2FMUA

Crystal structure of a tat-interacting protein homologue (htatip2, aw111545, cc3, tip30) from mus musculus at 2.30 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
236
structure length
209
Chain Sequence
HHHHHHLPKLREDFKMQNKSVFILGASGETGKVLLKEILGQNLFSKVTLIGRRKLTFYKNVNQEVVDFEKLDVYASAFQGHDVGFCCLGTKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSRGADKSSSFLYLQVKGEVEAKVEELKFDRLSVFRPGVLLCDSWASGYAVPVVTVVRAMLNNLVSPSSGQMELLENKAILHLGKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Tat-interacting protein 30 kDa (HIV-1 tat interactive protein 2, 30 kDa Homolog) (Human) (16924205) from Mus musculus at 2.30 A resolution
rcsb
source organism Mus musculus
molecule tags Unknown function
molecule keywords HIV-1 tat interactive protein 2, 30 kDa homolog
total genus 74
structure length 209
sequence length 236
ec nomenclature
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2fmuA00
3NJ8A 5F1PA 5AOVA 2VRBA 3FCOA 1VKNA 1E92A 5L40A 5H81A 2PFGA 2ZK7A 4OXYA 4YAIA 4CMJA 1TA4A 3JCZA 2PD6A 3ETGA 1T25A 2BFAA 4YT5A 4DQUA 4NFSA 3SC6A 4PCVA 3ZWPA 4A27A 4DREA 2AEFA 1NPDA 3Q9UA 4KWIA 5HM8A 1YO6A 3BYZA 3IP1A 1E7YA 2QW8A 4R9RA 4Z9YA 4DYVA 2X0IA 1O9BA 1PGQA 2WD7A 3C1OA 2CZCA 3OECA 3STHA 3LDHA 1GQ2A 3FSRA 1JVSA 4ZVVA 1P44A 1E1KA 4NU6A 4AICA 2X86A 3GLQA 3KEQA 1X13A 1PJ4A 1G0NA 3HG7A 1I24A 3LT2A 2ZYGA 1ISGA 5L53A 3L9WA 5IJZA 1QYCA 3M2PA 4BO6A 1BWSA 1U4OA 4EJ0A 1XQ6A 1MC4A 1Q7CA 1MG0A 1Q7BA 3E6AA 2OMEA 1DIRA 2EKQA 3NTQA 5CFZA 5DCWA 4L9RA 4W7HA 2R6JA 1XWFA 3S2EA 4DXHA 1IHYA 2Y93A 2QZ9A 2HCTA 3RBXA 3I9MA 4XEHA 5KCZA 1KETA 5GZ6A 4Z9FA 1H0KA 3VAZA 3WFJA 2YQ5A 1MFPA 1U7HA 4DC0A 3AUSA 5L7WA 3OJFA 1V0JA 2NTNA 3GMSA 1PWZA 3IUSA 4MKXA 3ZWCA 3O9ZA 4HFMA 4PIVA 3K73O 2VUSA 3VVCA 5JMPA 5EJ2A 4LCEA 4BO7A 4CQMD 1A9YA 3TL2A 2NTJA 7ADHA 3O4RA 3QV1A 2VZ0A 2PH5A 2VUUA 4NBVA 1NFQA 2CSUA 4W7IA 4D0RA 2Q2VA 4LGVA 1HLPA 2C7VA 3ADOA 1VSVA 3DBHB 5GMOA 3D3WB 4GSKA 1O94A 2HMSA 3FNHA 1F06A 4WUVA 3WYBA 1KC3A 3AI3A 3BMOB 2YDYA 3LF1A 3KXDA 4IIVA 3VKVA 3VHRA 3WGHA 2VT3A 4FBGA 1DIAA 1CEQA 5L3ZA 1DPGA 4E6PA 2GLXA 2JFFA 1ADBA 5COAA 4BNUA 3F9IA 1C0PA 2PGDA 1HL3A 2W2LD 1LLDA 3T7EA 2XF8A 3WMXA 4KUHA 4B7CA 4CMBA 4CM5A 3FI9A 2VRCA 1SOWA 3Q2KA 1ISIA 3A4VA 1HDGO 1IZ0A 1DJQA 2O3SA 4UUMA 1LUAA 3HDQA 3IJPA 4XYLA 3L4BA 1RWBA 4RVSA 4QO8A 4UEJA 3VH3A 1LI4A 2YV1A 4TKMA 4QTZA 2OL4A 4TROA 4WLUA 4JBHA 3GMDA 3OFSA 1DRWA 1U3UA 5J23A 3JQEA 3K30A 1PU2A 4FC6A 2DFVA 2P4HX 4TMFA 1MXHA 5B1YA 3QVXA 1SBYA 3DQPA 2POQX 4B3HA 2O3TA 4ALJA 1I3KA 1FK8A 3VOSA 1NFFA 1WP4A 4L74A 4U6QA 3GT0A 2YFHA 5ICMA 1DRUA 4L73A 5BT9A 3M6IA 4ND1A 2YV3A 1NR7A 2NU9A 1E5QA 1GUFA 4O63O 1GDHA 1U4SA 5EIOA 3ONFA 1DIHA 4J6FA 1K6IA 1WVGA 1XA0A 4BO4A 3HDHA 4B8ZA 3ZV3A 3H9GA 2EGGA 3ONDA 3W6ZA 4NJOA 2BLLA 4DMMA 4AJHA 2VHYA 1LJ8A 4YQZA 4JJFA 1WZEA 3L4BC 1D1TA 5DCYA 1BXGA 1ZJZA 3I9JA 2O2YA 5C37A 1M66A 3UKOA 3CPSA 1H6CA 2CUKA 4JQCA 1H9AA 5JAMA 3KRTA 5FWNA 3RI3A 3UH1A 3WLFA 1KYQA 1Y8QB 3CZRA 1OFGA 2BI8A 4HY3A 1K0UA 2PV7A 4XZ3A 4BV8A 1V3TA 2HQ1A 2HMWA 1KC1A 4J7CA 1PS0A 3MTJA 3DZBA 3EDMA 1E1MA 3D4NA 4GL4A 4BKPA 3M2TA 4BNFA 4GLLA 1X7DA 1PL7A 4QECA 3RSHA 4CL3A 4HV4A 1EBFA 4CV3A 2EGHA 1YDEA 5LDHA 1ZEJA 5L51A 4GQAA 1O8CA 3NDJA 1WDMA 3G3EA 4J1QA 4IUYA 5G4KA 3E9NA 1VM6A 4IXTA 4LRSB 3EZYA 3AUAA 3NJ4A 5L4SA 1R4NA 3GZNB 1T4BA 2J6IA 3HJAA 2JCVA 4J7XA 4KZPA 4FSHA 1C14A 1ZCJA 4FW8A 1LU9A 4O5OA 2Q1WA 2Q1SA 4MVJE 5CEFA 2D0IA 3LT1A 1Y5MA 4ITUA 3ZWNA 1IUKA 1ONPA 3ITDA 1Z7BA 3PGJA 3JQBC 2EP7A 2I9PA 1I8TA 3QA9A 3ZNPA 4CV2A 3HUDA 2E82A 4Z3KA 4EW6A 3H65A 1FMCA 2H1SA 1Y9AA 1GPDG 4CL8A 5JS6A 3HADA 4D79A 1I3MA 3S2FA 2Y05A 1B15A 2X58A 5JSFA 4BNGA 1J4AA 1NX6A 1WZIA 4BNLA 5DN9A 2FR8A 3GK3A 3H3JA 3UGKA 2P9CA 3I6IA 2X5KO 3IS3A 4K6FA 4UULA 4WLFA 1FDWA 1QP8A 3BAZA 4CR7A 1CF2O 3RC2A 4I08A 4O1MA 3DO5A 3KLMX 4BL5A 1MG5A 4L76A 3RBZA 2Y68A 4ROSA 4DVJA 2A94A 3C85A 3OEYA 3WOHA 1T4DA 4YRBA 1E77A 3GFGA 5EN4A 1QKIA 2P2SA 1IPEA 1EK5A 3N7UA 3GAZA 2WSBA 4AJ1A 2GO1A 1QLJA 1AN9A 2PGJA 3AM4A 1Z82A 1JQBA 3TOXA 3B6ZA 4OSPA 1MUUA 2P91A 3I23A 4HWKA 1YBAA 3FBGA 3ZWOA 3CINA 1BRMA 4U6SA 3ZWAA 3DEYX 4P22A 4BO8A 3OJOA 4HADA 3WNQA 2GSDA 3OICA 3ZU4A 2VYVA 3OQ6A 4GX2A 3MTGA 4FD3A 4U7WA 5JO0A 3A14A 1YONA 1I3LA 4RO0A 3D3EA 4CMIA 4JN6B 5GZ1A 1UDBA 3HDYA 3ZU2A 1VE9A 4EJ6A 3JQFC 4FJ2A 1KVUA 2HJRA 2EF1A 1A27A 3EYWA 3NT5A 4LK3A 4BKQA 1O0SA 4G65A 1C0KA 5KKAA 1TLTA 3WS7A 5I7FA 2JHGA 1LDEA 3H2SA 1AGNA 3PWSA 5JE8A 3TOZA 3F46A 4XQEA 3UCFA 4E5NA 3LLVA 3PP8A 1HYEA 1DHRA 4O6VA 1I2CA 5JAQA 3IL2A 1QLHA 2D3TA 4IDAA 2W2KB 2PY6A 2WE8A 1P77A 3GPIA 1DC4A 1L7EA 1EE9A 2X8LA 1ENZA 1BMDA 1HYGA 3IMFA 5CPFA 3UN1A 4PN3A 4MKZA 1C1DB 2W4QA 1YS4A 4Z0PA 2P9GA 3ROQA 2VZ8A 4RVGA 1GV1A 4CV1A 3AW9A 3F4LA 2VYVD 3JSAA 5BSHA 1B8VA 2IXAA 3ZDFA 2PA3A 1ZK0A 3OJ0A 5JXWA 1OZAA 1QV6A 2ZCUA 3GVIA 1N1EA 2G82A 3DMYA 4BQRA 3G49A 3RC1A 4IINA 3GUYA 1XCBA 3HN2A 2OO5A 4EUFA 4Z9XA 2VYND 2FRDA 1AHIA 4ZHSA 1C0IA 2X1HA 1U2DA 5I8ZA 1JLLA 2ZQYA 4Y9DA 1IB6A 5JCJD 4NI5A 4E31A 1ZMTA 1YB1A 4BNIA 1KIFA 2J5RA 3RC7A 3V2HA 1JWBB 4BGUA 2GZ3A 2PZJA 2CDCA 3U5TA 3JD0A 4IJWA 3PJGA 4DGSA 3ZHYA 3CKYA 2DBRA 4D3SA 3DL2A 3JTMA 1R4MB 4IIUA 2H9IA 3QWFA 2CFCA 1I3NA 1ORRA 3VZRA 3V2GA 1WLYA 1Y1PA 5IN5A 4MVJH 2O48X 1RKXA 3W1VA 4CM9D 3ZNOA 4CQMB 2VN8A 1EMDA 1XU7A 4J2OA 4BHTA 3L07A 1PX0A 4GH5A 3F5QA 5BSEA 1VLLA 4W4TA 4F6CA 1QXSA 3RKRA 4IDBA 1FDUA 3ST7A 4AJEA 2BFPA 4CMEC 1XGKA 2H6EA 2I3AA 4EI2A 3LT0A 3DHEA 4IQ0A 5KWEA 5CEEA 2OZPA 5F1OA 3G79A 2AXQA 4FFLA 1EUDA 5L7YA 1LA2A 4DIOA 4BKUA 1KVQA 4ND2A 3OIGA 3DZHA 4UVEA 5EL0A 1QSGA 3MOGA 2YHUA 4MOWA 3FWNA 2YHIB 1ZUD1 4KDEA 4YVFA 1BGVA 4DIFA 5TJHA 1SO8A 4D42A 1X15A 4UAGA 2R00C 3EVTA 4WNIA 1WW8A 1OOEA 1PGJA 1UDAA 3U0BA 3FNEA 3X2FA 2FR0A 3IKTA 5T64A 3SC4A 3JQ9A 2I6TA 4R69A 2YJZA 4I5GA 3DDNA 3ROKA 1W73A 2ZYAA 4R1UA 4BNVA 2WYWA 1DLIA 3P2OA 2ZATA 2PR2A 1HDCA 4Y98A 4WLNA 2LDBA 4XRRA 1FXSA 1O95A 3I83A 4E30A 2BRUA 1DLJA 4B79A 3TDKA 1LLCA 3GZ4A 3SVTA 3D5TA 2BGMA 3FR8A 4C7KA 5TLSA 1PWXA 4WCFB 4GWKA 1PL6A 4MVJI 3DTYA 4YRDA 4BMSA 5B4VA 1GCUA 5CDGA 4IS3A 3GNQA 1YL7A 2GCGA 1BDBA 2ZCVA 5JO9A 5AXAA 4DIBA 8LDHA 1TT7A 1IHXA 1PJ3A 4BO1A 2CVQA 2I76A 5HTOA 3WJAA 1ENYA 3ZU3A 1DC3A 4I9HA 1LDBA 3FRJA 3PHJA 3UCEA 2IEDA 1G1AA 1LX6A 2IDZA 2FHSA 4J0EA 5T6BA 4WGGA 2Y99A 3ZWXA 1ZJYA 4EGFA 4J0FA 3COSA 4YJGA 2Q46A 2WM3A 1E6WA 4HFRA 4FJ1A 2PZKA 3PQEA 1N7GA 2I67A 4UVHA 3VPXA 1EK6A 4D43A 4B8WA 5BR7A 4RF3A 3BHIA 3KSDO 1UP4A 3ZZNA 1P33A 2CD9A 3PDUA 4IDCA 1YB5A 2HLPA 1P0CA 2OFPA 4R4JA 3VPFA 4RF5A 5HS6A 4DL9A 1RJWA 4RPKA 4F46A 1B0AA 3LLSA 3Q9NA 3TZQA 3TZCA 3K9QO 4OIMA 1GZ4A 3ZV5A 4FN4A 2QRJA 1HF3A 3IAHA 4XKJA 1AXEA 3KSZO 4OXKA 2PKRA 1GADO 1K6XA 3OETA 1UDCA 2O7SA 1VRWA 2ZB4A 3OA2A 4IXWA 3PI7A 1GUYA 4JBIA 4BNHA 2FPIA 4NHEA 1U1IA 2C59A 2QRKA 3ZWMA 3KYDA 4Q9NA 2I5PO 1NVMB 4OAQA 1NHGA 1UJMA 5JC1A 4RDIA 1KY4A 1KVRA 2FPPA 5C7OO 4ZICA 4J91A 1R12A 3WSVA 2R00A 4MP6A 4QQRA 1Y8RA 4BO2A 2X7HA 3AK4A 4GVXA 3GNSA 4DQVA 4FB5A 1VL8A 3D7LA 4Q3AA 3HHPA 5TT1A 2O3RA 4ZJUA 3BMNB 3ON5A 5KJ6A 1NYTA 4UEOA 3MJTA 4BNMA 2Y1FA 3GAFA 2VWHA 2E48A 4CM4A 1P31A 3L4SO 4R5MA 3Q1LA 3ZH2A 1P3DA 1E1NA 4BKRA 1TT5B 2LDXA 1UAYA 1AE1A 5CG1A 3VDRA 3P2YA 3QSGA 4MINA 4GSLA 3QE3A 4PRKA 4BB6A 8ADHA 4KOAA 4GGOA 2AEMA 1U9JA 4XQ9A 3TNLA 1M75A 4IQGA 4OGWA 4P38A 3F4BA 3NX4A 3VDQA 3EC7A 4MDHA 3WTCA 3P19A 4AJ4A 3SEFA 1HWYA 1Y9EA 3L6OO 2HMUA 2UVDA 4I8XA 4ALLA 2CDAA 3E8XA 3GVCA 2X5JO 3NDRA 4FDAA 3FD8A 4N18A 3H9QA 1X14A 3QQPA 1ZSNA 4NIMA 3R1IA 4DMLA 1BW9B 5IZCC 4ND4A 2DM6A 2B5WA 3GGOA 4YT2A 3AM5A 4E2ZA 2Q45A 1KEVA 3SJUA 1ISHA 2VWQA 2C07A 4XJTA 3JQ8B 2AQKA 2X9NA 2GNAA 1U3VA 3PIDA 1XYGA 3H6KA 4QO7A 3CZMA 4IDFA 1VSUA 3PEFA 1X0XA 3DWFA 1W6UA 1A9ZA 4C7JA 4CUJA 4RPHA 5A5EA 1EUZA 3F47A 3K5PA 2HU2A 2XXBA 3GH3A 4AJPA 4BNJA 4BS9A 3JD1A 1EEHA 2P68A 3JQ8A 3QVTA 3EW7A 2V6BA 3GN1A 3LSYA 4DPKA 1EVYA 3DBHA 4D46A 2EKPA 1HLDA 5K0ZA 3V1TC 1P74A 3VPHA 2XAAA 3TN7A 1ADFA 1IY8A 1YRLA 1D7OA 4IJVA 3L9XA 1HYHA 4OO3A 3V8BA 2GRAA 4BVAA 4D45A 5C7LO 3GR6A 4PLWA 3RUDA 1PJCA 4CQMA 5IFLA 5CEJA 2O4UX 1I0ZA 2DPGA 4DPLA 2HSDA 2G76A 2Q99A 4TSKA 1CRWG 1PZFA 4M8SA 1OC4A 2EIHA 5JCXA 1PL8A 2G0TA 1DEHA 2RAFA 4Y6SA 3DOOA 3RIHA 1AXGA 1LDYA 3E9MA 1IYZA 1IPFA 2ZYDA 4CMEA 1YDWA 3GDOA 4JIGA 3WQSB 3H3FA 2PK3A 1SZJG 2D5CA 1NR1A 4TVOA 3ZGYA 2Y1DA 1GR0A 4MKRA 3K8ZA 4Q3CA 4JJIA 1WMBA 1HSOA 2DFDA 3WTBA 5CPBA 2B5VA 4CQLB 1ZBQA 4HKTA 1OMOA 4BIIA 3G0OA 4RORA 3MJVA 1U8XX 1ZVMA 4PG5A 2VOEA 4UEKA 4ID9A 2W90A 1K5HA 5TF4A 3X2EA 5A04A 3PWZA 3NEPX 3N74A 3CMCO 1SC6A 1XR3A 4PLYA 1JKFA 4D3FA 1K6JA 3CIFA 4XYBA 2CDBA 3WQRA 1UXIA 2NVWA 3GVHA 3PPIA 1I2ZA 1GZ3A 1PIWA 4UVGA 3U62A 3ETDA 3GVPA 5JDCC 3UOGA 1G0OA 1C1DA 1XKQA 2WD7B 2TMGA 5AQ1A 1M67A 2GD1O 3HN7A 5MDHA 1PZEA 2EW8A 3VZPA 4B3JA 2QYSA 4WECA 1O6ZA 1LRJA 3ZV6A 3SLKA 3DAPA 4LMRA 1M2WA 2OOSA 1ENOA 3K2EA 4YCAA 2AW5A 4B7UA 4DBZA 5L4LA 1R66A 4R54A 1BXGB 3DAFA 4QX6A 5DBIA 1SNYA 3NDIA 1P9LA 3HNPA 1UAGA 4S1VA 1V3VA 1X1TA 4Z3DA 2Y67A 5ENDA 4N5NA 4M54A 1D8AA 3KHUA 4EYEA 4J16A 4YAEA 1DXYA 3L77A 3OBBA 3WGZA 4CM3A 3C1AA 1L7DA 2NTVA 1S7CA 1Z7EA 3V2UA 2NM0A 4OMUA 6ADHA 4PG6A 3BHMA 3T4EA 1E7MA 5K6AA 2X23A 3HB5X 4DLAA 1T24A 1X0VA 4N5MA 2PKQP 2HJSA 5G4LA 4MPDA 5I9LA 1P0FA 4E12A 4NBTA 3NT4A 3VZQA 4MP8A 4E5YA 4E3ZA 2IEBA 2I65A 4WLEA 3NAQA 3W6UA 3KUXA 4GPD1 2Q2QA 3NKLA 4J4TA 3P7MA 5KTKA 1NVGA 4IM7A 5KJCA 5A05A 2UUOA 1LSSA 5G0TA 4XGKA 5TJ9A 3ANMA 1JN0A 4LW8A 4PLFA 5U4QA 5KNLA 1O89A 4OJNA 4J7UA 1HDZA 3QW2A 1QR6A 3PLRA 3QRWA 1GYRA 3AY3A 4E32A 5C3MA 5K9ZA 1CIVA 3IOYA 1PS8A 1XELA 5IXSA 3EHEA 3PYLA 1J0XO 4XDZA 4D41A 5JDIA 4O0LA 5I8WA 5JDCA 5JC8A 2HAEA 3QWAA 4U8GA 2C2YA 9LDTA 4RF2A 3OQBA 5A02A 3AOGA 4XGIA 3MCVA 3U4CA 2HK8A 2FMUA 2QRLA 4A03A 1R0LA 4RVUA 1P1HA 3PQFA 1ADGA 4BGVA 3UHAA 2XOXA 1I30A 4XA8A 4CLHA 2WDZA 1MB4A 5TQVA 4GGPA 3AI1A 4XIYA 4OKIA 2ZTUA 3GHHA 3MWDB 1LQTA 4QSMA 3ZNQA 4IMPA 2GF2A 4JP2A 1NFRA 1XDWA 3FTPA 3QP9A 4EZBA 4Y6RA 1ZSYA 5DF1A 2HK9A 3LC2O 1LSOA 5DZSA 4NMHA 1DB3A 3PZBA 5KVQA 3E18A 5G4KB 3EAGA 2WJPA 3ETEA 4E33A 2ZB3A 3LC7O 1DJNA 3KLPX 4TRMA 3EMKA 4GWGA 3AY6A 3AY7A 4ND3A 3ZI0A 4CJXA 5G0UA 4B4VA 3GDGA 1A7AA 2J5QA 2FSVA 2PD4A 2IXBA 3P5SA 1DAOA 3C7AA 3IUPA 3AFNA 3IIEA 2PZLA 2Z1MA 3DHYA 3G17A 4NFHA 5EPOA 4PVCA 3WFIA 4CPDA 3ZWVA 5K6AC 3WJ7A 5CG2A 2GERA 3JQ9C 4Q3EA 2Q49A 3IDSA 4WK6A 3MJEA 3U9LA 2NADA 4CM8A 4GX1A 4FCCA 3W8EA 5C7IO 1H6AA 1EDZA 2EEZA 1ZK2A 3C24A 1ZK3A 1NNUA 4N54A 2H5LA 1YH3A 4NJMB 2GN9A 4GVLA 1YBMA 2A35A 3DAGA 2AG8A 1I01A 5EESA 3CSDA 3R0IA 5F5NA 1YOVB 1ZK1A 4P4LA 1JTVA 2V6FA 2X0RA 3FF4A 3GG9A 4M87A 4BNWA 3PJEA 1EDOA 4RVDA 1KEPA 1CJCA 1JKJA 2JL1A 2X4GA 2UYYA 3BMCB 4WPGA 4R01A 2RCYA 3TZHA 1P1RA 4R9SA 2DQ4A 3TRIA 4M86A 3DBLA 1UUFA 1FF9A 3VTFA 4DC1A 2Q2WA 3WG9A 4GI2A 2AG5A 4AJ2A 1N7HA 2DC1A 4CR8A 4CLOB 1VJ0A 4XB1A 4D7AA 1BXKA 3ZHXA 5CDUA 3AWDA 4UUOA 5G0VA 3NGXA 2JAHA 3DZIA 4PGFA 1MC5A 4DWVA 3SLGA 5L45A 5DULA 4GBJA 3LQFA 3DZGA 3OJEA 2UDPA 3AOEC 1N2SA 5ILGA 4M1QA 1GFSA 4B3IA 2BKAA 1GPJA 2B0JA 1ZMOA 2VNAA 1GUZA 3BZUA 2NVBA 2WMDA 1JKIA 1WDKA 3IJRA 3PHGA 2I99A 1ULSA 1MV8A 3INTA 1U5CA 3R3JA 5TT0A 4RCVA 1QRRA 1Z74A 3H9UA 1Q0LA 1VJTA 5MGBA 2O3QA 3O38A 1B3RA 1B7GO 3PHHA 4R16A 3HFSA 3GRPA 5IG2A 3KOUA 4MIOA 3GG2A 4G2NA 1DHTA 5B12A 4PLCA 2OP0A 3RD5A 4E4YA 1B3BA 1ENPA 2O2SA 5B4TA 1VKOA 4K1LA 3GEMA 5AVOA 1NWCA 3HE3A 4OOEA 3MEQA 1V35A 5IF3A 2GASA 2PLAA 3EUWA 3GRKA 4FGSA 5F1KA 4JCOA 3GZNA 1JAXA 4DQXA 4R1TA 2Y0DA 1HZZA 1V3UA 3DMTC 3Q0EA 3KYCA 4HFJA 1CDOA 4J1SA 1MA0A 3HWRA 3UF0A 1V6AA 3GEDA 3QJ5A 1Q0HA 2VUTA 3BHJA 1ZH8A 1BG6A 1Z45A 2CNBA 2VZ9A 4ILKA 5DNAA 3K96A 4Y67A 4EUEA 4L4XA 2V6GA 5H83A 1DIBA 3H2ZA 4MVJG 1HE5A 4E2YA 3FBTA 3I4CA 3JQAB 1YJQA 4CM9A 3TSCA 1Q7GA 3DZJA 2GPTA 4K6CA 1E1LA 2ZKLA 4ALNA 3RUFA 3U09A 1SB9A 2PZMA 4LVCA 1F17A 3WBFA 2EWMA 1UXJA 1T2FA 3KB6A 5T8KA 9LDBA 4PZEA 2C82A 2IZZA 1SAYA 3RAJA 4NR0A 5TGDA 3KYDB 4WASA 1K2WA 2PD3A 5CDTA 1MX3A 2D59A 5BSFA 1LSUA 2AE1A 1HE2A 4RPGA 5ENVA 4FQ8A 4X54A 1ZNQO 3QLJA 3JYNA 2OGUA 3ZWBA 5IZCA 4D3DA 5A9TA 4DPMA 4FOOA 2YUTA 1VC2A 3PDJA 2FY8A 3PTZA 3UVEA 3DFZA 1YB4A 4JNKA 2B83A 5JYDA 1DAPA 3PJDA 1MP0A 4NK4A 1PZHA 4YACA 2RHCA 2E4AA 4II3A 1Q2XA 3QIVA 1YE3A 1LDGA 1P45A 3F5SA 4HFNA 4R5HA 1UP7A 2P4QA 4IGFA 3WR5A 1NQAO 1NWHA 1CQIA 1M6WA 3R3SA 1YBVA 4D44A 3D64A 5I9MA 5HWSA 1PR9A 3JYPA 1XU9A 3R6DA 1C1XB 5IDXA 1LLUA 4WCDA 5U9CA 3VH2A 4JROA 3A06A 2B37A 5KVVA 1GQQA 3F6YA 4P8RA 1BVUA 4ZQEA 1EVJA 4BOYA 1Y8RB 4PG8A 4WCFA 4IDGA 1ZEMA 1XIVA 3ABIA 5H82A 1KVSA 4GKBA 4YTEA 1LXCA 3OA0A 4A73A 4WNCA 2V7PA 5A3JA 1HT0A 2JKVA 4BNXA 1SEPA 1MFZA 3CTMA 3GGPA 2GZ2A 2JFGA 4BNZA 3WDSA 4XYEA 2BFOA 3HDJA 3H7AA 4MVJP 3GY0A 5T57A 1PQPA 3I1JA 1M6HA 3I9OA 4J1NA 2NWQA 1HKUA 5FI5A 4QUKA 5U1PA 3ANLA 3CEAA 3F1LA 2W98A 4BO5A 3JQAD 5ITWA 2YHIA 4WOJA 2EHDA 4RLHA 4AJOA 1NASA 5IDYA 3V1YA 3V1UA 1GTMA 3RCBA 2OORA 4Q3BA 1U7TA 2DBQA 3L6EA 5JLAA 4R1SA 3B20A 4W9NC 3W8DA 5A9SA 2WE7A 2VHVA 1N9GA 3PK0A 1HDYA 1HSZA 4NFYA 1QYDA 1XEAA 1XSEA 4NH4A 5EQFA 2QG4A 4PZDA 5A9RA 5LCXA 3GVXA 4G81A 2OUIA 4A26A 2NLOA 2AA3A 5KJFA 3JQGA 2VTDA 3S8MA 1Q1NA 3MJ4A 2WD8A 2X22A 3DONA 1ZW1A 2NUAA 5LC1A 1N5DA 1OAAA 1PGOA 5A3VA 1PGPA 5JPIA 4L8VA 1PEDA 4RV9A 3W4IA 3JD2A 1QORA 3JD3A 2EERA 1GY8A 2DUWA 2CF5A 5DDIP 5TX7A 1J6UA 2J3KA 1M76A 2IZ0A 1Y8QA 2Q3EA 3AFMA 3E03A 1LTHR 5IXYA 3JQDA 2NVUB 2FZWA 2QQ5A 3G1UA 4HX5A 1YXMA 1EVIA 1UXGA 3QWIA 3I9NA 1ZZEA 4JGBA 1YWGO 4WEOA 3NV9A 2QIOA 3B70A 4YJFA 2C29D 3C8MA 4MVJA 3D0OA 3ENNA 3GOHA 4PLPA 2W8ZA 1OI7A 2O7QA 3OMLA 4GKVA 2VWGA 2VTEA 1CQJA 4NG5A 1E7WA 1UP6A 2WYVA 5G2OA 5LDGA 2AE2A 1NVTA 4WLVA 4YJDA 3FN4A 4BB5A 3RFVA 1HDOA 2C2XA 4TRNA 2OXIA 4NK5A 2Q1UA 1YKFA 2X0NA 1UZMA 4A0SA 4IPTA 4E21A 4J43A 4PVDA 2VYNA 1WXDA 1PQWA 2EJVA 2NNLD 3OF2A 4JJGA 4QFDA 5CHEA 4R3WA 5G0WA 3OM9A 2NQTA 2DTXA 4H7PA 4WCFC 2QYTA 3RU7A 2DVMA 5FI3A 3VPGA 2EV9A 3OJLA 5L4NA 1Y7TA 4LRTB 2X6TA 3OH8A 4J90A 3I4FA 4L4SA 4LCJA 4Z6KA 5JMWA 1NBOA 4AJKA 2VCYA 1AUPA 1H5QA 3ZW9A 4CM8B 1EE2A 1ISFA 5ITVA 1BHSA 5BNTA 5KJEA 4IBOA 2CMDA 3LF2A 3IQDB 1J49A 3T4XA 3H8VA 3I3OA 1ISMA 4CLOA 4M49A 3PLNA 1PJQA 1N8KA 1PS9A 1B8UA 3RC9A 3ZW8A 2EKLA 4FS3A 4AFNA 2GDZA 2YFQA 1V8BA 1TB4A 1E3EA 3ZHBA 3ZU5A 4KWHA 3VZSA 4BV9A 1JA9A 3GF4A 2DTEA 3FWZA 2ZB7A 2DKNA 3DBRA 4II2A 4QT0A 3O03A 4XJSA 3RFXA 4J4HA 1ONNA 3RVDA 2DU8A 3JQ7A 1YOVA 5DBGA 4IJUA 4N7RA 3SX2A 3DBVO 4XQGA 3PIIA 5BNIA 5L9AA 1K3TA 1EBUA 4ALIA 1LQUA 3FHLA 3GHYA 1YL5A 5DOZA 2B4TO 4WE3A 4AJLA 3PXXA 3UW3A 3TFOA 3S55A 4BO0A 2VRCD 4IS2A 5TIIA 4CM1A 5BNFA 4CMKA 3B1KA 1NAIA 4WLOA 1GL3A 2DPHA 2Q1TA 1EQ2A 2JJYA 3WGYA 3WIEA 3JV7A 5JBIA 2Z5LA 2D2IA 1D1SA 4FFPA 3M1LA 2P5YA 1Y81A 1ZFNA 1K89A 5ILOA 4RLSA 4CLEA 1LRKA 4LMPA 4ZN6A 5IAAA 4KP7A 2DT5A 1O5IA 3W4KA 1E7SA 2D8AA 5IDQA 3ENKA 3D5QA 2O23A 3QHAA 2NU7A 4UUPA 3EK2A 4CM6A 4YAJA 1A7KA 2DBVO 4JX8A 4FOSA 3RUCA 3JD4A 1ADCA 5CDSA 4B4OA 3ZHZA 3OSUA 4AL4A 4IQ8A 3I52A 3I5MA 4LN1A 2J3HA 4MVJM 1P1FA 4YRAA 2NVUA 2UAGA 2XPCA 4CMGA 1U28A 1PR3A 5EQDA 1B8PA 2FP4A 4EITA 1F8FA 3LK7A 1JVBA 3TQHA 5FEUA 1H2HA 5HS4A 1PJBA 2HO5A 1TI7A 2V65A 5JCJA 3KM0A 2GZ1A 3QVWA 4YEDA 3ROPA 3GN2A 2J8ZA 3INGA 1KERA 3GUCA 5TC4A 5JNLA 1LC0A 1WNTA 5AXDA 1BVRA 4NBRA 2JD0A 1B16A 3GC6A 1C0LA 2EG9A 1WMAA 1ID1A 3INRA 3NTOA 4I5DA 4INAA 3L6DA 4HUJA 1CWUA 3JQGB 4BO9A 1JW9B 1ONOA 2O4CA 5COBA 1GD1O 2EXXA 1ZK4A 3GFBA 5JDIC 5ICSA 2I3GA 5KVCA 3H9EO 2FOIA 1DDOA 1N9GB 4XR4A 1EZ4A 4RDHA 5IDWA 1LNQA 1A71A 2J3JA 4E2XA 2FSSA 3ITKA 5TRTA 5KIAA 1T1RA 2JD2A 3JQ7B 5EERA 3MZ0A 1E7RA 1F12A 1QYXA 4J9UE 4YA6A 1I5RA 4OSOA 3RASA 3WQQA 1PJ2A 2GYYA 5T67A 3MJSA 1DC5A 1U5AA 3CMMA 4JK3A 2VQ3A 4UUNA 2GN6A 4CMAA 2W2KA 3OEWA 4IZIA 3RJ5A 3JQBA 1IOLA 1E3WB 3BXXA 5FYDA 2YV2A 2ZB8A 4BMNA 4YJGB 1H93A 1PJTA 3C1TA 4I9UA 1E3WA 2JFHA 4AJIA 3HFGA 1EQUA 3TWOA 1TVEA 2IZ1A 5ADHA 4Q3NA 2Y1EA 2RBEA 4XR9A 3ASUA 5AXCA 4BO3A 3B1JA 3RFTA 1R4NB 4ALMA 4Y8VA 4CLXA 1BTOA 1OBFO 3QWHA 3DOCA 4YAGA 3LZ6A 2BH9A 4JXKA 4NJMA 5BQFA 3BMQB 4Z0HO 2VT2A 1NM5A 1R37A 2D4AA 5JY1A 1D3AA 1B26A 3WNVA 2WWRA 4J9VA 2B4QA 2GUGA 2A4KA 4YAKA 2X9GA 4MP3A 1YJ8A 1EFLA 5DBFA 2VHZA 4N5LA 1C1XA 4EEXA 3E5MA 4PG4A 1XQ1A 3WX0A 2AEJA 3UFXA 1A4UA 4ZQGA 2HRZA 1QMGA 3DXFA 3MWEB 2EJWA 2C0CA 3BMCA 4F3YA 4YQYA 2E49A 4YB8A 1RYDA 1RPNA 3ZV4A 1BDMA 2HK7A 1DC6A 1EUCA 1W8DA 3EZLA 4TRJA 2YZ7A 3VC7A 1I32A 5JFOA 1UZLA 2C20A 2DLDA 2YYYA 3RBVA 4A7PA 3PHIA 3TF5A 1X1EA 3HB4X 2HMVA 4FFMA 2HRBA 2X5OA 4J2HA 6LDHA 1PJLA 1IULA 4JP3A 4LSWA 1RM5A 1HTBA 2W2LA 2VOJA 3ZCXA 3KYBA 1NPTO 1NXQA 3VTZA 1NTOA 3ZWYA 3AUTA 4PFJA 3BTSA 4YXFA 2G17A 5HBRA 2I66A 4NDNE 3LYLA 4FJ0A 1T2AA 3RWBA 3UUWA 4H15A 4CUZA 4J1TA 2FR1A 4KQXA 1NQ5A 1GV0A 4KQWA 4F6LA 4KDFA 4GAEA 1KS9A 1D4FA 1HDRA 3C7CB 3TL3A 3H5NA 4O59O 3Q11A 3TFQA 2YDXA 3KBOA 4WOKA 4ZD6A 4I9NA 3WMWA 1UXHA 2B35A 1QYVA 4P4GA 4BMVA 4XQCA 1R0SA 4TKLA 4ZA2A 4UREA 5AYVA 3ULKA 1VL0A 3D3WA 4GLOA 3IKVA 5G0SA 1A4IA 1Z73A 3GQVA 2BI7A 4BGEA 4HP8A 3ASVA 3H5RA 4RPJA 4NZ9A 1ISJA 2YW9A 2UV8A 3KTDA 3FNGA 1MXFA 2VHXA 2RH4A 4W99A 2TMDA 1W0CA 2PGLA 3RUHA 3DR3A 2IE0A 2NACA 1IL0A 2D1YA 3GPDG 2BMAA 2AQ8A 3KO8A 4FPXA 4CUKA 3NYWA 4F45A 5A1TA 3ORFA 4QEDA 1B2LA 3Q2IA 4NBUA 4OKNA 4PLHA 5TSDA 1NQTA 4DYDA 4TWRA 5ER6A 2Y0CA 3CUKA 1B14A 4I5EA 3C7DB 4QFCA 4A2CA 4BKOA 1RYEA 2CVZA 2JCYA 1ML3A 3JYQA 1I10A 5THKA 3NRCA 7MDHA 2O3UA 4K28A 3DTTA 2J5KA 3AOEA 3SXPA 1P1IA 2WEKA 3ZNNA 4RQTA 1LLQA 2JD1A 4KMSA 4BGIA 3DOJA 1WWKA 1BW9A 2WTBA 1ULUA 1ZXBA 1FJHA 3FR7A 3QWBA 3ZN2A 2HMTA 4J49A 2PTGA 3BMQA 3BMNA 5A5FA 3PFWO 1DOHA 3MOIA 4HXYA 4XIJA 1KOLA 1E5LA 4JBGA 3UXYA 5I7EA 4YBZA 5DOVA 3PQDA 1DSSG 1F8GA 4HBGA 1HRDA 3PYMA 3WBBA 3QVOA 2B36A 1I33A 4W9NA 3NT2A 4XYGA 1FDTA 5TNXA 3WLEA 4R1NA 4YJHA 4FC7A 3O26A 3L0DA 4ND5A 4BNYA 4FIZA 4CR6A 3W4JA 3WYCA 2BELA 1PGNA 5GY7A 2Y1OA 3RU9A 2ILTA 3JYOA 2NV6A 2VNSA 4OOFA 1E3IA 4J3FA 3KZVA 1UXKA 1MGOA 1A72A 2Y0EA 3IP3A 1ZO8A 3LVFO 3AU9A 3E1KA 4A5OA 4CMCA 5JAIA 3IC5A 1IZ9A 4Z0TA 1HE3A 3Q3CA 3D4OA 5I9NA 4E2WA 3HZZA 4H16A 2IRWA 4LSMA 3BA1A 1L1FA 4MIEA 3JQFA 4AG3A 2JHFA 5A06A 3A28A 3PYXA 2CF6A 4RVFA 3NUGA 4EEZA 2EP5A 2G1UA 5F21A 1QG6A 2OHXA 3FNFA 2A92A 2RIRA 2QX7A 2PNFA 5ES3A 1U8FO 3BMOA 3ICCA 2BFMA 4DTIA 4YJHB 1IE3A 2DTDA 1H6DA 5FFFA 2ZTMA 2NSDA 4AVYA 4Q3DA 3Q6IA 1DIGA 5JYEA 3E82A 1JU9A 3PFFA 4ZRMA 1NAHA 4B4UA 2FWMX 2DAPA 4DLLA 1UR5A 3DFUA 4NU5A 2DBZA 4CLRA 2JCXA 1H6BA 1SCUA 3ICPA 4OYRA 2WYUA 3O8QA 3TPCA 4DBVO 3WB9A 4TZTA 4MVJF 2Y1CA 3A9WA 1HEUA 3FTNA 4BUCA 3A1NA 3D4PA 5T8KC 3RJ9A 4RGBA 1ARZA 2C7GA 4HNHA 4G5HA 1LRLA 4E5PA 3LT4A 2AMFA 4LISA 3UICA 3RKUA 1C3VA 2PH3A 4IMRA 4W82A 4XB2A 2BD0A 3UAGA 1T2EA 2RHRA 3F3SA 4B7XA 2FZEA 1T2CA 3JQ6A 4ZGWA 4YT8A 4ZQBA 3OHSX 3DB2A 3AUUA 3PRJA 4FR5A 5C5IA 3RROA 1I36A 3BTVA 3MJCA 4AJNA 4QXMA 3K6JA 5GZ3A 5B37A 3VH1A 3H4VA 1XHLA 2ZTVA 1S6YA 3ROMA 1UH5A 4DA9A 1Y5RA 2ZIZA 1U3TA 1GEEA 2GN4A 3PWKA 4RZHA 3DMTA 1LEHA 3BTOA 3JYLA 3K2BA 3EY4A 4CM7A 3WGTA 2IYPA 2BHLA 2Q4EA 3EGOA 1V9LA 1HDXA 5AXBA 2HDHA 3E48A 4XX0A 3G1TA 2AQIA 3U4DA 1WDLA 4D0SA 1OC2A 1WPQA 2O3JA 3D1LA 3F1KA 4CV0A 2R2GA 4K9DA 5A03A 3V5NA 3DZFA 4PLGA 1DFGA 5JW6A 3DBRB 5ER9A 3GGGA 1YVEI 2GR9A 4NNJA 4A10A 2Z95A 3K31A 3E9QA 4XDYA 4P4NA 1SMKA 5F5LA 3KVOA 1YQGA 1R4MA 1VPDA 1MLDA 1YL6A 3WXBA 5KVSA 4GMGA 1SB8A 2OBNA 3OQ1A 2C5EA 3U49A 1U3WA 2SCUA 4EUHA 1R15A 4Q39A 2H63A 2YQ4A 4R3NA 3SBOA 5DCUA 2F00A 4U0KA 2BF7A 1H9BA 1T2DA 3H5AA 4GMFA 4KUEA 1TT5A 2NU6A 1DFHA 2VWPA 4RQUA 4CODB 4PLTA 1E6EA 4R68A 4PG7A 1FDVA 1CETA 4M89A 1NQOA 4RZIA 2HUNA 3RUIA 1J5PA 4DLBA 4RL6A 5JY6A 1KEWA 3AU8A 4CLDA 4Y6PA 4TRRA 1LSJA 2OBYA 4IJKA 1T26A 2ZJ0A 2AQHA 4NPCA 1H2BA 3WSWA 3CXRA 2BGLA 4YDRA 2PKQO 4PRLA 1F0YA 5DP2A 2AHRA 2O50A 3I9KA 4YPOA 2E37A 4TQGA 4AJJA 1KBZA 2OP1A 5I7VA 5FF9A 5KOIA 3CH6A 3WGGA 4BNKA 5COQA 3VVBA 4FFOA 4XWYA 2YY7A 4YJFB 4YT4A 4U0JA 3RUAA 4WJZA 4EJMA 1DRVA 5T5QA 1YQDA 4IDDA 3OIFA 4UVDA 4XD2A 4BQPA 1HXHA 5A4DA 1HE4A 4CMIB 3I6QA 1QYWA 4ALKA 5JAZA 4KUGA 5B4UA 4DUPA 1LC3A 3GA0A 3I9LA 5DT9A 1TXGA 4ZRNA 1E3SA 1Z6ZA 3VPSA 3WWYA 3U4IA 4ZQFA 1KEUA 4L75A 5IN4A 1TEHA 4E13A 1HETA 3GDFA 2X9VA 3DBLB 3FPCA 1UZNA 3GEGA 3S2GA 3N58A 3B1FA 1ZIDA 4M55A 3VH4A 3WWZA 1NHWA 1E7QA 5DP1A 4FFRA 5L7TA 3AM3A 1NPYA 1KY5A 2RH8A 3FPLA 3TZKA 5KKCA 3DC2A 2DUUA 1JAYA 1P1KA 5EMHA 4E5MA 4CMHA 4W6ZA 1LDMA 4RPLA 1R16A 2P5UA 3W8FA 1LBEA 2D5AA 4MIYA 5I7SA 1PZGA 2G5CA 3TJRA 1GAEO 4XRGA 2Q4BA 4LVUA 3DZKA 2PWZA 3HQ4O 4R41A 4MO2A 4YWJA 2QHXA 1DFIA 2JAPA 4PZCA 4MJLA 3LU1A 4K26A 2Y66A 3RQSA 4XGNA 5EINA 1KVTA 3WGIA 1EVZA 1N92A 2C54A 2FN7A 3WGOA 4EBFA 4RF4A 4H3VA 4ZU3A 4FFNA 5CDYA 1RM0A 1AHHA 1E6UA 5KJ1A 3LC1O 2Y1GA 1PTJA 5IZ4A 2UUPA 2Q50A 5HRUA 1U2GA 1LDNA 5BSGA 3S2IA 3WGQA 4YR9A 3U4HA 1FDSA 2BGKA 4OH1A 4I5FA 4TZKA 4EDFA 2C5AA 4YYZA 1VI2A 3AI2A 3E5RA 2EW2A 1G6KA 1N1GA 1GYPA 2HKIA 3PGXA 4RVHA 4IDEA 3T7CA 5A9SB 1T1SA 1NP3A 1P1JA 1E3JA 2FPGA 3ADPA 2Z1NA 1HZJA 3C3XA 3KV3O 3PJFA 4PLVA 4E5KA 1CERA 3UCXA 3PHLA 2V6MA 1A5ZA 4ZQHA 4CLRB 4OQYA 2F1KA 1ZXLA 2ET6A 1DBVO 1DO8A 3KSUA 3O8QB 3JQCA 3PVZA 1Z75A 3GNTA 1RM4A 1GU7A 3PZRA 4IGEA 2NU8A 2CY0A 3BIOA 1E0DA 3BTUA 3ONEA 1JWAB 4GX0A 4JLWA 4OXNA 4XYMA 5F3RA 4HNGA 4RJTA 4I1IA 4BNTA 3NGLA 3S1LA 4MVJD 1SEVA 1Y6JA 4KTTE 2ZJ1A 4U5QA 2X0JA 1YGYA 3QY9A 1I2BA 4WKGA 3SJ7A 3WICA 4OL9A 1JDJA 4XCVA 3WYEA 4B4WA 2B4RO 1GZ6A 1RM3A 1F14A 2VHWA 4OM8A 3DHNA 3KETA 5HA5A 3H9JA 1WAMA 2A9FA 1PSDA 3WIDA 3NTRA 2IODA 1XG5A 3KYCB 1SOVA 1ZSVA 2GGSA 1W4ZA 4FGWA 3QVSA 5THQA 2J3IA 4CM4B 4OQZA 2NQ8A 4J4BA 3U3XA 4ONEA 4GX5A 2IYOA 2QZZA 3M1AA 4UVIA 3KEOA 1BXZA 4CQLA 1X7GA 4NQZA 3OP4A 3ANNA 4IZHA 4S3MA 1GYQA 1BSVA 4IY1A 4PLZA 1EFKA 2ZTLA 3CE6A 1PQUA 2P9EA 1GEGA 4E0BA 2GN8A 1Q0QA 4L0QA 4R51A 4ESOA 2CVOA 3EVNA 1XLTA 5CAEA 1VJ1A 1ZKMA 4TVBA 4URFA 5CP8A 1CYDA 4KTVE 3OIDA 4WEQA 1VL6A 1R6DA 3AJRA 5L95A 4DRYA 2B69A 1X7HA 1PJSA 1R0KA 2E6UX 2XXJA 5TS3A 3VKUA 1QV7A 3JQAA 2ZQZA 4NBWA 3TZ6A 3ZWWA 1YQXA 4C4OA 1GQYA 4BNNA 3K92A 1H94A 4L4RA 4OHUA 1GCOA 1SPXA 1E3LA 3HSKA 3RUEA
chains in the Genus database with same CATH superfamily
1G7RA 3FPGA 3AEQA 4RTSA 3R9XB 3T3IA 3P0EA 1VKNA 2YWDA 3GRRA 5L40A 5JYCA 3H4TA 4UEQA 4I9GA 5ELLA 2PFGA 3A6JA 4PO3X 1Q6YA 4OXYA 4LF4B 3GFFA 4YAIA 3H2YA 2BZSA 2QRGA 3NG1A 5ECYA 5BOVA 1UKVY 2PD6A 3GCZA 4LMAA 4Q1EA 1YDMA 1OBCA 2FN3A 4HGNA 1BGWA 3D3QA 3T3GA 1NGSA 4JA2A 4B73A 4DQUA 3SC6A 2Z5VA 3EGIA 3ZWPA 4MUYA 4MDEA 2A0XA 4DREA 3I04M 1NPDA 4D5GA 4C43A 1X92A 4FI3C 3C8ZA 2DFPA 2J09A 2WWFA 2HA4A 1YO6A 1IK6A 4KWIA 5JI2E 2IZ5A 3IT2A 2WM2A 4DYVA 2X0IA 1AF7A 3TRKA 5KHAA 1PGQA 1TFUA 3OECA 5TQ2B 3CNBA 3H16A 4HVLA 1HRKA 2OAQ1 3LDHA 1H0RA 3S28A 2QGFA 4URYR 1DKQA 1D9XA 5E9JA 4LF6B 4E4RA 1XVVA 2GEFA 2I03A 4IOLA 4JWKA 1J8MF 2IVFA 4FYKA 1YB2A 3GLQA 4LOLA 5G1NA 3KEQA 4FM9A 1TAUA 1X13A 3W2IA 4G23A 3UAOA 1JXOA 5EKDA 3HG7A 2ZYGA 2C42A 2UZ1B 1LK0A 5IJZA 1D6SA 4EPRA 3QIAA 1GZUA 5LU8A 1S2IA 5IBQA 4Q9IA 1MC4A 1TF2A 3U26A 3BJRA 1Q7CA 5JJIA 1MG0A 2VPYA 3OQIB 4DLSA 3U1TA 5H80A 5GPBA 1DDGA 5CFZA 2VTBA 4LGMA 4YJ2B 2F9FA 2YNMC 1XMIA 2QTHA 3SGLA 2CJFA 4DXHA 4ZEVA 5LMZA 2Y93A 3BFJA 3D3JA 5BVGA 4FWBA 3ZCSA 4PZ0A 1GN9A 3GB9A 4YWHA 3IBSA 1A8SA 1J1IA 4P3NA 1KETA 2YVUA 4KE8A 1ETHA 4XEHA 3RYFA 3JPYA 3WMRA 1QQ6A 3A6ZA 4FI3F 2YQ5A 4EKNB 1MFPA 4BC0A 3T41A 2FMFA 3AUSA 2ZUBA 3S8EA 1SK9A 4D9BA 2V3WA 3RYHB 5C5CA 2B1QA 2WAOA 3GMSA 4X3CA 1J0CA 3M6MD 5HIKA 6NULA 5IASA 2IX9A 4KO8A 5JT1A 3GJXC 4ZAGA 1SUCA 1AQIA 3K73O 4TL7A 4ESHA 3LY9A 4FZVA 5DNWA 1XFAA 4ECAA 4UBKA 5JMPA 3UXHA 2PS3A 2NXNA 4LCEA 1UDXA 5DTEA 4CQMD 2J3MA 4Y2JA 4DM4A 2H7YA 5GWXA 3NHUA 4RK0A 3O4RA 3QV1A 3HYLA 1NYLA 3H84A 5F1YA 4NBVA 3NNDA 5HNKA 2I2FA 2Q2VA 4IEIA 2PGAA 1BCSB 2CHQA 3RK4A 2WTMA 3ADOA 5FNVA 1VSVA 4ARSA 5LP6A 4URWR 4D8VA 4F2DA 1AJEA 4DFDA 3JQQA 1M6EX 4ZP1A 3FNHA 3YASA 1JTFA 1IXSB 1F06A 3ZDRA 4YMVA 3F5MA 4ZOQI 5CFNA 1KC3A 1O0BA 5IUNC 3LF1A 4CIDA 2ZFUA 4HGOA 5G3ZA 2QORA 1LK5A 3KXDA 3TM4A 2ZYUX 3UJ9A 3KHTA 5T7BA 4FKMA 1SKAA 1X80A 3B9RA 3VHRA 4LI3X 3SHQA 2QN8A 2VT3A 4MCAA 1GTVA 1K9SA 3ICWA 2ZR0A 2PKYX 4RLFA 1BVYF 2GLXA 3RODA 1GNRA 1PR5A 1DCMA 2GRUA 4C0QC 1QVAA 4ZEMA 4MJ7A 5BYKA 2QMZA 1A69A 2PGDA 5B58T 4AZ0B 2XNDA 4CKWB 3WYAA 5LMCA 2EBWA 2W2LD 1EIWA 4X6XA 2VHJA 4OI4A 4LXHA 3T7EA 3WMXA 1MB2A 1QGYA 1V5WA 4A8JA 4B7CA 1M5RA 3DL7A 4RE6A 1SOWA 3Q2KA 1UPUA 3A4VA 1HDGO 1NF9A 1P17A 2ISCA 5LN1A 3GRVA 1NUSA 1A5AB 1VGRA 3CLTC 1DE0A 2AWNA 1R0BA 1EBBA 3PNMA 4C6SA 4P2BA 3C3AA 3VQTA 2C2GA 1RWOA 1T3ZA 2I71A 1FRNA 2IE8A 3P97A 4FFVA 4RVSA 3U4MA 1SRRA 4ZYVA 4TKMA 4P92A 4WLUA 5JZ9A 5J23A 3PWTA 1GSHA 4L78A 2WB2A 2Y1KA 3F7OA 4LXUA 4YPFA 3AVXA 3D6HA 2D06A 2OILA 1SPBS 2P4HX 4FC6A 4H7KA 2X1LA 4HK4A 1MXHA 1RPJA 4KQIA 4X7BA 5IYZA 5JQGB 2MSNA 5E3IA 2EQAA 1W6RA 2FEOA 2N46A 2O3TA 3MSXA 4HAYA 4J75A 1F0KA 4LS3A 4UFNA 4ALJA 4P3KA 4E7PA 1A9PA 1Z17A 4MV9A 5SY9A 4TN1A 1K92A 2WWYA 1K8XB 2EOAA 3OQOA 2FKNA 4BX9A 1NR7A 2G8LA 2NU9A 1E5QA 3HO1A 2ZROA 5LIPA 5JJLA 4OAOA 1GDHA 1U4SA 5EIOA 3W05A 3LVBA 2B5OA 1RYMA 3M6LA 3TTXA 3J7AC 1QZ3A 3I9V1 1K66A 1XA0A 3HDHA 3DKRA 5JS7A 2R6DA 3ISTA 1JIJA 3IAM6 4JI7B 1R6AA 3H9GA 4WXMA 3MG9A 4NZOA 2G7MC 3QE4A 3S1SA 1K63A 4W5JA 1B1CA 1OB2A 2ODTX 4AJHA 3HA2A 4L6AA 3DVAA 3M5DA 1WZEA 1QNLA 2X8JB 2ZJAA 4HJRA 4Y1RB 5DCYA 5HE8A 3SZMA 4BAZA 3EPKA 4NV0A 1M8PA 4I19A 3IH5A 1TJPB 3G59A 4M0PA 4YMWA 1QKJA 1W8IA 3SXJA 5TMPA 1H6CA 2CFRA 3Q3JB 1H9AA 5AJVB 4ZZIA 1AQJA 1VECA 1QQTA 1XTQA 1EP2B 2VKQA 1R18A 2ECFA 3RI3A 3E8SA 3EGVA 3TM5A 1Y8QB 2ZSHA 1OFGA 3B3FA 4G56A 4EG0A 1V7QA 3FMVA 3AW8A 4BV8A 3KTOA 1DOZA 2HQ1A 3W5HA 1EAYA 2WVAA 1QTQA 3EOBI 4PPYA 2G8NA 2FFAA 4Q66C 1CQJB 2ZI6A 3O21A 3G9XA 1WXXA 1E1MA 5KYYB 1U8UA 4QYWA 2FPRA 2W2QA 3QKWA 3M2TA 4D4GA 5AJXA 3QF4B 4KR2A 4C04A 5IWCA 1ZNZA 3ROGA 3N7AA 3RSHA 2X7JA 4CIYA 5CLFA 3D7KA 1VHDA 4CEHA 1J0DA 1GDDA 1EJ6A 1P0IA 3KE8A 3G3EA 5D3ZA 3D4BA 1P2DA 1E9AA 1SXJD 2BI4A 2VP9A 4IUYA 1KYXA 1YD7A 2Q27A 3HWX1 4IXTA 1NDQA 1W35A 4YAOA 3PQ5A 4UMVA 3ROFA 3AFHA 1N0VC 2ZIGA 3IT0A 4P58A 2J6IA 2IEGA 3K1TA 3VI4B 5JSHA 1FNSA 4HWOA 4BFWA 2PRYA 1LS1A 4KMMA 2J5BA 1HH4A 2CMFA 3RIGA 3T7JA 1J21A 3OC0A 3V46A 4KO1S 2BMJA 3QXSA 5ECGC 2RKWA 3PNLA 2WNSA 4O5OA 3E3NA 2Q1SA 4MVJE 3QNUA 4QWMA 3LT1A 2PQ2A 5DBEX 5CH5A 1YCFA 1PUIA 3R5KA 5AESA 1IEQA 5EP2A 1Z7BA 3PGJA 5IBRA 2E4WA 2R8OA 2EP7A 2I9PA 3JQBC 4N8SA 4YRQA 1TQ2A 2B25A 4REMA 3RRXA 2JJQA 4RWZA 3NBKA 4F4DA 2D4HA 2E82A 3UQZA 3H65A 1FMCA 2VH5R 2HADA 5EFZA 1NDHA 1OT3A 4UMFA 4D79A 1CFZA 2G4VA 2NU8B 2G08A 2Q4OA 2AUTA 3S2FA 1I3OA 4DMHA 1WULS 5AHOA 5BMVB 5JSFA 1J4AA 4NCNA 1NX6A 3UEOA 4PRYA 1RZVA 4BNLA 1C3OA 5IK2D 3LYUA 3LIIA 1U31A 3WRYC 2IITA 2P5SA 4MCIA 3UGKA 2ONKA 3NRJA 1G2OA 1JAHA 1WPXA 3GJ0A 1FFDA 4WLFA 4UASA 5EJFA 3EGXA 1CF2O 1G9XA 3VOTA 1FJGB 4O1MA 2QUJA 3DO5A 4TYQA 4DR4B 1MG5A 2A86A 1BE1A 4M1SA 4RWEA 2A94A 3OEYA 3OHMA 4NNOA 2P9JA 4X71A 3TQSA 4D5EA 4MRMA 3ETNA 1T4DA 5HQTA 2PGIA 1BWQA 1ECLA 2KLBA 2P6MA 2C95A 1J2UA 3N53A 1IPEA 2JF0A 1CE8A 3L7AA 1DU4A 1Z0UA 4Q7MB 3AM4A 2CV1A 4Q4JA 3DMNA 3TDNA 2GPYA 5DGHA 1JQBA 1Q7RA 1JS1X 4ZRDA 3ZEIA 7REQB 3FOAA 1QVZA 2QTNA 4NEGA 3I23A 3U81A 1PN3A 2PCLA 3IB3A 1YBAA 4RHCA 3TVYA 2QRVA 4JI3B 3PI6A 4HH3C 3K0CC 3GJQA 3ZWAA 4B3MB 4B6SA 3DEYX 4P22A 5AOCA 3WNQA 3MCWA 3F5DA 1I4OA 3PD7A 4FK8A 1MVLA 1YUNA 5CGZA 3EVGA 1YQUA 3GLFE 3TMKA 3UK0A 3BGIA 3EEIA 2JGJA 1LZLA 1KJQA 2B2CA 3D3EA 2OHHA 2MSWA 2JGMA 5GZ1A 4RJ2A 3QEAZ 1P19A 2QQGA 4N6GA 2ONJA 3OMXA 3GLHA 4Q1FA 3ZU2A 3M70A 4QYIA 3T7RA 1I94B 2QV7A 4HCJA 2Z6UA 1A27A 1K6EA 2JS7A 4BKQA 1RCTE 4KO3S 3U4QA 1O0SA 2PT6A 2XECA 1JDTA 1V41E 2ZBQA 3G2PA 4G65A 4X20A 3ODGA 5ALZA 1I2AA 2ODQA 3WS7A 4DJAA 1ZOSA 3H2SA 5JE8A 3PWSA 3GGJA 2DPYA 3LCMA 4PXAA 3UNXA 1R6BX 1DHRA 5KPJA 3G2QA 2EFGA 3QXCA 4I1YA 1RRVA 4RACA 1GL6A 1QLHA 1AQNA 4W9MC 2W2KB 3AVTA 1K8ZB 3AESB 1DC4A 1EE9A 1BMDA 2XGOA 5CPFA 3FMOB 3V8MA 4KHZA 3TW8B 1JDPA 3H86A 3D31A 3LC0A 3I5YA 1MR3F 1GV1A 2W11A 2LCQA 3UYKA 1Q12A 3F4LA 1XMQB 1NP6A 3LL7A 5CCDA 5BSHA 3WWEA 4D9KA 2IXAA 2C2HA 2ZYRA 3M4YA 1ZK0A 3H0EA 3QX8A 3ZDFA 1KTIA 3L06A 3GVIA 2OT3B 2WIBA 4M9CA 3ZGVA 4BQRA 4C22A 2GS9A 1YFLA 2XLBA 1QOZA 1KQPA 3G13A 3JAWB 2XQVA 3BJZA 1G5IA 4MV6A 4WH0A 4EUFA 4S1WA 4UM5A 1AHIA 4P82A 3LWDA 4DIUA 1XEWX 1R6XA 1N2EA 4ZYZA 1F3LA 4YI5A 1ZJ6A 3GJ6A 4EPYA 3B89A 4QE3A 16PKA 4LZZA 1V96A 1MEJA 3LUBA 1ZMTA 3N8NA 1N75A 1ZR4A 1KIFA 1JWBB 5DTIA 2GZ3A 2PZJA 1MIHA 2RKBA 2CXXA 4HDQB 2WG1A 3CB4A 3WMEA 4JUAA 1FLAA 3DE2X 3LW8A 3U5TA 2C78A 5C4GB 1CUSA 4INPA 3UK1A 5C8YB 4Z4QA 4DGSA 1JMVA 1MVOA 2CKMA 1XJ0A 2PUAA 4I99A 4R9NA 3ZHYA 5F7XA 2DBRA 4Y1FA 4D3SA 3DL2A 1OLUB 1SK8A 3HDTA 2HNKA 2H9IA 1A97A 3L8GA 2GBIA 3QWFA 1ORRA 5AHWA 4Z4HA 3V2GA 3KOWA 2OVFA 1NN5A 1YFZA 3BXZA 5F76A 5IN5A 4KBYA 4AB1A 4EG5A 5IT0A 4JJKA 4EB8A 1N0HA 4IHQA 2PPLA 2W6JA 2AVDA 4G84A 4QU0A 4ZCPA 2Z8XA 5LB4A 5KQPA 4MNTA 1RZRD 4MUFA 5CNKA 1QXSA 1TZJA 1T8UA 2QX4A 4IDBA 3RKRA 2QPOA 3ST7A 2BFPA 2H6EA 3IOMA 1JPNA 1IHPA 3LT0A 4LXYA 1FTWA 4IQ0A 2QRMA 5KWEA 4BZPA 3CJRA 4FFLA 3ZXUB 1SKMA 5L7YA 4TWBA 3W8NA 4BKUA 1KVQA 1L4FA 4F4CA 1A3CA 3DMDA 1C9DB 3DZHA 4KE6A 3MOGA 4MOWA 3N0RA 1ZKDA 1HT3A 1RWKA 1ZUD1 1I6KA 3NPMA 1F6WA 3C5CA 4KDEA 4D6XA 1SO8A 2DR3A 4Q4LA 3PEVA 1JU4A 2R00C 3ZE2B 4WNIA 4C88A 4PS0A 3U0BA 1RRKA 3FNEA 3KTAB 4NNPA 4YRCA 3OU7A 4UNIA 1GRNA 3ETJA 4J0CA 2PBZA 1TYDE 2I6TA 3OUZA 5K4AA 3T9CA 4B84A 4I5GA 3DDNA 1NV9A 3ROKA 4EPTA 3D2BA 2A9PA 4PRZA 2ZATA 1HDCA 1UIMA 4WLNA 3NIBA 3KKNA 1U8EA 3VO1A 4MQ5A 1FXSA 2VDQB 3VM6A 2XY4A 3K70C 1DLJA 2UXDB 4B79A 3TDKA 1LLCA 3GZ4A 3L8ZA 3UFXB 3D5TA 5C8ZA 3FR8A 3SVTA 2UUCB 3C6QA 4JQSA 4UD6A 3ENZA 4UFOA 4C7KA 2HCRA 3R7WB 1PWXA 1V2GA 1J7KA 3N07A 2AK2A 3P0FA 4WCFB 1O96B 4LDJA 2P4EA 2X41A 4GWKA 5FBKA 1MZVA 5EZQA 3DTYA 4BXOA 4FDTA 2QP9X 1GCUA 1T1GA 4IS3A 3TKYA 3UWPA 1YL7A 1PUJA 2HOQA 3HACA 3P2JA 4YAWA 4XWWA 3MOSA 5JO9A 4UNPA 2BM8A 1TT7A 4GC5A 2QTTA 5AKEA 3MINA 1Z68A 3C1UA 2A5YB 3AQIA 4KQKA 1JRLA 1TGYA 3I53A 3TRDA 5JSZA 5CHYA 2O5EA 2IQIA 2COUA 3SJBA 1FLDA 3K5IA 1LDBA 4ZO4A 1DAKA 2B8WA 2IEDA 5BQPA 3ZY4A 1G1AA 3CHYA 2HD4A 5T6BA 4WGGA 4EPXA 3IESA 4Q6WA 1CUUA 2JIZD 1QU2A 1ESCA 3KVRA 1BD4A 2UYCA 2Q46A 1I2DA 3QPWA 4HZUA 4YECA 1D4AA 5GOTA 3NHPA 3G0DA 1U1DA 2R8XA 1XPUA 2PZKA 2QAIA 3PQEA 1JHZA 1EK6A 5KYKA 3NVMB 1QPZA 1GG5A 4UDXX 4B8WA 4RF3A 4D43A 3BHIA 3OF5A 3RIXA 1E9VA 1GQOA 1P33A 2CD9A 3PDUA 1CC1S 3OMWA 3T0GA 3ZKWB 2GCEA 2HLPA 2QPLA 3COPA 2OFPA 3K9HA 4LNAA 4YGXB 5DBOA 4UZSA 3FGNA 3OLVA 4L7VA 1DARA 4NYIQ 5EWLB 2HA5A 1AC5A 1HF3A 3D8HA 3HB9A 4HXFB 3WFZA 5AI9A 1QWSA 2FWIA 3P4UA 3R4VA 3VYWA 1GADO 1MF7A 4BQNA 4Q6BA 5DT2A 1TTTA 2PS0A 2ZR7A 2ODEA 4YCNA 1AIPA 1JX6A 2ZB4A 3NDBB 4BLVA 1GJRA 4IXWA 2C4MA 3PI7A 3SYLA 2WUGA 4BNHA 1TYCA 3PHCA 2X0EA 1NLFA 2QRKA 1R9NA 4IIJA 3RF6A 3SF0A 1SULA 1UKYA 4RK1A 3AR5A 2DUNA 4P98A 3Q6MA 1NVMB 1XQ9A 2JGRA 5HGJA 4GDFA 3O0TA 4RMIA 2ZJ6A 3CIOA 3KDAA 4RDIA 3SDZA 5HBGA 2X2OA 3FY4A 2BJVA 1UOPA 1QRAA 4I6GA 5ENZA 3SXUA 2AL7A 2G67A 4MP6A 2B9EA 3S1AB 2X7HA 1D2CA 3EGWA 4GVXA 3KE9A 4FB5A 1BMQA 2GN1A 1KFBB 3T1VA 4EUKA 4WKBA 2VJMA 4UHEA 1JIQA 4AURA 5ARBA 4ZYXA 1SA0A 1XRNA 5KI6A 1TJ5A 2C2KA 4FNOA 2HWXA 1L5HA 3K05A 1CVIA 1SU6A 3GAFA 2XXAB 1SHLA 3ZVKA 1JMYA 1GGFA 3L4SO 2RJ3A 3K9LA 4R5MA 2WC1A 1RP7A 3Q1LA 3S70A 1P3DA 1WXWA 3KJHA 3UZUA 4R6WA 4EB3A 4YV7A 5BWLA 5J4KA 1X77A 2LDXA 3B82A 2FFQA 1UAYA 2AH5A 4BMXA 1FP4A 5IJ0A 3HKBB 1OVMA 2ASVA 3QSGA 2ZE7A 1CCWA 4MINA 2F3QA 1L5KA 3AFOA 3GEHA 5EMLA 8ADHA 2DT8A 2WWWA 4CIBA 1VMEA 2AEMA 1ZI6A 4XQ9A 3TNLA 4RTOA 4X97A 4P38A 5C1PA 3L5OA 3WTCA 3SEFA 4BJ6A 4BFXA 5AM0A 3OZFA 4S1OA 1W36D 4TUYB 3LUCA 4JI6B 1RT9A 2BMDA 1YS7A 4I8XA 3BN3A 5H4HA 3GVCA 3BXOA 3LCRA 1QHEA 2AC2A 2ADMA 3HN6A 4Q12A 4OHRA 3H9QA 1ZSNA 1GITA 1NI3A 4DMLA 2XRMA 3E7DA 4ND4A 4OKSA 3HC7A 1JR3E 1Z6PA 3QMMA 4IIYA 1AVTA 1K08A 1BWRA 3L2OB 2A88A 3AM5A 4BNVA 4WNAB 4FFDA 3PCXA 3FWPA 3A3NA 3RK1A 4MYSA 2HL6A 2VWQA 4H4EA 3E27A 2C07A 3V8NA 3EIOA 4LJ9A 1C9JA 4RUKA 2GNAA 4KIGA 2HQOA 1REQA 3R6TA 4HLDA 4QO7A 2GXUA 3PEFA 5EE3A 1TUBA 1R64A 3Q5EA 1CJVC 4BC1A 2ID9A 1V1MB 2GM5A 2HUPA 1MT0A 1A9ZA 1I1QB 2Z4RA 3TB6A 4BJ3A 3IPAA 5M29A 5A5EA 1EUZA 3UBTA 2XXBA 3GH3A 2IYYA 1CUXA 3LRPA 4W5OA 2P68A 3OZDA 4FDLA 3QVTA 2DP4E 5I3ZA 1EVYA 3SMVA 2PXCA 3N39C 5TVKA 1SFRA 3RGGA 2Q6KA 2NO9A 4EYKA 2XAAA 3U9TA 1DQSA 1YR3A 1GNPA 4KNVA 1T34A 2GA9A 5FWXB 1D7OA 4WAUA 4TKVA 2XYRA 3SK0A 1HYHA 5ALRA 4IEEA 4NONA 4BVAA 3IP8A 1W2GA 2ZUSA 4MB6A 1RHJA 3AT1A 2I3BA 3L8HA 2F48A 4W63A 1PJCA 2AYYA 3RIYA 4HX2A 4POAA 1Y3FE 2XDAA 3N5CA 2O4UX 3EIEA 1U02A 5H59A 3TS1A 3VJLA 5CEJA 4RTPA 4TSKA 1Z4OA 4NJEB 3O1IC 2EIHA 1HMYA 4IRXA 1AHNA 3HUTA 2G0TA 5EUQB 3RVKA 1JE0A 1I6LA 4RMJA 3S7ZA 4R71A 1O5TA 5AVQA 1RRGA 1YU6A 4CEHB 1G2PA 2PSFA 1OV4A 1TTHA 2UYOA 4X66B 1XLTC 4B34A 1A8HA 3DA8A 4Z99A 4O2AB 1JHAA 1IYZA 4MROA 1CUCA 2BMFA 4OGGA 4PIMA 3UENA 4CMEA 1YDWA 1JLMA 2PLNA 5IEJA 4CN8A 4LYEA 2FN4A 2PK3A 4NU0A 1MMFB 3B52X 1TAQA 3GD5A 2F2TA 1XPRA 1GR0A 4MKRA 1NR5A 1L7XA 5FXMA 3HEMA 3TXXA 3L05A 4Q3CA 1EB9A 1Y1KE 3T1QA 2F3RA 3B6EA 3BB1A 3E7WA 4ZPJA 5BWBA 3BREA 1GUAA 3T3NA 4EB6A 1ZBQA 1TC1A 4HKTA 4U3JA 3CZ9A 1NLZA 4GXTA 4RORA 1U8XX 4EI8A 1B0PA 1BN6A 1K5HA 2PZ8A 3N74A 1D03A 2J32A 3ET5A 4FR2A 4LBWA 1SC6A 3LIPA 2VP5A 1A8QA 3FOZA 1WHTB 5SZHB 2C04A 4XYBA 3WKBA 1IWPB 2X8JA 1AB6A 2OCGA 2WFMA 5K0TA 3EUEA 3E4DA 2NVWA 1XF9A 1VCNA 5AR1A 3PPIA 3DDOA 3UOGA 1O6BA 1PIWA 3OZ7A 4LZOA 3ETDA 3ZDQA 1G0OA 3TW8A 2EYUA 4MIKA 5AQ1A 1WCV1 3ZLVA 1M67A 1JHRA 3VR3A 1U1FA 3WL5A 3HU2A 4AMUA 1PZEA 1L6RA 2D1RA 2JCGA 5MDHA 4WECA 1O6ZA 1T1IA 1V9CA 3ZV6A 3W5DA 4RHTA 3DAPA 1R0WA 1N6IA 3K2EA 4KJZA 3BKWA 3KCNA 1PJZA 2AW5A 3VRHA 2WTEA 3TPFA 5L4LA 5CYOA 1T2UA 1R6TA 2DSNA 4R54A 3T3DA 5ALNA 1BXGB 4QX6A 4G0WA 3VR5A 2VDWA 1X1TA 3AL2A 3ZK8A 3BULA 1T9GR 2BT4A 1BKDR 4C2UA 1J99A 2H5IA 1XZMA 2D13A 2PMBA 4NSNA 2BFBB 1JT2A 1NLUA 1X7XA 3R0QA 3ZHVA 2H0RA 4DAEA 2G3YA 3KQOA 1E5XA 1ZA1A 1UKZA 3BH7A 3DFFA 2BP7B 1PFWA 3HBNA 4M54A 4ZT4A 4EYEA 1EWKA 3ETCA 3O7WA 2PFKA 4J16A 1XEWY 2BTQB 3C14C 5E4YA 4WZAB 3RYIA 4EG7A 2JANA 3A2LA 3C1AA 2GWRA 3DS8A 3PKJA 2NTVA 1HNZB 2XQGA 1SC3A 1NI4B 4K5QA 4PG6A 4RESA 4PBRA 1SHZA 4RIGA 5IC5A 1G8YA 1TNDA 2D1QA 2X23A 3HB5X 3JVDA 4J0GA 3HBJA 1LD3A 2PVCA 2QKYA 3G8CA 4PZAA 3TLAA 1VQ1A 4YMIA 4N5MA 4AZ0A 3ERCA 1XT6A 1Q1BA 5AWFC 1UZUA 3IUYA 3Q5DA 1O94C 4NBTA 1NW9B 3OX4A 4DNFA 3DNMA 1YCDA 1NXSA 3PX3A 3ZXYA 3S29A 3WYFA 5K0SA 5GVSA 1UMCA 1NIPA 4WD3A 3ZD6A 5AKYA 3A26A 2EBFX 4KW7A 1Y3HA 3W6UA 1E9SA 4GPD1 4EEKA 1VMDA 2IEAA 2G40A 2XE8A 1OPXA 4J4TA 2XADA 2W2MA 5KTKA 1P9OA 3HCFA 4IM7A 1UWCA 1P75A 2I3ZA 1UBNA 5A05A 4MQBA 3ZOKA 3VKHA 4IX9A 1N6OA 1Q16A 1PO7A 1Q11A 1JN0A 3IDOA 4JYCA 4LW8A 4PLFA 3AKYA 3SC3A 1FDIA 1U90A 1O89A 3LHSA 4OJNA 4J7UA 1T4MA 1J22A 5EUMA 1QR6A 1WMFA 4NC9A 5AUNB 5BUCA 4EAAA 3EXHC 4M1EA 1A2QA 3LLUA 1LBSA 1H8EA 3PUJA 4YV1A 1H1LA 3SF8B 3IOYA 2BF4A 3PQ2A 3VVLA 3AF2A 5BWNA 2J48A 2CSXA 2EC5A 5HP4A 3PYLA 1J0XO 4LJLA 1YT5A 2WJAA 2HFJA 4OB7A 3ECSA 4Y7DA 3ZPXA 1DIOB 2HAEA 2BZ0A 4U8GA 4RF2A 3WLQA 3THWB 1Q2UA 3NIWA 4F4JA 3U4CA 1IAQA 3IQGX 4L7QA 5F51A 1U8ZA 1P1HA 2G80A 4OP1A 1XPJA 4A4DA 4TVSA 3IHWA 1YB6A 4I1UA 3K1AA 4CLHA 3K71B 1F2UA 1RJ9B 2IYQA 1R8QA 1G98A 2IK8A 2QV0A 2QNBA 4OEHA 4QDJA 4OKIA 4PYQA 2B1RA 3I2GA 3N6VA 2ZTUA 2H59A 2JA1A 1Y9ZA 1D04A 4IMPA 4C5BA 2QRPA 2Y71A 3BL8A 1JEDA 3GCGA 3QXHA 5E6UA 1O6CA 4DAOA 3CYFA 3GWGA 3DEIA 3FHOA 3IA2A 3QP9A 1PYOA 4EZBA 4Y6RA 2ACKA 5L8VA 4DLUA 4OLAA 5DF1A 5B1DA 3ZEAA 1Z16A 2WUVA 2BFBA 3BERA 3NYQA 3TEMA 5JNSA 3MWGA 1I3CA 1QRUA 4M53A 1T9BA 1N77A 5KYYA 3EAGA 3ETEA 3Q7SA 2J87A 3LC7O 1P60A 4LXQA 1GQRA 1IB0A 2P0EA 4FXOA 5LYYA 1DJNA 5JRJA 3AVUA 1L5SA 4TRMA 4TV8F 4GWGA 4NABA 3K0AB 3K9FC 2HTEA 1KJWA 3ZI0A 3BWVA 5JU6A 3MYYA 5E4JA 5G0UA 4I9FA 2FV8A 1A0OA 4ME6A 5ELMA 5KTYA 2YX1A 2COEA 4OQEA 2PD4A 2VPXA 2IXBA 1DAOA 2QD3A 4YV2A 4V2UA 3G17A 2VQSA 2QSJA 5D01A 2CN1A 4CPDA 1QGUB 3ZWVA 5K6AC 3WJ7A 2BFWA 3MRTA 4XFJA 3AR6A 4Z51A 1I7DA 2QMEA 1Y8CA 4MUBA 3MJEA 4WK6A 3U9LA 4TMKA 4OLJA 4CM8A 4IV5A 4WZAA 2AF3C 5C7IO 1EDZA 2A8YA 3R74A 5CFLA 4NXMB 4FQ5A 4KXYA 1QO7A 3UQYS 2GCIA 3DVRX 2RMKA 1VGQA 2GN9A 1JBEA 4GVLA 4CHTA 4EHDA 4EKDA 1YBMA 3IP5A 2PUBA 1ZL0A 3DAGA 2AG8A 1Z8NA 1VKZA 3NC0C 5EWMA 5TEWA 5CIQA 3UHPA 4MJXA 1EFVA 5F5NA 3B1ZA 1Y1RA 4Y2VA 4FOTA 3TL6A 2H48A 4GXQA 1ZD2P 2ODNA 4M87A 2QR2A 1GARA 2V6IA 3H04A 4F2PA 1XAIA 3CEHA 1CJCA 1JKJA 2NUTB 4RVDA 2FWJA 2UYYA 4DIEA 1RXVA 3R7SA 1J09A 3N9IA 1R8XA 5C31A 2F64A 3DV2A 4M8LA 4INOA 4RTLA 4EFKA 4JJ4A 4CRWB 3VTFA 4AZSA 4RULA 3L1VA 3BBPA 4WERA 2XDYA 1HZZC 3CLHA 1N7HA 5AJYA 2Z2IA 3FDZB 3N2GB 4MV7A 4XB1A 1BXKA 3ZHXA 5MF6A 1ZM2A 1QU3A 4PY2A 4QOSA 4DWVA 1ZCAA 3SLGA 1EM8B 1TUGA 5DULA 4FX5A 3C3KA 5A4KA 3NIGB 5JD5A 3WKEA 1ILEA 2UDPA 2ZU0C 4F4FA 4TXHA 2BKAA 5LBUA 2XT0A 3COVA 4WKNA 4ZOEA 2OYRA 1CZLA 2IH4A 5HQJA 2GAIA 1V6CA 2VZEA 1ZMOA 1DMRA 1E2PA 1K8YB 3BZUA 4OD0A 4TKVB 5E7MA 1P7VA 4ZO9A 1USWA 2NVBA 2WMDA 5J5AA 5EE5B 3OZUA 3IJRA 4DUYB 3OKCA 3UJ7A 2C00A 2JFXA 1ULSA 3CX7A 1FLVA 3DOHA 4PQGA 4OXQA 3R3JA 1XZJA 4FHDA 1F8YA 5JD4A 3GO4A 4G89A 4TMTA 3VHQA 4CF5A 1Q0LA 1G8JA 2O3QA 5AI6A 3F7MA 5I7UA 4C76A 3CRNA 1B7GO 1OI4A 1PD0A 2CB0A 4UE3S 4DIMA 1QHNA 3QMVA 4K81B 2A5GA 4CTOA 3QE9Y 1H05A 2Z6QA 4G8JA 2QLJA 3KOUA 1BYUA 4G2NA 1EFAA 2WINI 1HORA 4GLOA 4LC0A 4B81A 2OP0A 2B20A 3C5HA 4HYEA 1OJ7A 1ENPA 4TLMB 4LJYA 4B9AA 5K0EA 3F6BX 5TGTA 1KPHA 1UPAA 3HS3A 1J06A 2JRCA 4NBKA 5HMLA 3OE7A 3K70B 3DW3X 4G5QA 3TLGA 4UOEA 3HTXA 1FW8A 2PLAA 5ILQA 1M0TA 1XAGA 2YOHA 3EUWA 2B7BA 3GRKA 3IMEA 3ORRA 1RLIA 3GZNA 3KT8A 4FGSA 4Q02A 2Y0DA 1HZZA 1SXJA 5FDFA 1V3UA 4XVUA 2D7CA 3DMTC 5LOVF 1ZIOA 3KYCA 3C6YA 4D3YA 4G0ZA 4W8HA 1VG9B 2JJMA 3QJ5A 2VUTA 3AF6A 3EPPA 4H3HB 2OZEA 2VZ9A 2NPOA 3WB2A 4D74A 3SVLA 1NU6A 4EUEA 1RPAA 1VJGA 2V6GA 3A3YA 1IOWA 3H2ZA 4NZZA 3FBTA 3I4CA 4M6WA 2GILA 3LQRA 4BMYA 2XTNA 3RH0A 2B4AA 4LF8B 1YJQA 4YCBA 5EFOA 2VSXA 2YXPX 5M7EA 2ZETA 4DCSA 5BSWA 3CUWA 4KBFA 4WXPA 1USVA 2QTMA 2IYLD 3ISVA 3TMAA 1B76A 5EMKA 1OGJA 4CKCB 1XVUA 4GC9A 3HB0A 1F6BA 3ZHSA 2I78A 3DCJA 3H75A 1UK8A 1X2EA 5CVCA 5T6MA 4FX2A 3SS9X 1W1UA 1F17A 3WBFA 2J46A 4UDNA 3E4CA 4WESB 2W6PA 5KS2A 5LSAA 5DSZA 4IDOA 2IZZA 2AT1A 4QXRA 1Q1QA 3RAJA 1L5FA 4NXNB 4WASA 3WGVA 2IU3A 3H1FA 3W2EA 4N0QA 1OFUX 2D59A 1V5FA 4TXNA 3RSGA 1RABA 2REXB 1IJFA 4DW8A 5BSFA 4KITB 4G4SO 1L5HB 4V0MA 3ZWBA 3OEHD 1KYTA 4IV0A 5HOQA 3QMPA 4G1BA 5CH8A 1M2HA 1LJLA 4DEXA 5TQ0B 3RM3A 2M9MA 4FOOA 5AKHA 4IGKA 3V42A 4ENWA 3PDJA 3PTZA 3ZHCA 2PXHA 3DFZA 2B83A 3W5BA 4YJ2F 1DAPA 1U3DA 3NHWA 3KJIA 3VC3A 3S81A 5LJIA 3SYNA 2FEXA 4HBZA 4YACA 1NIJA 4D02A 1M1YA 2JLVA 1OAOA 4UCFA 2WR8A 3RC3A 1Q2XA 2B6HA 1SVUA 1RHKA 2J6HA 3K70D 2HN9A 1IXRC 1E64A 1LDGA 1P45A 2NIPA 4NS1A 3CNLA 4HFNA 4V1CI 5IH7A 4B5LA 3PUXA 2D7DA 2P4QA 5BQXA 4L57A 5FLYA 1O7JA 2IXFA 3G23A 1EVQA 2BR4A 5FEMA 1C1YA 4ENPA 5IULC 4HN9A 4QEKA 3JYPA 2V58A 3R6DA 1U04A 4NMXB 1O95C 3W5UA 4KPFC 4WK4B 4CI9A 4P1ZA 3VO8A 5I7WA 2BFNA 4J0QA 4B43A 4ZV4A 4N48A 1U3CA 1CNFA 1EIZA 2WJHA 4LYYA 5I7OA 2GEBA 4FSXA 4LYGA 3GGDA 1II8A 2B2NA 5GQSA 3F6YA 4OMDA 5LPNA 3M7IA 5FA5A 3W06A 2IZOA 4FT4A 2J9FA 4DLYA 1ST2A 2QMYA 4ZQEA 1EVJA 5J4VA 2JA2A 3S1AA 1GZSA 3ZI4A 3K8QA 2E18A 3KEFA 1P3Y1 4P5DA 1GFIA 5H82A 4H1WA 1CEEA 4O2BF 5BRJA 1LXCA 3AYXB 1G291 2WP0A 1V2HE 3KZXA 4Q3KA 5AH0A 2HHLA 2SKDA 3NVAA 2H06A 521PA 3AIOA 2W83A 3UGTA 1SEPA 1U1EA 3RANA 3CTMA 3G2LA 5JISA 4TOIA 3V3KA 1K5DA 2GMWA 4ARAA 4MVJP 1KWGA 4C0HA 1OXVA 5FBRB 1PQPA 2Q3CA 3I1JA 3OHPA 1M6HA 4AJ9A 2GK7A 4D0GA 4IOMA 1IPHA 1XQWA 4Z7OB 4HLNA 3BF8A 3ROEA 3DVSX 3VYTB 1A96A 2CXPA 3V1KA 4PHTA 3CEAA 1K2VN 4EYSA 1R27A 1YULA 4L50A 2QSUA 2YVKA 3BRCA 1RWWA 3T12A 5ITWA 3ZE1B 3BBLA 2FPOA 2B1JA 1MEOA 4YAFA 5IDYA 3G02A 3R7WA 1UJBA 1U6JA 3GLRA 1NXTA 3KJGA 5DRYA 3STVA 4ZALA 2HCJB 2OORA 4Q3BA 1U7TA 1KK3A 4FNMA 2NU7B 1PFGA 4R1SA 3W8DA 1XD8A 2WE7A 3OKFA 1HDYA 2O5RA 3GRZA 4FMBB 5KNBA 1XSEA 2HMAA 2QG4A 2QUBA 4QT4A 1W5FA 2PXXA 3FVWA 3NHJA 1G20E 5HQ3A 1JLSA 1OWPA 3JQGA 5FBHA 1OZHA 1Q1NA 4S04A 4X94A 1ZS9A 3DONA 1TK3A 3AHEA 3CUVA 3PDCA 4ITVA 3PDIB 3W5VA 5E8RA 1NT4A 2AKAB 5LC1A 1PGPA 2QZ4A 1PEDA 4MTCA 3VSAA 3NU1A 3I04A 5KQGA 2BHNA 2EERA 1GY8A 4QPNA 1ZUNB 2DUWA 3IKJA 3VHLB 4YONB 4KR7A 5TX7A 1M1NB 1X8KA 1XZKA 4KGDA 4XW2A 2HSEA 1UBUS 4HEJA 4NLLA 2J3KA 3LLMA 4G6ZA 4NEHB 1NL3A 4JBXA 2V7XA 5JQGF 2Q3EA 1YBFA 2V5VA 3AFMA 2VSNA 2GXAA 2VLBA 5CNMA 1LTHR 1OHHD 2J0UB 3ER9A 1SQGA 2NOAA 2FOXA 2RAPA 3JQDA 1MRNA 2QQ5A 5IVPA 1UT8A 1YXMA 2P69A 4A15A 1VCOA 1B6SA 5CM8B 4RFSA 4BVFA 2ZIWB 4WEOA 1QE3A 2XH8A 5AM1A 1PQYA 2HF2A 1I14A 4DMKA 13PKA 4L27A 2WWIA 1U3FA 2H2DA 1CQXA 3JASB 1PEAA 2VBFA 2W8ZA 4KWEA 3Q3GE 3OIVA 2VWGA 1DZIA 1N57A 2VTEA 4X65B 4LWOA 4EG4A 4U9HS 4AYXA 4RHXA 4UTVA 2QR3A 4F12A 1LBQA 3MXOA 4NAUA 5KOJA 1WB5A 2VATA 1RLOA 1UOOA 2OXIA 3NHFA 2Q1XA 2X0NA 3KKLA 1JFFB 4LJ5A 4JGIA 1EHCA 4E21A 2VYNA 2Q5QA 1EI9A 2ECOA 2XEDA 4QFDA 4R3WA 4XVRA 9ATCA 1M2VA 4KFTA 3P9KA 4J76A 1PX2A 2QMHA 3G5MA 4NE9A 2JDID 3AFGA 1SVSA 1OH5A 3OJLA 3I30X 1Y7TA 3EMDA 3OH8A 4QGSA 5L4NA 3I4FA 5JMWA 2WFLB 3SBXA 3DLIA 4Q0MA 4UPDA 1H5QA 2P6NA 4JJ8A 4JT2A 5CT5A 3TLMA 4EO9A 4EZIA 2VHUA 1EE2A 1PT8A 5CVEA 2XOKD 2NZVG 2XWBF 5KJEA 5BNTA 4LZNA 3LF2A 5FWXA 4WFIA 1ULZA 2IHBA 1B1AA 3CR8A 3I3OA 1ISMA 3PLNA 4XJXA 5A6SA 4LJ6A 3V8RA 3AINA 2ZDQA 1PS9A 1B8UA 1DC8A 3DE1X 3QUTA 4YDSA 4FS3A 4AFNA 4XB2A 3SQLA 2GDZA 2YFQA 2FR8C 1V8BA 3T06B 3NUQA 3HVUA 1DT3A 1OWMA 1TB4A 1CQZA 4RTKA 3ZHBA 2CK3A 1QFMA 2CZQA 4KWHA 3ZU5A 4BV9A 3GJ4A 1JA9A 2I6QA 1PR6A 2Q9BA 2W93A 3NBZC 1R9MA 3OQJA 3MMSA 4G97A 2IHJA 3AJ9A 5TR9A 1BWPA 2W37A 3RVDA 5BXYA 2BFDB 3DWGA 4B3RB 5E1BA 2VDKB 1FJ2A