A 2BKEA 2Q2WA 1TGYA 4JP2A 1PWZA 1S2LA 1X38A 2ILVA 3IBFA 4D4GA 1XD8A 3BSYA 3SSOA 3C8DA 4DV6B 4XH9B 4UM8B 5IT0A 2QJWA 1VLHA 1QGZA 4HDQB 4HWGA 5E4TA 3CN9A 4FN5A 3HJTA 4EGFA 5C1OA 1E98A 1ZI8A 1JKJB 3VU3A 3WBKA 5KOJB 1PR4A 3FPSA 2GFIA 4GR4A 2EL7A 3V1KA 3BCUA 3KPJA 2QK4A 3PVCA 3Q6NA 1ZJ5A 3WQSB 2GS9A 4XDHA 5BQ5A 2B1JA 2CUNA 1L4KA 3Q9UA 1U8TA 1RPZA 4MB6A 2WPDD 1IAVA 2O4UX 1TRKA 4GLFA 3HG7A 3II6X 4CEIB 1PT9A 5CLFA 5CITA 2WSSD 1F51E 2XT0A 3KHKA 3L5KA 3OZ7A 2JK1A 2V7XA 3H6HA 4MS1A 3RU9A 9MHTA 3ROKA 5FBQB 1Q0HA 3G85A 4PHGA 1GPMA 4PYQA 5AK3A 3TM5A 4WLUA 5TS3A 3MWYW 4IMIB 4D92A 3BE6A 1I94B 2OLKA 4RGBA 4MYRA 3EVDA 2YV3A 2RBGA 1Q0SA 5AOBA 5G1PA 1FMJA 4PX9A 2ZBUA 3T7SA 2R6JA 1KEVA 3GI1A 3JR7A 3WB1A 2HREA 1NUUA 5EPEA 2VT2A 5MDHA 5ERYA 1G98A 2EIXA 2BWJA 2EFDB 3CZPA 3AGQA 1NW5A 3GMTA 4YONB 4BGDA 4UEOA 4R5MA 3TDMA 4EDFA 4LFAB 3NT5A 1HQYE 2O1XA 3EF0A 4Q7KA 2P90A 2V1XA 4UHCA 4G2TA 5IJAA 3UWPA 2X5KO 1JFVA 3H2JA 3UJBA 2QPAA 1Y1RA 3TTYA 3LPNA 1J90A 4BY9E 3LH5A 3WB9A 3WHPA 1ZW1A 1G5QA 2IZZA 1OXXK 1QLWA 5ALXA 4BV9A 2WAYA 1W5EA 2QUJA 4AICA 4ZFNA 3IT0A 2VTBA 1PJ4A 2GKOA 2A9JA 2XWPA 2AQKA 1DTWB 2RI0A 2HWXA 1L5RA 3WL6A 1FY2A 3QU9A 2H1FA 4K6MA 3VR6H 1TK3A 4AJIA 2IPAB 1T1IA 3FYDA 1RWMA 5IYZB 1ICEA 4Q9JA 3HB4X 1HDYA 3OLZA 2DQZA 4EYSA 2J4DA 4GM0A 3JYLA 1QG6A 2WK1A 3ZHYA 1XUOA 3R7FA 3RKUA 2CHVA 2HSEA 1X14A 4D8VA 1FSZA 5HKKD 3GHYA 2DY1A 4JI7B 3PNYA 8MHTA 1XE3A 3MB8A 3FNHA 4D4JA 1RWKA 3KNZA 4ESHA 5BWCA 1STOA 2NU8B 5LZ7A 5H1YA 4HAVA 5E9QA 1FJGB 1VB5A 1ZBQA 1AHIA 1M0TA 2NACA 2Q3DA 3PX3A 4FLMA 4LDPA 5HJEA 3Q8MA 2X13A 4P93A 4PC7A 2JKVA 4JYPA 5LDHA 3BG5A 5TPZD 4RKQA 2HWKA 3SQOA 5K3DA 3U4CA 1OZHA 2BM9A 2OBBA 3JPYA 4DXAA 1YVUA 2FKAA 4NJEB 3ELWA 5C31A 2A2ZA 3KEMA 3LLCA 2OB1A 4Q3EA 3WC4A 1D1SA 2F6RA 2IYLD 2QMZA 3CUVA 3PQ8A 4M38A 4ND7A 3GDWA 1KJYA 1RWOA 5FJJA 4DLRA 3KQWA 1KHTA 1V5FA 3G7UA 4IM7A 4RBNA 4PZDA 4U3JA 1L8OA 1U7PA 2H59A 3HDJA 4LE0A 4C87A 1D2GA 3V7YA 1O2DA 4TSFD 1ODSA 2Z3WA 1VGRA 2ZOSA 4R9UC 5JISA 4X62B 2B99A 2F3UA 2BSXA 2B20A 2PSFA 1AO3A 2QN1A 2QZPA 2XVZA 3HY6A 3R40A 2E6KA 4D9CA 3DXFA 1CJBA 1E63A 2HA5A 2IS2A 1F9AA 2JCVA 2PSEA 1L4EA 4XAQA 3UM9A 3OZCA 1E3JA 4Y6GB 3K8OE 2R6FA 4J2TA 2MJLA 4EJ0A 1T4DA 3Q3IA 4V0NA 2VDNB 3NASA 4KZPA 4U2EA 5DASA 4ZVNA 4KI7A 1UFKA 3W4JA 5ENZA 2WOOA 1PK8A 1RCUA 4TUYB 4BBJA 2R6DA 4DXHA 2IS1A 4CJXA 1U3WA 5CVVA 1PE0A 2R5WA 4J4HA 1DAEA 4UAUA 3H0KA 1O5IA 1CHNA 4UHEA 1WU8A 5A04A 3CVVA 2ONZA 4TV9B 3ZDAA 1E3TA 3GRFA 2Q0QA 3UWOA 2VPTA 4ER0A 3HU5A 1A72A 1D7OA 3O90A 2JGDB 2XE4A 3X1ZA 5IHPA 5FUWA 3RIHA 5B36A 5KOJA 1XTTA 3EIXA 3SQLA 5NLLA 1ORTA 3TLZA 4EYEA 3GFTA 2GWHA 1LTQA 1XV5A 3PRHA 2O7QA 3RUPA 3C7AA 2JGFA 3D3EA 1P2SA 3MAJA 2RBKA 1CQIB 2W8BB 5GPBA 2VQDA 3AKCA 3WKDA 3NCHA 4YCCA 2OG1A 3ORRA 5A6VA 3KFVA 3N53A 1BS2A 3TIFA 4CEIA 1P6XA 2D7CA 3S7ZA 3GRPA 2VDWB 2ODNA 4O4HB 4XVRA 2YBEA 2POQX 2R6ZA 2VA8A 3IT3A 5EP2A 5D1HA 2X0KA 4G8BA 3DLCA 3JQCA 3GLHB 5IBQA 3VR2A 5KJ1A 4A1FA 2TRSB 2OGWA 4DEYA 3T9CA 3QXXA 1LSJA 1ZIOA 2FHPA 4NOMA 1NQ5A 1PBTA 4QTXA 4L75A 2ATEA 1XZLA 2CCKA 5TIIA 4PIVA 1SOAA 4BXOB 5K0JA 4WOBA 3EWSA 2IIPA 4ND4A 2LD4A 4PVDA 3E84A 3V7WA 1Y5LA 2Y1EA 2OXIA 4BO6A 1EX9A 1UBMS 2P9YA 3OPYB 2J3KA 2YXNA 1Y9JA 1LU9A 1Y1TA 4HEJA 1I3OA 1V25A 2O2GA 2PWYA 3GJ8A 3M6XA 4GX1A 2H5IA 2FXIA 5CHEA 4EM6A 5KYNA 1G6Q1 1E6KA 3NXSA 1OMOA 3ORYA 5KKNB 3M1LA 2X2PA 4OCZA 1B1AA 1IEVA 2RCYA 1YNOA 3NGLA 4ZT7A 3R5SA 1BHO1 3NEPX 5B4UA 2LWIA 1VI5A 2PR7A 4JQYA 1ZOSA 1KJQA 4EJ2A 4B3TB 4RMHA 4U7FA 4KTVE 2V54A 1R9GA 4UHHA 1QG2A 1WHTB 5IC4A 2DFPA 3IDFA 5AFSA 3EA0A 3MJEA 4W9MC 2VBIA 2ZUEA 2VPWA 2W2LD 5IYZA 1LV7A 4KR0A 1E5XA 5GOZA 4OA5A 1JG6A 4E88A 2ZYDA 2G4VA 3VR4D 3KAPA 4R0VA 2B36A 2IF2A 4R8LA 4U2FA 2BBSA 1KVQA 5JAUA 1MC4A 5C8ZA 1O4WA 2PD6A 2XBUA 5FOUA 5BR7A 3NO4A 2QUBA 3ETJA 3NBQA 4WESB 2D0PB 3U49A 4YAEA 2AJCA 3CF4A 2XEXA 4OD0A 4ZAXA 4IBOA 1YZGA 5CIYA 2JAXA 4YALA 2NU8A 4ENQA 3W06A 1ZCAA 3QELA 1YE3A 4YUVA 4YV2A 5HGXA 2HJHA 4DCNA 3OBBA 2DZDA 2VQ3A 3RGWS 1PGJA 2C5EA 1CYDA 2B0JA 2M6LA 3HC7A 3L84A 1BSVA 1UPXA 1N2CE 4NJEA 3KDAA 3BSSA 4URVR 4AKSA 1DGQA 1WOYA 3VR1A 3RUDA 3ILHA 4KX5A 3VYVA 3DDWA 3LDAA 1BAPA 4LIPD 2H54A 5EQTA 1G8AA 5GONF 2WWTA 1QQAA 4Z9BA 2MSEB 4WE3A 4Z0PA 3U7IA 3ZDQA 4PGAA 3VC7A 2IWHA 3HYSA 4G1FA 3PXDA 1WMDA 4DCTA 3ZLTA 5J2TB 1UUFA 1WMFA 3K16A 1I5OA 4G9BA 2HA7A 3GA0A 5K0TA 3TRHA 1EUZA 2F1OA 3LCMA 3OEHA 4X61A 3WLMA 1XPOA 1A1VA 1T0PA 1PL8A 3TG2A 3J7TA 4AP6A 1N92A 3W1WA 2IIVA 4HX5A 2PMBA 3QBTA 3BH6A 1EEHA 3BKXA 3NHWA 2Q0SA 4JYBA 4XB2A 1B76A 1NMYA 4DMRA 1Z5VA 1D6SA 3DUWA 4KO1S 1UXOA 3K09C 3TE7A 4TV8F 5JZBA 4IX1A 2MSNA 5DTIA 3K71B 4BPRA 4DOMA 3LC0A 5FOTA 4F9TA 1N5IA 1Q83A 1KNXA 2D54A 2OHFA 2MDTA 3FNQA 2XGGA 3AF2A 4JHXA 4UNSA 1FFXB 1H65A 2L69A 4TUYA 3HP4A 2FW8A 3EEIA 4GDMA 4Y0AA 3T41A 3V32A 4DV3B 4OI1A 1XKLA 3WK4A 3N87A 4HNUA 4BKUA 2I7XA 5IK2D 4MUAA 4QTZA 4LJSA 3OIGA 5EIBC 2OKCA 5DCWA 1VCNA 2DLNA 3PT9A 5JO9A 4NS1A 5KDOA 1II0A 1KC1A 1JMYA 4R98A 2VSXA 3CR7A 3JSXA 3CLRC 5TQ0A 1VL1A 3AM3A 4B87A 3N2EA 5BWBA 3B3AA 1GAJA 3RVRA 7MDHA 2WQ6A 1VPVA 4ZALA 3LT2A 3S7TA 2Z2KA 1JAYA 1TEXA 4KE8A 3S8YA 2XB4A 6AT1A 1JDJA 2OENG 2QT9A 1FTSA 4BBAA 4LK2A 5FPQA 5A4FS 4ZEMA 2W8BA 4J16C 3HB0A 1XP8A 2DQYA 3EFBA 3DOFA 2GYVA 4BZZA 1NUHA 5LWHA 2FR8C 2X6TA 5K20A 3CLKA 4N7MA 2GA9A 1AUXA 3SIWA 2PKXA 3BTSA 4EUFA 2VDWA 3KKMA 3FJOA 4O4HA 4QOGA 2WSLA 5JE8A 2FG5A 4L7QA 1PDVA 3PEUA 4I81A 1CRLA 4UTPA 2C7QA 2AK2A 1NULA 1VMIA 1FQWA 4GSKA 4M7WA 3KSDO 5IM5A 2WKPA 1JSCA 3MCTA 5EHXA 3SIXA 3RIYA 4BXOA 5A7HA 2VH2A 3BFKA 5F5NA 3FOEC 1G8FA 1UAYA 2HHJA 2Z3VA 1MEEA 3OPYA 2VYND 3H5WA 1P73A 3M2PA 3CX8A 1OFGA 4XVUA 2ZT5A 1VPDA 4TN1A 1J5PA 3U7QB 3SDZA 1T2CA 2IY7A 4C0AC 5AW1A 3R8FA 2IYQA 2GBIA 3IOMA 3ZCUA 2AXQA 1QVWA 3FW1A 3R3YA 4PRKA 2FCRA 4E31A 1TFRA 2KB0A 2O48X 2QTLA 3AB7A 4FOSA 5BSRA 4M2LA 2IU0A 4P82A 5ITWA 2QTHA 4UTOA 1EFPB 1ZJYA 1RC8A 3HMKA 4TL6A 4Q21A 1HEUA 1Y8CA 3PVSA 2XECA 3OQVA 3MGGA 2GNPA 4QECA 4F60A 3HCCA 2BEKA 5JWHA 1K9VF 3DTNA 3WK9A 1G1AA 1N2SA 4KXXA 3WGNA 3TTUA 3V7NA 1WB5A 1I3LA 1WHTA 1YDWA 2GFQA 3ZWXA 3COJA 2XDQB 2IYPA 1FYDA 1MTZA 1Y8RB 1T9HA 2GJKA 3HI6A 3QWBA 2HDHA 3NAQA 4H35A 2UUBB 1KS9A 2GM3A 3HKEB 4AKGA 4M8SA 2B78A 5I8WA 2J87A 1OI7A 2P7IA 2Y2VA 3EGVA 5FBRB 1JL3A 5FO1A 3D4PA 4MICA 5G41A 1KA9H 1O03A 1OROA 1QFZA 2V7WA 2DH6A 1ANKA 4WESA 5EIBD 2Z9BA 2OV2A 3RK4A 4R2WA 2R6HA 3SU8A 3TCKA 4ZOAA 4ZOQI 5I9SA 4RTRA 2HU2A 1CT9A 3CLRD 3E23A 4LDNA 2WIDA 4BX8A 3UIEA 1PSDA 1YACA 3RD5A 1SHJA 4E03A 3SGLA 1BO6A 3RQIA 3T5MA 3H5LA 3MRSA 4DV2B 2I4LA 1GU0A 4IEFB 4TKVB 3PITA 1LSSA 1N1DA 3HWSA 3QHPA 1IIBA 1WW8A 5FLYA 1E9VA 2E85A 5L45A 3UV6A 1FXWF 4JASB 4PINA 3WIBA 4MKRA 4TV9F 4DCCA 2X1VA 3DOCA 2XQFA 3MBIA 1Z6QA 4J07A 3X1DA 1V5WA 1SHKA 2OQVA 5ICMA 5KYVA 1TUBB 4G67A 4A2WA 1D6JA 5BNIA 3WLEA 4FX5A 4EG0A 3IEMA 4OGLA 4C2UA 1X7DA 2AYXA 2JCBA 3N8IA 1MOZA 5J2TA 4D3SA 2VO1A 2O0JA 3CRRA 1Z6XA 1GKUB 2C8JA 4RZIA 4RD2A 3CSUA 3UMVA 3PHIA 2WSSA 5LWQA 1UP6A 3BXHA 4GYKA 4S2EA 4FGWA 3A6PC 4KIGA 3TCNA 1L9XA 1XU4A 5AICA 1D6MA 3C6ZA 3LV8A 4N0MA 2VBGA 3ZE9A 2KE5A 1RHKA 1ZGAA 4FEAA 2RJ3A 3LG2A 4HMQA 5EJ2A 3KPVA 2AHOA 2ILTA 1VJDA 3LS2A 3LDGA 2R5FA 3SYKA 2C82A 4HPJB 2H5LA 5C3MA 3WWYA 1DELA 1GZSA 2I1LA 3HCNA 3R6LA 1AGRA 2QMQA 5TS2A 2CUTA 1UBLS 3IEKA 3Q3JB 1JU3A 4X6LA 3NNSA 4FFVA 4NBNA 4XB1A 2P0AA 2C96A 2NZUG 3KLPX 4P7BA 1FFXA 1YFZA 3STYA 4FKZA 3ZWMA 2KLBA 1H6DA 1VRWA 3IH5A 1KEZA 1O6CA 1F8FA 4O5OA 4FOPA 3MQ4A 1GZDA 4R2LA 3IEIA 1VC2A 4ZOEA 1T0UA 4KFRA 4Q6BA 3UQZA 4BE7B 2GERA 2IXGA 2JD0A 3KKOA 4ME6A 3K5PA 5L3QB 2BW0A 3C5HA 3PHHA 4DG5A 5IKXA 3MT8A 4WWHA 1J8MF 2CYCA 2XADA 4TKLA 5L8VA 3QXGA 1TQ2A 2VK2A 2MWMA 2I6XA 2C84A 4O1HA 4DDUA 1SA0B 3KJFA 1LBSA 2VDLB 1QH8B 2VP6A 3B8EA 3O4IA 1BYIA 1X7XB 2QLFA 1KFCB 3DBIA 4NMMA 3HSKA 4H6WA 3UANA 4BX2A 3I1JA 4DRZA 4PXSA 4TYQA 4WBXC 3VISA 1V43A 1U2QA 1R8YA 2C8KA 4XCXA 2J0EA 2QG4A 1N75A 2Q6LA 4WY8A 1X1TA 1BFKA 3A3KA 5GZ1A 1BCRA 1JTVA 4M53A 4UCFA 5HKKA 3HXQA 2WF6A 3N7TA 1XVVA 3P1JA 4NQRA 1JLHA 3OLXA 4DA4A 4A82A 4LNUB 5JRZA 4EJFA 2HO5A 3PDHA 1XZAA 2DFKB 3AHIA 3ESXA 2I1WA 5B64A 4CTMA 4L57A 3JYOA 2JZCA 2Q5LA 3GLRA 3ELDA 4FNOA 3FBGA 4JVLA 4M0PA 1OC2A 4QQRA 5B2ZA 3VU1A 4AMUA 1JJ7A 2H1CA 4QSMA 4WKBA 5E8JA 2EIHA 3SJBA 1A5BB 2V0GA 2JFWA 4MVJG 1LKZA 3WGTA 1WKBA 3K1AB 4BLTA 4ENWA 4GH5A 4BE9A 1Z4KA 2EYQA 4JZYA 4JYCA 2YXLA 1OB5A 1I2MA 3V4LA 5F52A 3KAJA 4XWKA 5JLAA 1DBIA 1EFPA 1Z4IA 2FPSA 3N8KA 5HX7A 1XU7A 2Z2IA 1R6AA 1L4BA 3W6PA 4R1TA 3WGZA 5DBGA 4JLUA 3GBPA 4KQ6A 3HFJA 4J0CA 4Z3DA 1JECA 2D1FA 1P75A 5T57A 4UJ3A 3R6WA 4UVEA 1NWCA 2YICA 1Q11A 2XDQA 1PL7A 1K5HA 1U0EA 2FVXA 1LPNA 1VBKA 4RM2A 2ZAMA 4CDNA 2ZRBA 2ZRHA 3IP7A 3HKEA 1HG1A 1WAMA 2ZS8A 5IT4A 2W6PA 5HK9A 6ADHA 1QP0A 3P9YA 1C3XA 1FU7A 3RQSA 1LX6A 3SC4A 4UBNA 1AKNA 1F48A 2DFLA 3VZBA 4EFMA 3WVNA 2IH4A 1B42A 2GCNA 2K87A 1E7MA 2E9SA 5IC5A 4ZHSA 2GSDA 1I7LA 3K1YA 4GI7A 4TM8A 4HWOA 4NDNE 5DYIA 5EGSA 3RWOA 1BX1A 2G76A 3U3KA 1E5LA 1FQKA 2ZBRA 4KO3S 3RHSA 1J9ZA 1MQ8B 2DE0X 2JJMA 2YXBA 4P4LA 2I33A 1UDBA 4V0OA 1GCGA 4ENSA 2IH5A 3WGOA 4C07A 3PCTA 2P65A 1UBRS 1UM8A 2QVLA 4V03A 5DXJA 1N2ZA 5FLKA 5T6BA 4TKVA 1NVFA 2ZZKA 5KQPA 4K9QA 4OH7A 3ZHQA 3P71T 1QHHB 4WA7A 1M9NA 3U4GA 2FMXA 1R0XA 2H9IA 3HVHA 4HKTA 4CBVA 1UKBA 1ZY2A 3L8GA 2QAIA 2QEQA 2WJZB 4D56A 3L82B 1KVRA 3A6GA 2IZ6A 3A14A 4Z1MD 1X1SA 2H1OA 3OPQA 4MVJI 4EEZA 1RKBA 1CR6A 4KH1A 2ZI5A 4FGKA 4Q3OA 1LI7A 2OCIA 3QGMA 4WT7A 3W9SA 1ZFNA 1DRWA 4YRRA 3S29A 4ZK6A 1IDOA 4JP3A 3QZUA 1WNTA 5J4HA 4RVDA 1ZZGA 3GLIE 2O23A 3GJTA 1Y89A 2N1MA 4MUHA 5FA6A 3RHFA 1UBUS 2O0HA 1P62B 1L7QA 3P9NA 1EH5A 3AV3A 2JLWA 2JIDA 3GJRA 3KUUA 3VV2A 4FW8A 3TTTA 1ZYUA 2HRZA 2IP2A 3PRKE 5H82A 3DLHA 1KJIA 1S3SA 1SKYE 5ER9A 2YTZA 4YDSA 1OJ7A 1CD5A 1EFUA 3RIMA 1FOEB 2OLJA 2A0FA 2WUEA 3GFGA 3FNRA 5A03A 2W2NA 3PX2A 2ZJ5A 1SHUX 2WF9A 3DEHA 4ZO6A 1NVVR 2OBYA 3C3BA 3HLKA 5AVKA 3FHTA 1NJ1A 2Y6UA 3DDHA 3ES9A 5LZ8A 1R88A 1RJFA 1SN7A 3RUEA 3VAYA 1U0JA 3D8BA 1NZFA 1QANA 4YJ3F 2EGHA 1R8XA 3DVLA 4DTCA 2G7MC 1YZVA 1W4BA 1OZAA 5L3QA 3LKDA 1EE1A 2DX7A 1RPAA 3MWGA 2QZJA 4HPWA 4EABA 4NV1A 1XLUA 5E2BA 1L4GA 2RIPA 4Q9LA 4GW3A 2P79A 2R00A 1E5VA 4H77A 3OBIA 3K6JA 1TZMA 3TQFA 1RQ2A 1AC5A 1SBNE 3MERA 3T5CA 1QH8A 4IDEA 3Q8WA 3UTDA 1CG6A 3IUQA 2FMIA 3K2IA 3I73A 1X7XA 3MTDA 5BQOA 3WMWA 1SXJE 5FNVA 4URXR 1LH0A 1R5BA 5U4QA 3SVLA 1WZUA 4BMXA 2OGUA 3VR4A 1ESDA 2XRFA 3VOAA 1ULHA 4GI3A 1S3GA 4IXMA 3D43A 3S28A 4NWIA 4UXHA 1XF9A 2I71A 1QBGA 1U9IA 2JHPA 2C0CA 3WX0A 4G5SA 4F9GA 3IELA 2Y0PA 1RQPA 1TMKA 4FTWA 3OESA 2R8EA 4IZIA 4MCHA 3AILA 1KRXA 1L3BA 3UXYA 5BT8A 2PUEA 2RH9B 1N6LA 1O4VA 3BREA 3FVVA 2FG7C 1J8DA 4LNUA 1JG1A 4ZGWA 1H4VB 1YS2X 1E1LA 4M9SA 1NM5A 3VNSA 3AERB 4QBIA 4QXMA 1ZN7A 5KTPA 1Y9ZA 3MTGA 1SD5A 3PRYA 3U6KA 4WCFC 1ZXXA 3OZTA 4B2IA 1AGYA 1L5VA 2ZK7A 3BK1A 3S2EA 3EOZA 4D8UA 1GAWA 3BQNB 3L1KA 3GUZA 4J0GA 4A8JC 4NPAA 4DLKA 1KOLA 1WXEA 4KPGA 3DBHB 4QATA 4OU4A 4J1QA 4ARAA 3WYGA 1UBTS 1XNQB 2XVMA 1TAGA 3K1AA 3PJDA 3KYBA 2G4LA 3WLHA 1W44A 4EI7A 5ICFA