2FMYA

Co-dependent transcription factor cooa from carboxydothermus hydrogenoformans (imidazole-bound form)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
ATQMRLTDTNLLEVLNSEEYSGVLKEFREQRYSKKAILYTPNTERNLVFLVKSGRVRVYLAYEDKEFTLAILEAGDIFCTHTRAFIQAMEDTTILYTDIRNFQNIVVEFPAFSLNMVKVLGDLLKNSLTIINGLVFKDARLRLAEFLVQAAMDTGLKVPQGIKLELGLNTEEIALMLGTTRQTVSVLLNDFKKMGILERVNQRTLLLKDLQKLKEFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of CO-sensing Transcription Activator CooA Bound to Exogenous Ligand Imidazole
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Dna binding protein
molecule keywords carbon monoxide oxidation system transcription regulator Coo
total genus 67
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fmyA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2fmyA01
4A0ZA 1GXQA 2GH2A 2EV5A 5FCCA 4OOIA 3NRVA 3SFZA 1FP2A 4A5MA 3LWCA 2ELHA 1R5HA 2D40A 2PQQA 2FSWA 2WC2A 1QZYA 4XSXF 4IESA 4XFGA 4XBFA 4CHUA 4XFIA 2GIVA 4LFUA 4J1WA 1SFNA 2OYZA 3OOPA 5ERIA 1J9IA 4PGGA 4P9GA 4ZU7A 1FOKA 4HQMA 2DLLA 5I93A 1G3SA 2GA2A 3MCZA 1EPZA 1S29A 1QPMA 5DD8A 3U0ZA 3TO7A 1U2WA 3LQRA 1O5LA 4HLYA 5DEQA 4L5JA 3S0MA 4LLNA 4HAMA 3C3WA 4I01A 3U9GA 4TV7A 1IPKA 4HBNA 1O57A 1OYYA 1J58A 5BMZA 1TNSA 4U0WA 4Q48A 1HKTA 2VBXA 4MX3A 3RNSA 2EB7A 4LGWA 4IRIA 1DZRA 3JAMK 2BV6A 3Q9SA 2ET7A 4NHJA 1JUHA 1B1BA 4LUMA 2M30A 2RDPA 1FXZA 4CGZA 3IRQA 1KYZA 4ENKA 2CYYA 1EY2A 4O9EA 1IN7A 5HDGA 1QNTA 3C18A 3NL1A 4LLOA 1WWXA 4RB3C 1XSXA 5FPZA 1YFYA 5FLXZ 2MBFA 3H3UA 3TDUC 4F7ZA 5FO5A 1OD5A 3I59B 3DN7A 2C0ZA 4ONUA 4WCGA 3RPQA 1XDSA 3HOTA 1J7KA 1EV7A 1Y9QA 1OYWA 3JAMZ 4MQ9F 3K1NA 2G7UA 4HVOA 1KYWA 3PLQA 3IIAA 2HKXA 4UVAA 2CGPA 3DL3A 2VE9A 3I0TA 2A68F 1WSUA 2K86A 1RUOA 2ZFWA 4AVPA 2PYTA 4Q0PA 2IRFG 4L5IA 1K78B 4EM2A 4BNCA 2RKHA 2PAKA 3ISPA 4LULA 2IPQX 1LDKB 5CVIA 1J5YA 2LNBA 4KT5C 4OU0A 2EFWA 5D4SA 3NSTA 1DDNA 2V09A 4I2OA 1VP6A 4XLPF 4KMFA 1NZCA 1MJBA 3FHIB 5CYVA 3UKTA 2VT2A 4X6QB 1QO0D 5D6FA 4HMZA 4MQVA 3WE3A 3RYPA 1TW2A 1H9TA 4I3PA 4DNCA 3VFZA 5HVQC 2FA5A 2GC1A 1ZZ7A 2NNYA 1R36A 3KP2A 5KHIA 1P4WA 5LEJA 4KIGA 4HN0A 2P6TA 2IP2A 4LK0F 4XFHA 2L3DA 3BJ6A 3FM5A 2EJRA 5HS7A 5T3NA 5ILSA 3OD0A 3IRRA 2PMUA 1BC8C 4UNOA 2W57A 4P5OA 1MJAA 4XFFA 1FNNA 3DPTA 5K5QA 3ELNA 1SD5A 1BI3A 1KQ9A 5E8GA 2EFQA 1SFEA 1KQ8A 4EWDA 2YU3A 3E6DA 3BJAA 3OF1A 1TQIA 2Q4SA 1CAUB 2RN7A 2PJPA 3S7EA 3WTZA 1FI2A 3E5QA 2ATFA 1YIOA 4CXFA 3M70A 4RB2C 2KKOA 2F4PA 3QPHA 1Q43A 3QRFF 2ZNYA 3WW1A 5J8CA 2F5EA 3CJXA 1YFXA 4EV0A 4Q5SF 2GXGA 2Y75A 5BXXA 4N0BA 2PAMA 2NRAC 4MHGA 1RC6A 3V8KA 1LKNA 1J3QA 3FZVA 4HLXA 1O3SA 4IEWA 2V1UA 2M8EA 2DTRA 3IHUA 2HFHA 2BE5F 4G6QA 1W5TA 3ZN0A 1WLTA 1HQCA 4EJWA 5JAXA 3U2RA 4KIBA 5DCMA 3GZ6A 3GYDA 1IN5A 1CAVA 2O6GE 4KN7X 1T38A 1SMYF 2VOPA 3FF5A 1ZG1A 1XD7A 4J1XA 4U0YA 5L3GA 3QU6A 1T6SA 2UYAA 2YR2A 1YO5C 1XGNA 4HYEA 1FSHA 2O1QA 4CO8A 1T98A 2PG4A 2PFBA 2P7VB 3F8NA 4LG0A 2XAQA 4NB5A 2XROA 3QPTA 1EH7A 1Z91A 2FNPA 2VE8A 4P9FA 2DQRA 2GC0A 5HOOA 1USSA 2OA2A 3TOBA 1XGMA 3KSCA 5EFUA 5I0UA 3NEUA 3KGLA 3PQKA 5HDNA 3USSA 3U1DA 3BOQA 2CQKA 4KUMA 4QLCU 4IRGA 3F23A 3B73A 5I8SA 3BY6A 3E6MA 3CLPA 1I1SA 4KN4X 4MV2A 3IBMA 2FBKA 4MH0E 4EWEA 3J81Z 3K9TA 4H0EA 1PUEE 2J5PA 2Z3YA 1NHAA 2VBZA 3KFWX 4LTAA 5E1WA 1V3FA 4X6RB 4KNYA 4RGRA 4K8FA 2WWYA 1VJ2A 3W6JB 3IL2A 4QM9A 3LSTA 1BBYA 2X4HA 5D5XB 1EH8A 2RVCA 1L3LA 1HKSA 3SCGA 4HF1A 1GXPA 1G4DA 5I0RA 2IT0A 5C6CA 1U6GA 1TQ5A 1W7PB 2L54A 4ZYGA 5H6QA 3KLNA 1B4AA 5C8WA 4QM8A 2KJBA 1OYIA 4ZYEA 2PAEA 2VECA 5E18F 5LRRA 2GAUA 2E1CA 4MGIE 4UV8A 2VXZA 1ZVFA 4ESFA 2E7XA 1H1IA 4AIKA 2CSOA 2FNAA 3E6CC 3O3KA 2OU2A 4BHPA 5DUIA 3ZP5A 2VODA 2QJVA 3CO2A 1SFXA 4ZZLA 3OGJA 1D5VA 2KRFA 1LQ1A 1XDUA 3E5XA 1IXSB 3M1EA 3MWMA 2DO7A 2FQPA 5A2QZ 4HX7A 3F8FA 2VONA 4YYOA 4PIZA 1G3TA 1E2XA 3H1MA 1CAUA 1ZZ8A 3SXWA 2V79A 1WGPA 5CJ9A 1U3EM 3IDCB 4IEVA 4JTOA 3E6BA 2HQNA 2FF4A 2MLGA 4L0YB 3JSPA 2TDXA 3CDHA 1TTYA 4XLNF 3EJKA 4GYGA 1K7AA 4A6DA 2XVCA 2XLFA 2CWEA 1FYKA 3ZMZA 1NXMA 2QQ9A 1BOAA 2Y48A 3CUQB 3WTWC 2DT5A 3DP7A 2K9ZA 1IZ1A 2OBPA 2EWNA 4AVCA 3HRSA 4KDPA 3R6SA 3WGGA 3WW3A 1YG2A 1MJ9A 2R7FA 2HYFA 4EVIA 3WW2A 3EQLF 5LGTA 2HQRA 2IW5A 4KWJA 1T39A 4AIJA 3WTSC 2OZ6A 2QBYB 5IT9K 3RYRA 2JPCA 1U5TA 1ON1A 2WTEA 4HZFA 4IHTA 1TW3A 5DDGA 3V7CA 4GYIA 2QLZA 2OAZA 1V4RA 4HV5A 1WQ2A 3GLXA 5F6FA 1OI6A 4B29A 4R1HA 2GXBA 3HSEA 4D7SA 3LOIA 3WTUC 4KL1A 4NQWA 2QENA 1HBXG 4QGLA 2UWMA 3LFKA 2A5YB 4IEZA 5J3UA 3S2WA 3WTYC 2FQ3A 1QWRA 4I0BA 3ULQB 1XGOA 5D4RA 4WXDA 5E1ZB 4L9NA 4Z2YA 2ZO4A 3SZTA 3F8BA 3GZ5A 4UXNA 3HOSA 1Z1DA 1YHFA 4P96A 2EK5A 4MUVA 1FT9A 1PMIA 3NW4A 4R52A 3HTSB 4G7HF 1EH6A 4DQ2A 4K2EA 2PMHA 3MZHA 2XKPA 3MFKA 4AVBA 1OMIA 4G7ZF 1HSTA 4BHBA 5A2QK 2M5WA 2VN2A 1J0RA 2JPBA 1YYVA 4WXHA 4B8XA 4HQEA 2PI0A 2OQRA 1PP7U 1B9NA 1P4AA 2Q1ZB 3KZYA 4LA2A 1K79A 1RUNA 4PDKA 3ML6A 1O5UA 3LQQA 5CADA 2IXIA 4KA4A 4G94A 2A3SA 3M8EA 3SHFA 1UPIA 3I53A 3JTHA 5FFZA 1CAXA 4E70A 1Z9CA 3ACLA 3UKNA 3JTGA 4H7LA 3IKVA 2IC1A 2IA0A 3D5LA 1ZNPA 5HLGA 2V9VA 1FZPB 2RNJA 3ROUA 3JW4A 2G9WA 1EP0A 3HSRA 4A2UA 3DFGA 5J6XA 3V4GA 1S3JA 1SD4A 3LA2A 4LK1F 2UY9A 3O2PE 4KFCA 1W7PD 3I54A 3FZ3A 2EAAA 4GO1A 3FXQA 5CVUA 2VOOA 2JZYA 4RB0A 4HVQA 3UKVA 4MTDA 5H20A 4D0PA 5FQ0B 3ETQA 3HT1A 2CO5A 4EJTA 1USTA 4M72A 5E17F 1LEBA 1P92A 3EBRA 4N9HA 1ZGJA 5KHJA 1J59A 4YG2F 5I0SA 1PP8F 3KP5A 3K2ZA 3EETA 4UV9A 3DF8A 3LA7A 1KU9A 4IEQA 3ABUA 3N97A 5CVRA 1O7LA 3SMHA 3TOAA 1SD7A 2P4WA 5ICGA 1S8NA 2OPKA 2EFOA 5KHGA 3LWFA 1P4XA 4ENMA 2LDUA 4XF1A 2D5FA 4I7HA 3FMQA 2NNNA 5IT3A 1F1ZA 3BJOA 3DV8A 2A69F 4L11A 4EWAA 2K7LA 2Z5UA 3EO6A 5E8IA 5D5WB 1UW8A 3BPZA 2CFXA 3VOEA 4LB5A 3KLOA 2XASA 5HS8A 1IN8A 2IXLA 4MTEA 5EEHA 3RTRA 1Z6TA 2MC3A 2XL7A 1I5ZA 2DBBA 1YUDA 3M9AA 3P7NA 5LHGA 3TNQA 3M8FA 2QUFA 1EYBA 4EM1A 2H09A 1Z7UA 5EZWA 3MZYA 3GFLA 4MEYF 5HS9A 4PJYA 2BNNA 1I6XA 5H6RA 5LEKA 4QXKA 2HEOA 3JZVA 5K5RA 2Z2SB 1IRGA 1TLHB 4HF2A 4BHCA 3BALA 3WTTC 1QY4A 1FWZA 2Q2EA 3FWEA 4ON0A 5BOXA 1O4TA 5FD6A 4E2SA 4B09A 1XE7A 1STZA 4Y13A 3EYYA 5FB2A 2K0GA 3H8UA 4LUKA 2P5VA 3F3XA 1GVJA 2ACJA 1X3UA 3ES4A 1ZHFA 5BUVA 2ISYA 1ZZBA 4EROA 1LB2A 2HZTA 3T8TA 2NYXA 1NYWA 4IJAA 3DXJF 3TKYA 3GVAA 1W7PA 4IEOA 2AXLA 3HIFA 3ZMVA 4RAYA 2D5HA 4UBHA 4XF3A 4D7TA 5FGMA 2O8QA 5I0TA 4TLFA 5JI6A 3FJSA 4AQ6A 3MYXA 1KQ0A 3HT2A 5E16A 1FYLA 3G73A 5K1YA 1XGSA 3BPXA 3P9KA 2MD5A 2QQBA 5J48A 2DI3A 3HRTA 4E2QA 4KIFA 3I4PA 2MPFA 5I91A 3RKYA 5JR7B 3CUQC 1KA8A 2Z33A 2QYOA 4XF4A 2XV4S 3DPLC 3E3VA 2IXJA 1U5TC 1Z05A 4EQQA 2ZMEA 1Z6RA 3QAHA 4XSZF 5FLXK 1X8EA 4HSLA 4M74A 3CO7C 4UVCA 3QP6A 2BNOA 3IC7A 2H6BA 4M6XA 2UXXA 2EFNA 1GQHA 2I45A 4FAGA 2QWWA 2QVOA 4A6EA 4JK1X 1Y3TA 2CAVA 3BWGA 5JHUA 4GCVA 2QZ8A 4BH9A 1QQIA 2XRNA 4MGRA 2FOKA 4NVPA 1OR7A 4LLLA 5L3EA 3REOA 3HRMA 3OTFA 2UXNA 3DKWA 1R1TA 2XAFA 3H92A 1FLIA 1VR3A 4META 3V8JA 4L2NA 2XGXA 2FEZA 2STWA 1I1GA 1B9MA 4Q0QA 1K6OA 4OIQF 4XEZA 1KU3A 1TQPA 2KIMA 2EV0A 4PCQA 4LG0B 4HW0A 2XUBA 3VB2A 3H50A 1R00A 2XAHA 3L7WA 2Z99A 4HF0A 2RV8A 1ZAOA 1IAWA 1XB4A 3H1YA 1YW9A 4FBFA 3RPUA 2V1DA 3RZZA 5E1XA 3I64A 4WK8F 2G7HA 2Z9OA 2IXKA 4YNIA 5E1RA 1DPRA 3BB6A 2ZKLA 1L3JA 2YX7A 2PN6A 1RIOH 2UYBA 2O03A 4EGYA 2GU9A 4WVZA 3HQXA 4OIRF 3ECHA 3GFMA 3ZN1A 2Z69A 2FMYA 4XFAA 5AIPA 2XAJA 4N9IA 5L3BA 3E5UA 1GQGA 1S7OA 1J75A 4HX8A 5F1RA 1YLFA 2MHFA 2FU4A 2LSOA 3GEZA 3GUDA 3K0LA 1X7NA 3HHGA 4P9UA 2PEXA 1ZREA 1ZZCA 2D45A 1MDMB 1BJAA 2GQQA 2YX4A 2ZBKA 5ILVA 6PAXA 1BIBA 2FMLA 1MKMA 2VT3A 3DEUA 2J5OA 4LA3A 4LB6B 3KP6A 5I8TA 3GFIA 1LJ9A 4FX4A 1ZG3A 2ZKZA 1IRFA 2C6YA 3G3ZA 3F6VA 2DU9A 1TBXA 1IN4A 4KU7A 3F21A 4A0YA 1SFUA 1HW5A 4ZZDA 2F5DA 4QMAA 5KHHA 4M71A 2K4JA 4IETA 4E2GA 5FPXA 3ZMSA 1WRJA 1IUYA 2L01A 4G9YA 3KCCA 2A07F 4L9VA 3HHHA 3CEWA 4ENJA 2MLKA 4I98B 4YFXF 1YWKA 1J3PA 5D8LB 4WX9A 1QGPA 4CICA 1B6AA 3WGIA 2Q0AA 2IXCA 3PFIA 1ZX5A 3T0YA 3HRUA 2X0LA 3I5UA 3CUQA 3T8RA 2O61A 4O9GA 3LA3A 4L9TA 4WF2A 3KMHA 1ZLJA 1CAWB 3ZQ7A 2F5FA 1MD0A 4P55A 5F64A 3RKXA 2JT1A 1LDJA 4A12A 1LVAA 2GA1A 5BPIA 2COMA 1JXSA 3SZPA 2FE3A 4QGNA 4JTNA 2OA4A 4BXUA 1JHFA 3G7DA 4YIIA 3GYHX 4Y17A 1SEFA 4IEUA 3WU1B 2CG4A 2P8TA 3KP7A 4S04A 3KEOA 5AVPA 1J1LA 1FBQA 1XMKA 4M73A 1H9GA 3TNPB 1LRHA 4KMUX 4OMZA 1P2FA 1FSEA 1SMTA 4LJZF 4RGXA 5JR3A 4IXAA 3I7DA 1FYMA 2BYVE 4EJUA 1F4KA 4OFGA 2MH9A 2VC1A 5D5UB 2E9QA 1Q3EA 1CAXB 5BV6A 1UFMA 1CF7A 2RGVA 3KP3A 2XLGA 3P9CA 1G3YA 4HOBA 3R61A 1FP1D 2BGCA 3WTVC 4UXAA 1T0FA 2NAZA 4Q0VA 1CAWA 2IJLA 3I71A 5KK1A 4MGKE 2K4BA 3KEQA 2XIGA 4LD5A 5LGNA 3TO6A 1ON2A 4KWLA 5J7MA 4IEXA 4WZCA 4WXCA 1QBJA 4IPAA 1HXDA 1ZGAA 3KZZA 2KXLA 4EMSA 1UB9A 3NJZA 3R0JA 1FX7A 2P6SA 2OQGA 3F8CA 2K02A 3COAC 3DQVC 2W84A 3L9FA 2IA2A 5FLIA 2HOEA 1H0MA 4AVAA 5FD5A 3WU0A 1CF7B 3ZDSA 4U7DA 1LDDA 2MNGA 2OZJA 4O6JA 2F2EA 1TQMA 3CTAA 4U88A 3S7IA 1FBUA 4KYWA 5LGUA 3SCHA 2LKPA 5HLIA 1BN5A 1G3WA 3C1DA 1TNTA 5CLSA 1C0WA 5LHIA 1UHMA 1OFNA 2E7WA 1I27A 2WFPA 4GXOA 1XCBA 3RI4A 5BY5A 1R58A 4RAZA 4Z07A 2O0YA 2HDCA 5DUKA 3F6OA 4IHSA 1QXRA 1IN6A 2XKOA 4Q0UA 4EM0B 2DCTA 3WW4A 4KWKA 2W25A 4L9JA 4Q0SA 3T5XA 4XFCA 2M1BA 2L4AA 1O3QA 2P17A 2PTMA 2B8MA 3O14A 3ST7A 1ZZ9A 2B0LA 4HVRA 4YRDA 4HLTA 2JRTA 1ONVA 3H9AA 4LLGF 2N7GA 1HKQA 3U10A 5FDBA 3L2HA 2D1VA 3C3VA 5ICFA 3FE5A 2DPUA 4XFBA 4IEPA 1R7JA 3IWZA 4ASNA 4WWCA 3FXUA 4YIFA 5D1IA 2ISZA 3MQ0A 1CX4A 2EVXA 2PHDA 1R22A 1T2KA 1KU7A 1REPC 3EHKA 5J8FA 2W85A 5AONA 3K69A 1ZRFA 2QVSB 4UHTA 1LR5A 3NQOA 2A61A 5EEGA 2ZMEB 3P9IA 4RD7A 1W4MA 4OMYA 1W5SA 5KHKA 3VEPA 4PGHA 2QQAA 4EJOA 1H1MA 1FC3A 4EJVA 4IERA 3I59A 4ZYDA 5L3DA 1V70A 3RYKA 2M87A 1ZH5A 3D0SA 4G6DA 4KU8A 2GWRA 2QDRA 2D93A 3WG9A 4OIPF 5LLQA 4FHTA 5CVVA 4R79A 3H7JA 3F22A 5ED4A 2O8XA 3GFJA 2ADUA 3V7RA 4A5NA 3RJPA 2HWVA 1ZG5A 4FT8A 3CUOA 1YS7A 4BIFA 1YFHA 1E17A 2EA2A 3Q9VA 1UCRA 4IF4A 2P5KA 1RGSA 3SHRA 4CYDA 1RZ4A 4WBBA 4OIOF 1HW1A 2P7CB 4UUVA 4UBGA 1HW2A 2W24A 4Y15A 5D6EA 3TO9A 2HTJA 4G8XA 3CL1A 3VODA 2H0VA 3D0JA 4XETA 1YQAA 4DINB 5DCMB 1R23A 3EDPA 1K78A 3QOPA 1CAVB 2ESHA 5DCFA 4MNUA 2V6CA 2A6HF 2PQ8A 2BEOA 4PZJA 1ZYRF 1X82A 4GGGA 1IPJA 2DQLA 4HSJA 4U0VA 4CZZA 2D2WA 2GC2A 3BCWA 4M6YA 1JE8A 3B02A 1DGRA 4HBLA 2DK5A 2JTVA 5JSPA 1NE6A 4RB1A 1ZARA 1XRUA 3F8MA 3IWFA 4I09A 1OPCA 2ESNA 3EQEA 4S05A 2HR3A 3CJNA 2BBYA 3GWZA 2H94A 2R3SA 1J3RA 5HI0A 2QM3A 5DYMA 4AWXB 2GC3A 3J80K 5JFRA 1DUXC 5FLJA 2HTSA 3FXRA 3V7SA 4PIYA 3QU3A 3FFQA 4ZH4F 2B9UA 2VQAA 2Q8KA 4EGZA 3OCPA 1P6RA 5KBFA 3PNAA 3LZZA 5DD4A 1X8MA 5ICEA 1MZBA 1U5TB 3GX4X 2R7DA 1QZZA 3HUGA 2PBIA 4ESJA 4Z82A 1YW8A 4BQAA 1KU2A 3GXOA 2A6EF 4PIXA 5JVTA 1F5TA 1JHHA 5DV5A 2DK8A 5KVRA 2L4MA 1U12A 4FX0A 4MGYE 3HSFA 3ECOA 4CDGA 1GHCA 5K8SA 5JSOA 4JBAA 4G7OF 1U78A 5TRDA 1ZLKA 3KGZA 4Q47A 1ULYA 2VBWA 4OINF 1FPQA 2MH2A 1ZRRA 3H1WA 2XAGA 3J81K 1J2XA 3N4MA 2ET1A 3RKWA 3TDZC 4FAHA 3EYIA 2PHLA 2FBIA 1S7AA 3LAPA 4L18B 1XN7A 2O3FA 1RTVA 4I0AA 3R0AA 3WE2A 3LAJA 4IVNA 3IDBB 4BYYA 4ORFA 2EA7A 1Q5OA 1S6LA 3ZMUA 2IXHA 3FM3A 1YS6A 3L09A 3OV8A 1ODDA 3ZMDA 4AXOA 5FLHA 2L02A 3U11A 1UD1A 1NE4A 3MAJA 2AS5F 3MPBA 4RS8A 2DPDA 1L0OC 3BROA 2ETHA 1DPUA 5JCTA 1R5GA 2ZJ2A 2RC4A 1BC7C 4M9ZA 3LAGA 3KP4A 1Y0UA 4MGZE 3QACA 1B59A 3QP5A 4AQ2A 1R1VA 3PVBB 5I8YA 3C7JA 3H7YA 1DGWA 2KJCA 4ZU5A 3IKTA 4ZU4A 1XSDA 2QBYA 2HS5A 2ETEA 2HYGD 4M9XA 4AIHA 1JGSA 4XF0A 2H6CA 4BAYA 2E1NA 4QGMA 2FRHA 1U8RA 4F8AA 4IRHA 1PDNC 1ZN2A 3M3IA 1SQ4A 1UCXA 3NVCA 3PQJA 3BU7A 4YFNF 2XL9A 3HTUA 3GO5A 4RGUA 3WGHA 5BPDA 3CLOA 3MDPA 3KE2A 4RGSA 3BDDA 1ZRCA 3E97A 1DZTA 2GZWA 4HDVA 1IXRC 4HX4A 4XRFA 3TQNA 5K5OA 3FX3A 2YPRA 3GBFA 2OD5A 2Y0OA 4ZYHA 2IVMA 2M45A 2EV6A 2LF7A 2HKOA 2CW0F 1YTYA 3BZ6A 1IF1A 3ABTA 4KICA 3GF2A 5BQTA 1D8KA 1IW7F 3FHZA 4R8HA 2FXAA 4GULA 5ILUA 3GW2A 1RI7A 1BIAA 2ZCWA 3RDIA 4XF9A 3TGNA 1KGSA 4IEYA 3BP8A 1XE8A 4LMYA 1YFUA 4JV4A 4O3MA 5FFXA 3SXYA 2NS0A 2BNMA 3L00A 4O5VA 2CAUA 1SD6A 3EUHA 1O3RA 5JSRA 2FBHA 2WV0A 3ELKA 3K1PA 2YSRA 5CU1A 3I58A 3L2CA 4MEXF 2H27A 1G6NA 2KIUA 4HDUA 5D8KB 1LEAA 3R60A 1WA4A 5HDKA 1D8JA 3AAFA 1UIKA 3FMRA 4HA8A 5CVJA 2QNKA 5L3CA 5LHHA 3WODF 5LBQA 2KIFA 3J7AO 5D5VB 2EFPA 4YFKF 2STTA 1CGPA 4ENNA 3VHRA 3M7GA 3SCFA 2DAOA 1YFWA 1BI2A 3HYIA 4AD9A 1D3YA 1FBSA 4YARA 2B5HA 3D82A 5E20A 4OLLA 2HJIA 4MZUA 4L0ZB 1Q1HA 1F9NA 2Y0MA 2QCSB 1YW7A 4Q4ZF 3CF6E 1ZRDA 4I02A 5HLHA 1UIJA 5L3FA 1XSVA 1LNWA 3J80Z 1HSJA 1OKRA 2OZUA 4JQFA 5TJJA 3FMSA 1MGTA 1AWCA 1PM7A 1BI0A 3R4KA 1WKMA 2UZKA 4LEJA 3W6KB 2VPVA 2VBYA 3ES1A 2CV6A 4A0XA 1YLLA 5FQ0A 1XCVA 2ZNZA 4JVAA 4QX5A 4M9SA 3ZMTA 3H3ZA 3CO6C 2UY8A 1ZZ6A 4HV6A 3ZPLA 4UVBA 2IA1A 5AIQA 4HN1A 1FY7A 2DFIA 2V1XA 1SAXA 1BI1A 5BS6A 4ESBA 4Q29A 4YSFA 2EA4A 1XMAA 2XHKA 2Q30A 2P5LC 2RQPA 3BPVA 2Q0OA 3ERED 1R1UA 4QWQA 3F72A 3JSOA 1O7FA 2MA3A 5IT9Z 2XLAA 1RL3A 2ZXJA 2VC0A 2LF8A 4U7BA 1O3TA 1RNLA 3RIRA 3SQNA 2PFWA 1A04A 1QXJA 1IXCA 1WI9A 5LRSA 3O6BB 2F5CA 3V8LA 2JSCA 3WTXC 2PLYA 2K27A 3Q5FA 3MEXA 3K1MA 3KETA 1AOYA 2DW4A 2HGCA 5BPXA 4ETSA 3NKTA 1UHWA 5ICCA 1VTNC 1DP7P 1BM9A 3T1BA 2D1HA 2PA7A 1MDMA
chains in the Genus database with same CATH superfamily
1TZLA 1VQ7I 5JMCA 2VGDA 2GH2A 2EIKH 1ULPA 4IZZA 3DBRB 1PHMA 3RMYA 2WC2A 4XSXF 4XBFA 3I8TA 2GIVA 1SFNA 2Z1DA 3RZJA 2OYZA 5ERIA 1DQ2A 4IE7A 4PGGA 5FIXA 4XRSG 1FOKA 1H8TC 2W95A 5I93A 4FP2A 2FDIA 2GA2A 3MCZA 1X1BA 4PT6A 1QPMA 3QOEA 2YV8A 2ZGQA 4DW6A 1Q8OA 4YVWC 1KDMA 3S0MA 4LLNA 5ANQA 2ZA9A 3U9GA 1IPKA 4TV7A 2A71A 4U0WA 1MH3A 4YW5A 3AZXA 3PJRA 5L19A 1PGW2 1W3XA 5FXVA 1HB2A 3FBNB 4L8QA 2DVGA 4HG6B 1MZ5A 3ZRGA 4NHJA 2ET7A 4R9DA 3I2JA 2M30A 4IE5A 4FPYA 1KYZA 1AR63 1ZM1A 3GCXA 5FBZA 4ENKA 4O9EA 1IN7A 1BEV3 4NQWB 1IDZA 2X5IA 4B43A 3CQOA 3BZCA 4LLOA 3UR3C 5FPZA 4TN7A 3H3UA 1IHMA 2WT1A 5FO5A 1OD5A 2VAUA 2YYOA 1URXA 4E7SA 4ONUA 3RPQA 1W8UA 3SEZA 3HOTA 2VO5A 4CDWB 2OV7A 4WVWA 4N4OB 1R093 2GDFA 3VBSA 4XKWA 4JX4A 1S0BA 2VQCA 1SVMA 2V4AA 3FBIB 1GV9A 4DOZA 2W7NA 5L7OA 3FN9A 2YU1A 2A68F 4RR3C 2KIQA 2W1WA 1A8MA 5C5UA 1WSUA 1SCSA 3WHBA 4BPZA 4HONA 4L5IA 2VQGA 1WD4A 2HZDA 3TBDA 1JTYA 2D5VA 1Q8VA 4UI9L 2RKHA 2K2SA 3PMSA 4Y3OA 1LDKB 1J5YA 4Q1RA 2CW7A 5E6HA 2JDKA 2BGPA 2V09A 4UUSA 4IHWA 1MJBA 4PI0A 1BCXA 3RCOA 2VT2A 4X6QB 1V55H 1QO0D 4HMZA 4MQVA 4RHV3 1SZBA 3D4KA 3Q8BA 1F15A 1H9TA 4I3PA 5HVQC 2GC1A 5AFEA 1X3WB 1HDPA 2R7SA 1R36A 3T1MA 2IVJA 1UKGA 5LBCA 4LBQD 4XABA 4KIGA 5CZKA 3K46A 4J25A 3POYA 2VMEA 1H2LA 3RI8A 3OBTA 1KFUL 2EJRA 4EN8B 4C8DA 2HYJA 4LHSA 3CBNA 2VXRA 5J40A 1ULCA 4LK6A 3I97A 2X1DA 1O4ZA 1BC8C 4HKLA 4Q4Y3 4UNOA 5FAXA 4JHZA 2DMTA 4ZZ8A 1SD5A 5BNPA 4MO7A 2E34A 5A7WA 1KQ9A 5E8GA 1SFEA 4PJ0C 3JD73 3SEQA 4N90A 2Y26A 3BR0A 1SAUA 3U37A 1VBD3 2WBKA 2LY9A 4MGTA 5B2GB 2ZZQA 2KD7A 2DMQA 2KKOA 3QPHA 2ZNYA 5D8AA 4E7HA 5A32A 3K4AA 3N3HA 2IGNA 3RFRA 4ISRA 2Y75A 2GN7A 2NRAC 3RJ2X 4MHGA 4G3YC 4OAZA 3V8KA 3WP6A 1J3QA 2WYFA 2R32A 1JZ6A 5F6KA 4FXKB 2V1UA 2B46X 3CMGA 2DTRA 3OYLA 3P5BA 2RDRA 1IKQA 3PSIA 2L2OA 3ZN0A 5JAXA 1HQCA 4EJWA 3U2RA 3T0BA 4AHWA 1IN5A 2K9QA 2O6GE 3KIOA 1STMA 4M00A 1SMYF 1U5YA 2MYSA 4J1XA 4CVUA 3QU6A 5CKNA 2DBNA 2O1QA 4HYEA 1R081 2FDGA 4A7KA 2P7VB 4N8MA 3D5RC 3BG5A 2OUJA 3PIGA 3HPNA 1OA2A 1EUTA 2QEXI 4P9FA 2R93J 5DZFA 3OYFA 3AKSA 1MPXA 1VQ5I 5EFUA 5EF6A 5EZGA 1WD3A 3CCYA 2HWB2 4XLEA 3U1DA 3BOQA 2CQKA 5GZDA 5I8SA 3E6MA 1R71A 4EWEA 3IBMA 2FBKA 4MH0E 4YW7A 1PUEE 2L9LA 4BGDA 2VBZA 2B39A 5E1WA 3BIWE 4AVVA 4X6RB 4KNYA 3CHXA 2WWYA 3N35A 4LBQA 1BLZA 3I4IA 4P9LA 2QCOA 1BBYA 2X4HA 5D5XB 3Q3SA 2RVCA 2OS2A 3SCGA 2B4KA 1CESA 3EMRA 5E3MA 2DFEA 1NH3A 2VZVA 4ARXA 2NVXJ 5SV5A 1U6GA 1TQ5A 2L54A 5H6QA 3T30A 5C8WA 1UXXX 2YROA 3VBOC 2WY7Q 5LRRA 2GAUA 2R043 4ESFA 3O1SA 2R5YA 1H1IA 2CSOA 4Q4W1 1B09A 4BHPA 5F1JA 3ZP5A 1QQP3 3CO2A 1OFSA 1SFXA 3AKRA 1AR91 1Y8RB 1I6HJ 4QKNA 3OGJA 1D5VA 4QPGA 2FQPA 3M1EA 4ASKA 2VONA 4YYOA 4D9JA 5JIAA 3L2WA 2ZJQF 2A5ZA 3SXWA 2X6WA 1W6MB 4NHYA 1WW4A 2HQNA 2MLGA 4B4RA 3J8F3 3JSPA 2AEZA 2TDXA 1TTYA 3AVRA 4GYGA 4UB8C 1I3AA 2QQ9A 4C2UA 1BOAA 1R1A1 3WTWC 5HCAA 3DP7A 1IZ1A 2EWNA 3D1NI 4FFIA 4AVCA 1LAJA 4KDPA 3WGGA 1YG2A 2VZTA 2JICA 1MNEA 2Q8CA 3MV11 2O14A 3S1QJ 2HWF3 2FZ1A 5KCMA 3WTSC 2A3YA 4LO8A 3TEXA 5DDGA 1TW3A 1KZHA 4AEMA 3GLLA 2Y6LA 3AJYA 1XNKA 3GLXA 4BY7J 3P3PA 4ZXEA 4BA6A 5F3CA 3AXDA 4R1HA 1SANA 4ES8A 1GWLA 5B5EC 4EQVA 1VFCA 3T0DA 2W48A 4LT5A 2OIIA 4RHV2 2UWMA 3FUQA 1UJ8A 1PGL2 1OXCA 2YDEA 3OYAA 1KS4A 4IEZA 3SISA 5EIYB 2DCJA 2DCKA 3WHTA 4NAOA 3WTYC 3ULQB 4WXDA 5E1ZB 1ONAA 2ZO4A 2LD5A 4KQ7A 2DT6A 3ASOH 5DDJ3 1UY1A 3HOSA 1YHFA 4P96A 1FT9A 3NW4A 3QH6A 1QOSA 4PF5A 1FOD1 1KEXA 4FPLA 5JWPA 5C3SA 1OMIA 3LDBA 1WUVA 2I07B 1HSTA 4BHBA 4EJRA 4M3EA 5A2QK 1WCDJ 1TWFJ 2M5WA 2VN2A 4BS9A 2JPBA 2VMHA 5F39A 1UOGA 2W2IA 1WJ5A 2OQRA 1PP7U 2PI0A 3VD3A 1B9NA 3FDYA 1OQ1A 2MG4A 1LHUA 3CMAI 1G9CA 1PNGA 1COV2 4KA4A 2A3SA 3M8EA 3UJQA 3J7ZI 3I53A 1CAXA 4HPKA 4BE2A 1Z9CA 2Z79A 2YY1A 3RQ0A 1H6XA 3UKNA 3JTGA 2BHYA 1O4XA 1FOD3 1WH7A 1ZNPA 5HLGA 5JPNB 2Y30A 2V9VA 3LOBA 2CWMA 3JD71 3RQ4A 3JW4A 2B63J 3RSNA 2G9WA 1NY71 3HSRA 2HWE2 4A2UA 4CCEA 3BQYA 1SD4A 3LA2A 3HOUJ 4UFIA 3I2FA 1R1ZA 2QQPA 1PJRA 3GHMA 3U4SA 4K21A 3FZ3A 4AI0A 1Y0NA 5GJ6A 5DG2A 4Y33A 1OQEA 2HYXA 3FXQA 1JT0A 2VOOA 5AFBA 2WN3A 5FP3A 4COVA 5H20A 4D0PA 3ETQA 1AXZA 3W21A 1JKRC 2CO5A 4EJTA 1USTA 2R16A 4X0GA 3NNJA 2P1BA 2VL4A 5D8AB 5A3NA 3VZLA 3DU6A 2EXHA 1Y43B 4UV9A 1RKWA 1KU9A 4F52A 4CDUC 3ABUA 2COBA 2QE3A 2VMFA 2P4WA 4XPVA 3ZFFB 4KH9A 4UW6A 3LWFA 5CKQA 5EG0B 4IO9F 1O59A 3MI8A 1P4XA 5A3MA 1CVNA 5GZGA 2D5FA 3CJIA 1RMU3 2A69F 3QQAA 5M0TA 3EO6A 2Q2EB 2ZX0A 4AI2A 3BPZA 3VOEA 1UY2A 2E7AA 2EZHA 4Q4W2 5EEHA 3RTRA 1Z6TA 4LBNA 1RUC2 2WAFA 1W8TA 3M9AA 3P7NA 1NLSA 3MIGA 3TNQA 1GZWB 1TNRA 4ASMB 5FR3A 1DF0A 3MZYA 4MEYF 1HRV2 3HVDA 2R4GA 3MKZA 3WNOA 3HN1A 1I6XA 4QXKA 2HEOA 3TP0A 5LW9A 1BR4A 2Z2SB 1D0YA 1T56A 1N25A 1TLHB 2JQ7A 4BHCA 5FOJB 3BALA 1QY4A 4Y1VA 2EAKA 4DZGA 4E2SA 1STZA 2LW8A 4YEJA 1TC3C 2K0GA 3LFIA 2ELJA 4A69C 1D2SA 3H9QA 1EUUA 4BLJA 2P5VA 3F3XA 1H4GA 4YG6A 2EIBA 2VZPA 4XYXA 1DIWA 4KITB 4QQHA 4LOCA 1IOAA 4K3UA 3FBMA 3T8TA 5F0CA 2MEV3 1FIAA 2PELA 1DZQA 3LEIA 2DODA 5FYVA 4IEOA 3HIFA 4UBHA 2KHMA 3K3NA 1BYHA 5FGMA 5I0TA 4XUNA 4H55A 4TLFA 5JI6A 4BM8A 1N3QA 3HAGA 1QJU3 3S2HJ 2WV1A 3A2KA 1R49A 5FRNA 4MHUA 5K1YA 1CZSA 1XGSA 1MBHA 4PDWB 4BEHA 3LIHA 2DI3A 3HRTA 4QQPA 1QZEA 5EYRA 3RKYA 5JR7B 1KA8A 2QYOA 4JX6A 4YGDA 1W99A 3MIEA 4X8PA 3LEKA 4IL6C 1OCCH 1Z05A 4E4SA 3N7LA 1HQLA 2F48A 3QAHA 4XSZF 5FLXK 2QQKA 2W46A 3NJYA 3QP6A 1XQNA 2H6BA 4E8CA 2GMEA 2UXXA 5FKLA 2RR12 3S5AA 2W9XA 5L7OC 3W6VA 2VU9A 3CC7I 3QH7A 1OPOA 1Y3TA 2JIGA 3BWGA 2IWGB 1OCTC 1UXZA 1RYYA 4GCVA 2QZ8A 4MGRA 2FOKA 2YU9J 3VZOA 5GM0A 3OTFA 5KXDA 2W1OA 5FZ6A 2XAFA 4CEYA 2C5DA 3H92A 2VQUA 1FLIA 4YZ3A 3PHMA 2KQRA 1FIPA 2V5YA 2E26A 1VBE3 1MS0A 5DM6F 1MSEC 1I1GA 4OIQF 4LMFA 3MW2A 5K7PA 4OUMA 4FOYA 2A70A 4PCQA 4LG0B 1YIPA 1C28A 3A0NA 4BJTA 1X58A 1DGRM 4P9WA 1US2A 5KXEA 5IATA 3WF0A 3H1YA 3BG6A 3RZZA 2XG3A 1VQKI 4B1LA 1JMUB 1Q8SA 1UYYA 5E1RA 3QWLA 1DPRA 2R7OA 3AYEA 5FREA 3BB6A 2MSYA 3L9JT 1BJQA 4UYBA 2E6VA 2UYBA 3ZQHA 3QYFA 3LF7A 3HQXA 3VBUA 4OIRF 2HWB3 1W8WA 3ZN1A 3GFMA 2WADA 1FMD2 2DMUA 2MEV2 4XFAA 1GNYA 1FNYA 1VRH1 4LR4A 3FISA 3JQXA 1JU4A 1GQGA 5LA1A 2BV4A 1D4M2 1Y9MA 1YLFA 1QRYA 2MHFA 4M4RA 3LEMA 2DT7B 4ZZ5A 5A7OA 2L9SA 1VBB2 4CDXC 3HHGA 5A1FA 2ZEYA 1ZREA 4P9IA 4QSHA 1MDMB 1CONA 2GQQA 4D6RA 1QGLA 1S2KA 3WG3A 5ILVA 4L92A 2X85A 1BIBA 2FMLA 2VT3A 5IP9J 2P4EA 2XJTA 1AR62 3A0BC 1JYVA 2J5OA 3LPFA 1ASJ3 4JAAA 1A36A 3BTZA 1LJ9A 5DAXA 1YJ9I 1IRFA 2G4IA 1W90A 3V64A 3CU7A 2DU9A 1TBXA 1IN4A 4KU7A 2PHTA 1DG6A 1H2KA 1HW5A 1CN1A 2TUNA 2K4JA 4FPGA 3JQWA 3KCXA 3ZMSA 1SDDB 4V2WA 2C1FA 3H0DA 1VBA2 2A07F 1UZWA 2ZHMA 4I98B 4Q8LA 4YFXF 4GMP3 1NCQC 2X1EA 4WX9A 1QJEA 2C26A 3OG2A 3ZN5A 3KD4A 5JOZA 3K4DA 2Q0AA 1HQWA 3DGTA 5DUUA 5T5PA 1J83A 3H0GJ 2VTXJ 3PFIA 4E4ZA 1OF3A 4IXLA 3KT1A 2X0LA 5A3WA 1FATA 2A6TA 3CCUI 5FYSA 4WF2A 3KMHA 3JD72 4IE4A 1WA6X 1OCPA 2HDDA 3JB4C 4YM2A 4P55A 2ZTNA 3MPPG 5FZ8A 2KP6A 2YC2A 2JT1A 2WUHA 2F4IA 2XR4A 1LVAA 1OF4A 1W2AX 1E3HA 2COMA 1DU0A 1U9OA 4C1WA 2ZX2A 3ZXKA 4J01A 2WQ4A 4KJZA 4P08A 5A7QA 2CQ7A 5A3LA 4Y17A 4WM7C 4BZ4A 1UAAA 2CG4A 3FBYA 2ZXHA 2L9RA 3LEGA 1J1LA 3E7LA 3OYWA 1XMKA 2OC6A 4GFBA 2L9VA 3ZGKA 2NVYJ 4F3QA 4KMUX 1U0AA 2QQMA 5BNNB 1DYPA 1G59A 1DP3A 2AO9A 5JR3A 4IXAA 3I7DA 1FYMA 2BYVE 2W08A 4XMYA 1F4KA 4FVVA 3DECA 5J36A 4CCCA 1RINA 4BEHB 4RQPB 4CP9B 1UFMA 5BV6A 1VMFA 3OJBA 4HOBA 1G3YA 2KDOA 1JBCA 2HWF1 1KJLA 1QVTA 2DOFA 5M3MJ 2BGCA 4OMDA 3WD5A 3I71A 5KK1A 1ND2C 1OURA 2K4BA 1TWHJ 4II3A 4YW3A 1RHI3 1ON2A 4KWLA 4WZCA 4WXCA 1QBJA 1NA1A 1SBFA 1ZGAA 2KXLA 1FX7A 1A6IA 4OUEA 4Q4Y2 3BTYA 2VNGA 1JOPA 4AVAA 4JKMA 1CF7B 4U7DA 1PVXA 3S93A 4O6JA 4K8RB 5FV3A 2LKPA 1BN5A 1JYTA 5CLSA 1C0WA 4JP0A 1F5JA 4GXOA 1LFPA 1XNDA 3VV1A 2ZSHB 3RI4A 1MNDA 4AGGA 4LBQB 4Z07A 2O0YA 3VZMA 1XX5A 3F6OA 2BBVA 1C8M2 1QXRA 1MACA 2FMDA 1FYUA 4Q0UA 2LKXA 1V5FA 4EM0B 3HBZA 3OYKA 2W25A 3VHPA 3GTPJ 3KF5A 4XOGA 3VBSC 1K12A 1NA1B 1AKHB 4P9YA 2PTMA 1SCRA 2Y33A 3JBG1 3DU5A 1ZZ9A 2VMCA 2R071 5FY7A 3DYOA 3BKZA 2JRTA 3DWLE 2CHHA 3K2AA 3PL0A 2YGLA 3AMHA 1ONVA 4LLGF 3QODA 2DTYA 3L2HA 2D1VA 1B72B 3C3VA 3FE5A 4OMCA 1WBFA 3P1IA 5J1UA 1R7JA 3ZSLA 3AL0B 2ZOEB 1MMDA 3AYDA 3NAPA 2ORXA 1W9YA 2W85A 3O0VA 4A3ZA 5JLVA 2QVSB 5C3EJ 1TMF2 4UHTA 2ZSIB 2CUJA 4BBSJ 3PIJA 2ZMEB 4RD7A 3GZNB 1QKQA 5KHKA 3A02A 4JKLA 1OA3A 2QQAA 3BTIA 4EJOA 4MGQA 2YBPA 4XCBA 4EJVA 4B4QA 4XURA 4MFDA 3OL4A 4UFJA 1HIXA 1V70A 5FMDA 4Q4V3 2EICA 2M87A 1FMWA 5EP9A 1ZH5A 3B94A 4KU8A 5E3OA 2RDNA 4GDFA 3A23A 2D93A 2BVLA 3WG9A 5JIUA 5LLQA 1C1LA 5CVVA 3H7JA 1QQP2 4QHBA 1TZOA 2ADUA 3V7RA 2CQXA 2OX0A 1ZG5A 4ZONA 3O1TA 1VRH2 3JU9A 1LE8B 5LK7B 1IS3A 2VW2A 4RFT0 1K5MC 2EA2A 3IH3A 4RDUA 2XJQA 1IS6A 4CCJA 1RGSA 3SHRA 4AEDC 1VBB1 1LGCA 4NN0A 4CYDA 1W6OA 4IDZA 4OIOF 3A01A 1W03A 4Y15A 5D6EA 3MIHA 3CCEI 2YFUA 2G0EA 2K46A 4SLIA 4XETA 2HWC1 1WGXA 1CAVB 4JKKA 2V6CA 3A7QA 3DTKA 4PZJA 1ZYRF 3EPZA 1UL9A 4MOAA 4A3EJ 1FNZA 2JVGA 4CZZA 1VQNI 1TT5B 1NG6A 4KI5M 2C6SA 3BCWA 4JGZC 2GMMA 2DK5A 1XYOA 2JTVA 5DTDA 3KQ4B 4JCKA 3ALQA 3LD8A 3WQ0A 1ZARA 2VPRA 3IWFA 2ESNA 3EQEA 4GMP0 4JGYA 4U2AA 5IVVA 1W06A 5B66C 1GANA 2QM3A 4AWXB 1V6KA 4NDLA 3J80K 1EAH2 1FMD1 3I2HA 4F93B 5A7PA 2D6LX 3BC8A 4PIYA 1DLCA 1IG3A 2XOMA 1AKHA 1MQTA 4EGZA 4FQZA 4RM3A 4UF0B 1P6RA 4JGYC 2RDQA 2XQRA 1NK3P 2AEYA 1ZKGA 5EGOA 4PJMA 5FJ8J 1MZBA 1W0OA 1U5TB 2RS53 3GX4X 2M7BA 2Y0IA 4BDZA 2XVKA 2DU0A 3HUGA 2PBIA 4Z82A 3BOPA 2A6EF 3HEIA 3JB8A 4JGZA 3A21A 2L7KA 3I3EA 3TMOA 2EIEA 4DPNA 3ECOA 1W36C 1OVPA 5JSOA 2KPMA 2FDKA 4Q1PA 3HC7A 2LOOA 3FLPA 2LY2A 4DXTA 4OINF 1AYM3 3RKWA 1W05A 3EYIA 3KLSA 2VBPA 3GMEA 1QEXA 3VDDC 3LAPA 5FUPA 3JBG3 1CX1A 4I0AA 2LR8A 4IVNA 3RJRA 1G9AA 5FMCA 4BYYA 2OVUA 4ORFA 2WA0A 1D4VB 4AW7A 5KC6A 2IXHA 1YEWA 5C4WC 2HXIA 3OV8A 5FLHA 5L36A 2L02A 2BGOA 2Y6HA 4N43A 3M4OJ 1G86A 2AS5F 5I0DA 3LSEA 3EUHC 2DTZA 3MPBA 1E57A 2LRPA 4BE3A 2ETHA 2BOJA 3HOYJ 5F0FA 1R5GA 3GZEA 5FKCA 3KP4A 1V6IA 4MGZE 4TYSA 4DEQA 1HRV1 4XIOA 4M0NA 5FY9A 4UFHA 3C7JA 2TNFA 1TME3 2KJCA 4Y5SA 3WG2A 2IS1A 4ZU4A 5J98B 3VBRA 3QBQA 3A4UA 4GWJA 2ZEXA 4JYKA 1SFPA 1U8RA 1VQ6I 1X3ZB 4IRHA 1TVGA 2VQHA 5DAVA 1AUYA 1S0CA 3F95A 2K9MA 5JI9A 3ETPA 4ZDPA 2ES3A 4U87A 1YQ2A 3BU7A 4FOQA 4CP1A 1A34A 3WGHA 1H9WA 3MDPA 1JN2P 3BDDA 1ZRCA 4ATEA 2C4XA 1HRI1 2DMNA 4HX4A 4XUOA 4A3DJ 5F08A 4AQSA 4XCAA 4ZY9A 2CV2A 3FX3A 2YPRA 1E3OC 3JRBA 2Y0OA 2LF7A 4R9AA 4XKCA 4KICA 3I2OA 5BQTA 4M0HA 1IW7F 4GULA 4D5CA 3RDIA 1LOGA 1XE8A 2J22A 5FFXA 2UV1A 4BMEA 4CCKA 2D3PA 3L00A 4MXWA 5KHDA 4O5VA 3O1VA 3PNYA 1R092 2WFF1 4G12A 5JSRA 1RUE1 1B35B 3EB7A 3K1PA 1ODMA 3I58A 4MEXF 4I3GA 3WOGA 2LALA 1LEAA 3R60A 1DYOA 5EWSA 3I2KA 5HDKA 3AAFA 2OW4A 2BJSA 1UIKA 4N7UA 2C9KA 1EA3A 5GPAA 5LBQA 4E7LA 3NV1A 5D5VB 2NS8A 3ZMOA 2ME6A 2X8KA 1CGPA 4ENNA 4QTRA 1O6UA 5FXZA 1BI2A 3HOZJ 2DFBA 5G04L 3S1RJ 4C3IJ 4YARA 4YLZA 1Q8QA 3GCWA 2JX9A 2WNVA 3WQ7A 5DUWA 1VRH3 3O1OA 1UYXA 2E1OA 4OCTA 2K40A 3TP3A 2CGNA 1IDYA 2W00A 2QCSB 1YW7A 1OUSA 2PQSA 5DAQA 2VLAA 4Q4ZF 1LHOA 5HLHA 5L3FA 3AYAA 3N36A 3LIGA 4BUPA 4O65A 3J80Z 1OKRA 2OZUA 2IAIA 3LQCA 3G2BA 3MBWA 1AWCA 3AL0C 1WKMA 2WLQA 5F5AA 3ES1A 4AG4A 2JG8A 3MUY1 4RS5A 2HBUA 1T08B 4JGZB 1AL0G 4QX5A 1PK6C 1RUI2 1VMJA 1GOFA 3Q0WA 3ZMTA 2UY8A 3CMMA 1Z3XA 2KT0A 5AIQA 3AM2A 1SAXA 4TLGA 2ZJCA 4ESBA 2AGSA 4DUVA 3DPUA 2WSVA 1DQ4A 3WDWA 3PO2J 1VBE2 1YO8A 4PK4A 2OTLI 3ERED 1XBFA 3F72A 4G9SB 1UZZA 1RL3A 2WZ8A 2ZXJA 4F92B 5KWRA 4U7BA 1SLAA 2JDPA 2YFZA 3RWNA 1A04A 1IXCA 1WI9A 1VE0A 3RZOJ 1LU1A 4HL0A 3V8LA 3HNYM 2R1DA 2ID3A 5JVGF 2Z16A 3BR1A 3Q5FA 4E6KG 5J09A 3KETA 3K10A 4Q4X1 3WEZA 5KXBA 1DYKA 3ZX7A 5JUVA 3ESWB 1UHWA 2RJ2A 1UYPA 2PA7A 1MDMA 4A0ZA 3ZR8X 2EV5A 1ND2B 2D43A 1IRZA 3FLRA 4OOIA 3SFZA 3KT4A 3OEBA 3LWCA 2ELHA 3JCIA 3B5LB 4XFGA 1HLVA 4J1WA 1V9U2 1VB4A 1UNBA 4RQPC 4P9GA 3BCBA 3AX4A 3WDXA 1G3SA 1TWGJ 5GZCA 3U78A 3AFHA 3H3VK 1BBT3 1RUG1 2CU7A 4IKFA 1S4CA 2E1MB 4HLYA 1AR93 4L5JA 4OQ8A 3KT7A 3O8HA 1O57A 1R082 1OYYA 3P3NA 4JZRA 2VBXA 4MX3A 4WM7B 4IEJA 4V2GA 1W8ZA 3RNSA 1JXNA 1YX5A 2ZHNA 4CDWA 4NPRA 3PVNA 1TL8A 1MS1A 4NIAA 2QQVA 1HN1A 2RDPA 1WCSA 2XDVA 3NKGA 4JRLA 2BY2A 2GN3A 4P00B 3HL2A 5KR7A 2CYYA 2IS4A 1D7PM 5HDGA 2WZR2 3FK6A 3C18A 3NL1A 1XNCA 4LQRA 4RB3C 1YFYA 5FLXZ 2MBFA 1G9DA 1W2TA 1EV11 1U0JA 2IEKA 3TDUC 4KG0A 4NE9A 2C0ZA 5A80A 3R05A 4MFEA 4CXXA 2JJ6A 4A41A 3JAMZ 3MICA 4MQ9F 4H14A 4YPJA 4UW4A 4YZ2A 2DCEA 2F17A 2JSPA 4UVAA 4IQPA 1DHKB 4AGVA 3L2UA 4LO6B 3DL3A 2VE9A 4A3JJ 3I0TA 1LU2A 1E3PA 4AFCA 4B8EA 2K86A 1RUOA 4B7EA 4LOSA 2P37A 4GWMA 3KS7A 4Y1XA 3GBWA 3OSDA 4AEJA 2PAKA 3ISPA 2IPQX 2XB0X 4OZOA 2EZIA 2JE8A 4KT5C 5FPAA 2LH9A 1QJY1 1N1YA 5CKTA 2BW3B 3TL4X 3EUKL 4XLPF 5DMYA 2R0QC 3FHIB 3UKTA 2VC9A 5D6FA 2JEMA 1JOBA 1C3HA 2ZHLA 1ZA4A 1TW2A 4DNCA 3S1MJ 1ETXA 3K4CA 3BTCA 5FWEA 5BNNC 2NNYA 4A93J 2MW8A 2YC0A 1ZA7A 3SKVA 2DA7A 5LEJA 1K4TA 1YI7A 4HN0A 2P6TA 2PHRA 1VQPI 5AVAA 5ILSA 4YELA 2V26A 3MMYB 2PMUA 3X29B 3S57A 2ZAAA 1RUD1 4XFFA 1MJAA 4JDOA 3DPTA 3CZJA 3ELNA 1VBA3 2KISA 5K0UA 1APLC 4IQJA 2EFQA 5IP7J 2MD0A 5FXXA 4DUXA 2YU3A 3FXJA 4L9BA 2IS6A 3I49A 1TQIA 2X6XA 1CAUB 2RN7A 3ACGA 3E5QA 1YIOA 3VZJA 4IV3C 3M70A 4CEWA 4CZSA 2F4PA 3KYLA 4XXPA 3AFGA 3QRFF 2KA3A 2GXAA 4PQQA 3M3YJ 2XSJC 1RESA 3CJXA 1X4OA 1LPQA 5B1BH 1YFXA 4ISQA 2ZACA 5BXXA 2PAMA 1U8BA 3OIQA 3CMYA 4Y4RA 2VUAA 1EAH1 1VBB3 2ZMKA 1O3SA 3IHUA 5JR2A 4KIBA 3U1XA 1BBT2 5T5OA 3GYDA 3VSLA 1T38A 2VOPA 3FF5A 1WJFA 1JZ8A 4U0YA 5L3GA 2HWE1 5CKMA 4RBOA 2DUOA 1PNFA 1XGNA 4CEWC 4N43B 3X2QH 4IV3A 1U5ZA 2PG4A 4N4NB 3HPGA 3A0KA 4PBPA 2XAQA 1G2HA 5DPNA 3QPTA 4LO7A 1EH7A 2FNPA 2VE8A 4PDWC 1MMGA 4CDXB 3MIFA 2WO1A 1PGSA 1IZ3A 3M2MA 2EXKA 1USSA 1PO12 3OYDA 2OA2A 1W3VA 2WNUC 1XGMA 1OPMA 3ZR5A 5I0UA 3NEUA 3PQKA 3OS1A 4RAGA 4KUMA 4B4CA 4KNCA 2X53S 4XIKA 2VTFA 3D8CA 1IRXA 3CLPA 1I1SA 4MV2A 3J81Z 3K9TA 4H0EA 1MS5A 2BY0A 1POQA 3KFWX 4LTAA 1P9QC 2FHRA 2X51A 1V3FA 5JZGA 4RGRA 2CH0A 1O8SA 3KPHA 4QM9A 3GM8A 1YJKA 1HKDA 3FHQA 1L3LA 4XLHA 1HKSA 3LOCA 4HF1A 1MW7A 2HPMA 2WY8Q 2L5QA 4QX0A 5C6CA 1W7PB 3WSOA 4ZYGA 3KLNA 4QM8A 1OYIA 4E4HA 2PAEA 1LKXA 5E18F 2FCTA 2VECA 4W50A 1OUXA 2RE9A 1CWPA 1ZVFA 2VXZA 1AA7A 3A01B 4QHZA 3ITQA 2Q8OA 3E6CC 5FZ9A 3RI9A 1DQ6A 2DVDA 1KQRA 4PUSA 2Y9YA 5BNPB 1IC8A 2KRFA 3ZFFA 1XDUA 3E5XA 4DBQA 2DO7A 4QB6A 3F8FA 2JDYA 1G3TA 5CG9A 1CAUA 4LBLA 2TCTA 3IDCB 3BG7A 4JTOA 4CE8A 4L0YB 3EYPA 1AX1A 1YJNI 3CDHA 2LG4A 3EJKA 4XLAA 2XVCA 5E88A 2CWEA 1FYKA 4OHVA 2VKEA 4N7IA 5DDJ2 3CUQB 2DT5A 2K9ZA 4Z1VA 4I6ZA 2OBPA 4M3CA 1D1BA 1UOFA 3SNMA 3HRSA 2WFF3 3T2QA 3WW3A 1MJ9A 2R7FA 4YGBA 3PSFA 3WW2A 3PVEA 4CSWA 3JXSA 2HQRA 5C4WB 4G4FA 3ZFFC 4IE0A 4XUQA 3L2RA 4XOPA 2QBYB 1Z7S1 3RYRA 3GALA 4B44A 2A1XA 4L0PA 4HK9A 2WTEA 5F37A 3V7CA 1V4RA 4HV5A 1G8WA 1FTZA 2JA6J 1ZBA2 1OI6A 4B29A 2HOSA 2O0OA 2GXBA 5A3TA 1VBD1 3AG2H 3GZUC 4NQWA 3LSHA 3RS6A 3VKFC 2LBFA 1HBXG 5IUQA 3I2GA 4GKYA 3H36A 5J3UA 3S2WA 3B9CA 1QWRA 1XU1A 1C8M1 3WUCA 1QVUA 5D4RA 1WJCA 4L9NA 4NBQA 4Z2YA 1KD7A 2L7MP 4BKXA 3H5RA 3BVCA 2XBO2 1SFKA 2EK5A 4MUVA 4DB5A 4MO3M 1EH6A 3H3LA 4DQ2A 2PMHA 1NLRA 5IPAA 3ZYRA 4FPKA 4KISA 2OT7A 1OA4A 2VJXA 2JG9B 4LIUA 1RJ7A 2R1BA 4UUSB 1R5ID 4W4ZA 5DXDA 3FUOA 5K9YA 3K7AJ 2VZRA 1PO11 3KZYA 1K79A 1RUNA 2AXTC 3ML6A 2IGMA 1RVF2 1JODA 2XJSA 1FMD3 2R92J 1E5HA 4PQ9A 4G94A 2PLV1 5FFZA 3FHNA 2FDHA 4OI2A 1S0FA 2WS93 1RUF2 2DJIA 2IC1A 2L0KA 1VQLI 2VQLA 1PIV2 3T4HB 2PHWA 1V54H 1VLNA 1HJGA 5GTIC 4FSJA 4ZJZA 2RNJA 3ZXAC 3ZIXA 3DFGA 4XZUG 1PVC2 2XF6A 1E5SA 5H9QA 2CRGA 4XXAA 3TB0A 1W0PA 3O2PE 3AJZA 4N53C 1H89C 5BYNA 5GKAC 5D8AC 4FCAA 2JZYA 4RB0A 3N9OA 1GV2A 2VOKA 3AL6A 5FK7A 1Y56A 4H7MA 4YW1A 5FQ0B 3IPVA 3S14J 3WCSA 5JZGB 4Y5TA 4M72A 2NVTJ 1MNMC 3PUBA 2VH9A 2E35A 5DAPA 3EBRA 3SC7X 3C7EA 1WMFA 3FC0A 1PP8F 3KP5A 3K2ZA 3EETA 2M34A 5CEHA 4BQXA 5K0UC 4MXVA 5CVRA 3SDBA 2XGCA 1OLMA 2AZ5A 5A70A 4LKSA 3ZDVA 4C1XA 5KHGA 2JVHA 2ZGSA 4ENMA 3FMQA 2E2JJ 3ZVXA 4LLFA 1F1ZA 5L73A 3DV8A 2XUMA 2K7LA 3IAM2 4HG2A 2CDPA 3POIA 3GNEA 3GHNA 3B6AA 4RFRB 1GU3A 3SZGA 4LB5A 1ZBE2 5HS8A 2IXLA 2DUQA 2MC3A 2RS13 2IVIB 4HOOA 1GMMA 2DBBA 1YUDA 2DDBA 2MFZA 2WDBA 2BY1A 1DCSA 2G19A 3L1PA 5LA0A 5EZWA 4K1ZA 5M5YJ 5LEKA 2V6EA 3MD2A 2QQIA 3K77A 1OH3A 4QXHA 4RGAA 3WTTC 4RR3A 1N47A 4XHXA 4COUA 1FWZA 3TEZA 1AR82 4ON0A 4XIDA 3P6BA 1T0FC 5BOXA 5FD6A 2F4LA 1CZTA 1L7QA 5C8CB 4Y13A 1FOXA 4CDUA 3PDQA 1AR92 3VSKA 1ACCA 4XUTA 4C3HJ 5GLVA 4A3XA 1Z7LA 2ACJA 2ZGLA 4A6SA 1X3UA 1W6NA 1R6RA 3QYEA 4DJAA 2BFUL 3WUDA 1WI3A 3VD9A 2VNRA 2MGQA 2FBEA 4F91B 1LB2A 2NYXA 1H0BA 3GVAA 5FPLA 2AXLA 4QPGB 3ZMVA 3AMQA 3BR2A 1RHI2 3RZDJ 4XF3A 1VQ9I 5LBEA 4HK8A 2O8QA 1BEV1 3NWKA 3FJSA 2XPUA 3HKZN 1ZK8A 1QJY3 2W1UA 3ABKH 2CNAA 2VULA 5HV0A 1MZFA 5E16A 2LKSA 1FYLA 3G73A 1ZQ3P 3UGFA 4XRSA 3PU8A 1QDCA 5FKNA 1RUG2 5KAFC 2QQBA 4FCYA 4E2QA 5FO8B 2MPFA 2HVQA 5I91A 2PLV3 3E1F1 1ZTRA 1QXPA 5AC93 3AG4H 3SH3A 4XF4A 4GRIA 3DPLC 4D7NA 2IXJA 1ULGA 1XJAA 5C4WA 5HXMA 1Z6RA 5JVVA 4M74A 3CO7C 3AP7A 1UN1A 2BNOA 3IC7A 2WR9A 2EFNA 2I45A 4BQ1A 4P9JA 1X9PA 2QVOA 2WNOA 4JK1X 4ZHNA 2E71A 3PUAA 5F32A 4W6WA 2XRNA 2WO7A 2ZGOA 2DU1A 3C2GA 4LLLA 1YXWA 5L3EA 2QA4I 1W39A 1YQCA 1VQOI 3I2IA 1C4RA 3THTA 1ALYA 1NUKA 3K4ZA 5IVYA 1JZ2A 1VR3A 4O7XA 3SITA 3V8JA 2XGXA 3H5AA 3HJRA 1K6OA 3DEWA 1D2QA 1YITI 2KIMA 4HW0A 3H50A 4PSXA 1R00A 2JDUA 4KGQA 3L7WA 2HWD3 3FXMA 1IAWA 1XB4A 1YW9A 1LGNA 4BQWA 2CDOA 3I64A 4WK8F 2G7HA 2Z9OA 3ZN4A 3GCMA 3ILFA 4XUPA 2ZKLA 1VB2A 1L3JA 5C3QA 5J37A 2O03A 3OUHA 5TGTA 3VBOA 3ECHA 2FMYA 5CB7A 5FZ3A 1JJ6C 1QJY2 4V2VA 2VQ0A 1POV3 4PFOA 1S7OA 1BL0A 1J75A 2W94A 5F1RA 4M3CF 2CUFA 3GUDA 3K0LA 3K4KA 1PZ8A 5HLTA 1XPXA 3S15J 3RZLA 1QNYA 1X7NA 4YZ1A 1LEMA 1ZZCA 2HDWA 3TYJA 1XYNA 4TWTA 2YX4A 3ZN6A 1FX5A 4LKEA 2XWBB 4BJ0A 5IK5A 1MKMA 3DEUA 2QBXA 2JK3A 4LA3A 3V56A 4V1PA 3DKQA 2E7TA 3GFIA 1ZG3A 4QX3A 3VB9A 5JXGA 3PUSA 4LE3A 4IV1A 4BB3A 1OR7C 3F21A 1UKRA 2ZXWH 4A0YA 1JYCA 1SFUA 4ZZDA 4J00A 2F5DA 5IOZA 2KZGA 4M71A 2L7ZA 3MEPA 1D1CA 3FLTA 1FEXA 2L01A 3OYWB 3UGGA 4ZC3A 4AEDA 3KCCA 3CCVI 3CEWA 3UNGC 1LTEA 1W6MA 2MLKA 2DTWA 1RUJ2 4YW6A 3WR0A 4P5HA 2R7TA 4GH4B 2NQYA 2CMPA 4BBRJ 5HPOA 4XC9A 4OUSA 3VYRB 3I5UA 1W2NA 4R9CA 3CUQA 3LA3A 2XAUA 1HRI3 4CU6A 4A3IJ 3NNFA 3DBHB 1Z7S3 1QQP1 2CSGA 4GMP1 3ZQ7A 4AF9A 2Y6JA 2G9FA 5J4VA 3IIIA 4C30A 5F64A 3RKXA 2DVFA 1LDJA 3B3QE 2GA1A 4RQPA 5BPIA 4CP9A 3ZO0B 1JXSA 3SZPA 3I56I 1FPN2 2YZ4A 4QGNA 4JTNA 1JHFA 5HXVA 3D5SC 1OD3A 4YIIA 3T09A 3GYHX 1MBKA 1SVOA 3WP3A 5IP6A 2ID4A 1POGA 3TBIA 4BDVB 1AR73 4XVHA 3UK9A 2VI6A 3KP7A 1JYIA 5AVPA 3OYIA 1W9WA 5GADJ 2VVDA 2A5WA 3AZZA 2AQEA 4OMZA 4JX0A 2RS33 1P2FA 2K9NA 5BNQA 1FSEA 1EPWA 1SMTA 3S2DJ 1NCRC 4RGXA 4UAPA 3W2WA 3JREA 1XSQA 2MH9A 2E9QA 2QQNA 5TISC 2HVSA 1CF7A 2RGVA 4M3CE 3R61A 3WZ1A 1Y1WJ 3H0OA 3WTVC 1TWAJ 2DA5A 1MBJA 5KNLA 1QF3A 1AYN2 2WINB 2CY6A 4LPLA 4NHKA 5LK5A 4IPAA 4BACA 5K4LA 2XJPA 1UB9A 3OYEA 3R0JA 4UFMA 1R64A 1SLCA 1PZ7A 3F8CA 3WDUA 4RR3B 2JB4A 4M3DA 2R061 3M1HA 4UUTA 3OYCA 1NT0A 4X8NA 2MNGA 3WNXA 1X19A 3RRDA 5T5LA 2F2EA 1TQMA 4ATFA 1HRV3 1FBUA 4KYWA 2JKBA 5HLIA 1XSRA 2BHZA 1TNTA 4B1RA 1WH5A 2E7WA 4GWIA 2DCYA 1S72I 1WFXA 2ZMNA 1XCBA 1CPNA 2DV9A 3M4FA 2IS2A 5ACA2 1OBNA 3FMGA 1JI6A 2DYRH 4K6BA 2WO2A 1ITYA 5DUKA 2K5CA 1T6GC 3K4BA 2XKOA 2OJED 3CCRI 1DGRN 5GAEJ 3EUAA 1MBEA 3HEFA 5C9AA 4FTHA 2M3AA 1HQNA 3LSPA 2AR6A 2L4AA 3VHNA 3AXEA 2P17A 3S6PA 1MEC3 4HLTA 2OXBA 2RDSA 3DPRA 4DXSA 1HKQA 3U10A 1VBC2 2ZJPF 3TWIA 3DYPA 5FPUA 2CQQA 3MQ0A 5FRMA 5F0HA 4DIQA 3N7MA 1LECA 4NPLA 1R22A 1KU7A 5BNNA 1UU6A 4SBVA 1ENRA 5AONA 3K69A 5HNFA 2J7MA 1LR5A 1ORKA 4V19K 5BNOC 3P9IA 4FPHA 1W5SA 1Z7S2 2D6MA 5A7SA 4TTGA 3ERMA 4B48A 3I59A 3OOUA 4ZYDA 1W6OB 2ZGMA 4LHLA 1OLME 3D0SA 3UL2A 5EHDA 4IV1B 1KS5A 4DYRA 5J1RA 4FHTA 5ISLA 5IVCA 5ED4A 2O8XA 3RJPA 1R091 2WFF2 5FYMA 2PJRA 4BJ5C 1YFHA 4A3KJ 3Q9VA 2JA8J 4GB32 5EJ1B 5LZ6A 4GH4A 4LOTA 5GAHJ 4Q2FA 4ZS3A 1RZ4A 1HW1A 2P7CB 1HW2A 2LS6A 2W24A 5FZLA 2DA2A 1FOD2 4M4PA 1JZ4A 3CL1A 3VODA 3OD4A 3D0JA 4QB1A 4HSRA 1YQAA 2DJNA 3IP4B 1JUPA 1K78A 4GALA 1F4HA 1UYZA 2A6HF 2Q1MA 1RB8G 4PBOA 4XLCA 1X82A 4GGGA 4Y1YA 2DQLA 3GTGJ 4CU8A 3O0XA 3VBRC 3AKZA 3DCQA 5T5JA 2PMZN 3OIPA 2GC2A 2GP5A 4ZTJA 4HBLA 1FMVA 5JSPA 2OQ6A 4RB1A 3ZXGA 2CTVA 3AKQA 1QU3A 2WSUA 3HUGB 3F8MA 3GZTB 4CYCA 4CP2A 1OPCA 2VNVA 2JD9A 2OQ7A 2RQQA 5DYMA 4L99A 2GC3A 2KRHA 2HTSA 3SFIA 2EILH 1PMHX 2CV1A 3FFQA 4ZH4F 4TZDA 2B9UA 2HLEA 4KGGA 3HBLA 2VE1A 1GLHA 3HR9A 2ZHKA 4F3JA 2HQAA 3NV3A 1X8MA 2GNDA 5BNOA 4IE6A 4W8JA 4LIVA 3ZYJB 3GF6A 4XBQA 1QZZA 1ND3B 4ESJA 4FPOB 3O1PA 1VF9A 3ACFA 1T33A 3GXOA 4FETA 5JVTA 4Q4X3 2WN2A 3HJEA 1HXS3 1IKPA 4NO4A 3N9NA 4FX0A 1CQTA 2W82A 4MGYE 2P6CA 4CDGA 1JTXA 1GHCA 4JBAA 1U78A 5TRDA 1ZLKA 3KGZA 1JUIA 3ZFGC 5LBFA 2HWC3 2MH2A 4BK4A 1IQDC 2XAGA 3J81K 1J2XA 3N4MA 2M2EA 4FAHA 2VKHA 1ETKA 3QPSA 4JDNA 2AACA 1CR7A 3PIOF 1XN7A 2O3FA 1BEV2 5EDNA 2FQ4A 3R0AA 3WE2A 3LAJA 1SEUA 3IDBB 4DNYA 1N78A 2WT0A 5HODA 5C3PA 4Z6YA 2EA7A 1Q5OA 1S6LA 3FM3A 3Q8CA 2A3WA 3MUZ1 4NC7A 4BXFA 1W28A 5FMOS 3IT8A 4AQTA 1OKQA 2ERFA 3BTLA 4RS8A 3BROA 2XPVA 1DPUA 5CFCB 2RC4A 1BC7C 2XMLA 3AMPA 3LAGA 5E79C 1Y0UA 3CJQB 3MW3A 1NOVA 4CH7A 3PVBB 5I8YA 1PGL1 4D0QA 4NIIA 3OOXA 2WAQA 4ZU5A 4XBNA 1W2UA 4Q27A 4AZZA 3IB3A 2K3FA 4YM1A 2ETEA 1JGSA 4QGMA 3MKYB 1TME2 1MH4A 1LEDA 1UU4A 3T0AA 4AVSA 2X09A 3M3CA 1W8HA 5IAVA 2WNUA 1ZN2A 1YQ8A 3ZQFA 1LENA 3UYJA 2NLRA 2R7QA 3B69A 1V6JA 2LBFB 3PQJA 3LPGA 5GTHC 2BXYA 2Y34A 2XL9A 1NCRA 3HTUA 1H2NA 3KHCA 1WCKA 5L9BA 4B3AA 4LBKA 3OYGA 3E97A 2BW8A 2GZWA 2XXZA 3ECQA 3NO8A 3TQNA 3GBFA 1GWMA 2JWTA 2OD5A 1G9BA 1GQPA 3KWVA 2IVMA 5LASA 2RR13 3ME2A 4GD4A 4MLOA 1B8IA 3FHZA 2ZGRA 2AREA 1BW5A 2ZCWA 5JOYA 3FKIJ 1YFUA 4O3MA 3MF6A 2NS0A 1N75A 1A3KA 1NG0A 1SD6A 2FBHA 2WV0A 4S2FA 2YSRA 2JG8C 3L2CA 1G6NA 2KIUA 2NOJB 5D8KB 3GTLJ 1WA4A 4W65A 4RS5B 4M01A 1RITA 3FMRA 4HA8A 4TXWA 1XYPA 5L3CA 3FXKA 9ANTA 4YFKF 2RR11 4CXWA 2RHPA 2FCUA 2WAOA 4Q5OA 3IAPA 1MS3A 2VOTA 3M7GA 3SCFA 2DAOA 3K2OA 4AC0A 3DPRC 3OBRA 2RM21 4BQNA 3TN92 3J26N 4HNVA 3TN91 4CYCB 1D3YA 3SDGA 3D82A 2BW3A 5E20A 2LP0A 1WCMJ 4FOWA 2MC4A 1KDKA 4RMNA 2O8OA 4MZUA 1RVF1 1E5RA 1Q1HA 1F9NA 3OWTA 2X9DA 4XMIA 3JRIA 3PJQA 3GTMJ 3HDDA 2UWCA 2QZ2A 1LNWA 1AHSA 3BR3A 1HSJA 4JQFA 4RL7A 1R1A3 3FMSA 1MGTA 2XJRA 4D7MA 2PX9A 2KDZA 2A6VA 1OLTA 3VN4A 3W6KB 3LFMA 1WKYA 1TWCJ 1UU5A 5EJZB 1KONA 1YLLA 5FQ0A 4CUAA 4K9SA 1LHWA 4JVAA 2QQLA 1S0JA 4QX1A 3VBRB 1OHFA 4OHXA 1ZZ6A 1VBE1 2IA1A 3CP8A 4HN1A 3Q0UA 1FY7A 2DFIA 5JXJA 1V9U3 2IGKA 1PUFA 2EA4A 2XHKA 2L9NA 2P5LC 4P02B 1H9PA 2DDUA 2Q8EA 2P5BA 4P14A 2H8RA 1KITA 3OGVA 2BOLA 1QJFA 3RQIA 2MA3A 4HKWA 2VC0A 1UG0A 1RNLA 4XBLA 3N7JA 1AYM1 1J84A 4PHZA 1QXJA 2W5FA 5LRSA 2F5CA 2JSCA 3WTXC 2PLYA 2K27A 4HNTA 2NP0A 4PJJA 4W97A 4FPEA 5FZOB 2VW0A 3BYWA 2OF7A 1UMHA 3ZSMA 4OQ9A 5ICCA 3CCMI 1VTNC 3T1BA 1GXQA 4AI3A 5FCCA 3KEYA 4A5MA 1HXS2 1ZBE1 2D40A 2PQQA 5EPAA 1HXS1 3WCRA 1OT5A 3H35A 4IESA 4CHUA 1RUC1 4D7YA 2R7RA 1J9IA 3B6CA 1OCRH 5A3UA 3H9JA 4HQMA 3R4SA 2K3PA 3ZN6B 2KM2A 1N77A 2DDAA 3ZYIB 3DXTA 1AZDA 1U2WA 1PGW1 3J7LA 3TRSB 5DEQA 1HX6A 3F0CA 2X5IB 2P81A 2RJKA 4HAMA 1IUFA 2EIMH 2HWE3 1ZELA 3C3WA 1TNFA 4I01A 3WDYA 1QPIA 1TNSA 4MVTA 1HKTA 5CIRA 3LSRA 3A0HC 4CPBD 2EB7A 4LGWA 3CZ6A 3JAMK 2BV6A 1JUHA 1FXZA 2X48A 2FDFA 4MADA 4FQGA 2N8GA 2QKDA 1LUJB 4DQAA 1QNTA 3CC4I 2QQOA 4BISA 2RREA 3N9LA 5F04A 5FRAA 1WWXA 2NXNB 2RMU2 2P0WA 4F7ZA 3LE0A 1COV3 3JUUA 5FUIA 3WX5A 3DN7A 4WCGA 1XDSA 3D6EA 2PMZA 4GH4C 1J7KA 1EV7A 1OYWA 3K1NA 2G7UA 1KYWA 3PLQA 2VZOA 2HKXA 3PURA 2F6CA 2A6YA 1Q8PA 1KXGA 2CGPA 5K7FA 4COZA 4NHLA 4GA9A 5IVFA 3CP2A 2JIJA 2R5ZB 2WKKA 4Q4Y1 3HOWJ 1YQ5A 2PLV2 2WNUB 4AL9A 1EKEA 3WF3A 4BNCA 2PHFA 3WG1A 4LULA 3POBA 5CVIA 4NC6A 2LNBA 2EFWA 5D4SA 3NSTA 4IHYA 1NK2P 3AC0A 3POFA 3ZXFA 1VP6A 3TW6A 4KMFA 1NZCA 3T2TA 1W9SA 2R0FA 1KFXL 2BWCA 3K3OA 5A7WB 5FZ0A 1I3QJ 1VNDA 1YIJI 3RYPA 4GKXA 2O9LA 2FA5A 2RS11 2EALA 2QSGX 3KP2A 4XOTA 2MEV1 1P4WA 3OYBA 1B8IB 2HVRA 1S2EA 1ENHA 3H5NA 2PMWB 2IP2A 1IQAA 3I55I 3IKWA 3FM5A 1ND2A 3JRFA 3OD0A 1YRZA 3ZFEA 4W1UA 4P5OA 3V65A 5K5QA 4XDPA 1WW6A 5A1AA 4NROA 2Q8DA 1X2MA 1KQ8A 4WVMA 4EWDA 3RZMA 3OS2A 3BJAA 4RLFA 3OF1A 2J1VA 4CPBA 1X4PA 2VD7A 2NS7A 2PJPA 1VBA1 2F6BA 3WTZA 5IYDJ 1FI2A 2ZKNA 4CXFA 2YXSA 4RB2C 1Q43A 3OEAA 5J8CA 2F5EA 4XAAA 5FMBA 4EV0A 2GXGA 2BPA2 3BG3A 1RUF3 1BJZA 2ID6A 2CV0A 5EYYA 1RC6A 3ZQGA 1LKNA 2DOAA 2WNVB 1ZBE3 4LHNA 1Z78A 2E51A 5IFPA 4C0BA 2VJ5A 1WW7A 5A6QA 1C57A 3VL9A 2QSHX 1OH4A 2RS51 2ZAHA 2BE5F 5FROA 3AKPA 4G6QA 1W5TA 2H1LA 4ABZA 2ZS6B 3GZ6A 1GLNA 2VL8A 1BQPA 1PIV1 4OULA 1ZG1A 1YHQI 2ARAA 3MLLA 1T6SA 4ZXKA 2YR2A 2WB1N 3C2HA 3JRAA 4YG0A 2RNGA 2XB5A 1OQDA 2XROA 3AMNA 1Z91A 4XNFA 3N9QA 5LA9A 3SKJE 1OKOA 2DQRA 5HOOA 1NQJA 2JECA 3OL3A 2DWRA 5CQGA 3KSCA 3T3YA 3ZXLA 5HDNA 4BIOA 1YX3A 1TP4A 3ENRA 1XOYA 1IG0A 4ES9A 5ACA3 4QLCU 3F23A 3B73A 1ULOA 4BK5A 3BY6A 2J1EA 4CDQC 2J5PA 1W0NA 1NHAA 5JHFA 3WDVA 2JA7J 4QT6A 3HBKA 3N9PA 2CW8A 3IL2A 3PU3A 3Q9OA 2BDRA 2NM1A 4X6AJ 3U21A 1QH7A 4AFDA 5GLTA 1UY0A 1G4DA 4EE2A 1OOPC 3LSIA 5FZ7A 1RUH3 5I0RA 2K85A 1JI8A 2W68A 3OPWA 5M5XJ 2EBIA 1B4AA 5M3FJ 2KJBA 1GSLA 1WZXA 1LESA 2V1NA 2LMDA 1UO9A 2YPJA 1AX2A 3L2QA 5AC92 2E7XA 5FZOA 2FNAA 3CCQI 2OU2A 1F5FA 4XN0A 5DUIA 1PYVA 2QJVA 2YGMA 4ZZLA 2XWJB 3PUQA 3GZAA 5DQ0A 1VAKA 3B93A 3ZYBA 3KM5A 5A2QZ 3H1MA 4GIQA 3C7GA 5H9SA 5FY8A 4LBJA 1ZZ8A 4IEVA 1RUC3 2FF4A 1RPWA 2WRAA 4UY8I 3UGHA 4XLNF 2H1KA 3TOJA 1ASJ1 4XK4A 3Q8EA 3J7MA 5IW0A 3ZMZA 1NXMA 4IQ4A 3OSFA 2YMZA 3TEDA 2B7EA 5HBAA 1ENQA 4D3WA 2BXZA 3ZOIA 4FP3A 4R4ZA 5FJHA 3HNMA 2HYFA 4EVIA 2J1UA 1AJOA 3VHOA 1JZ7A 4UFKA 5DABA 2EXJA 4KWJA 4Z2AA 3I3LA 3PIPF 1MQTC 4AIJA 2OZ6A 3LGRA 3WV6A 1BXHA 5IT9K 3OY9A 4DMIA 1U5TA 4IHTA 1AHDP 4GYIA 2QLZA 2OAZA 5FZBA 3CDLA 1KJRA 1ZBA1 4QPIB 3AZVA 2B45X 4NRQA 4D7SA 4II2A 3HOXJ 3ZFGB 4HKOA 2I8DA 1OOPA 5FBJA 1NXD1 2V72A 3LFKA 2FQ3A 4M3FA 2V4VA 4I0BA 3UNPA 1EV12 2WA3A 2HEYF 4HNUA 4E27A 3F8BA 3GZ5A 4LE4A 2XC7A 4FPJA 4E4DX 1Z1DA 1UOBA 1XTAA 3O1MA 3VYSB 4R52A 3HTSB 4A3GJ 2LTPA 4DBRA 3MZHA 3VBFA 2B9VA 3CJRB 3MW4A 5DZEA 3B00A 4AVBA 2R7WA 4XN3A 1X1PA 4G7ZF 1TEIA 2M4GA 2CGOA 1J0RA 4IGQA 4PDWA 1BA5A 3NAUA 4HQEA 1BR2A 5EXOA 4NPMA 4RA2A 1S7EA 2E7QA 2VJ4A 1PO13 3KV9A 2Q1ZB 3D3AA 4PDKA 1O5UA 3LQQA 5CADA 1F8VA 2E31A 1JJ8C 3VBHC 4CTEA 3SHFA 3JTHA 1DGLA 4E70A 3J8F2 4M3BA 3I3MA 1RUI1 2YU2A 1VIWB 2VB6A 2WA4A 1AU7A 3G1MA 1FZPB 1X50A 3ROUA 3ABMH 4NHMA 3U1KA 1EP0A 2W3JA 4LK7A 2WWSA 3V4GA 1S3JA 1SLBA 2E32A 4IOCF 4LK1F 5IJRA 4PCRA 2UY9A 5K0UB 1D4M1 1W7PD 2Q5TA 3USUB 4GO1A 4R9BA 2D6NA 5CVUA 4BCUA 2PHUA 2M0CA 5JZGC 5BNGA 3UKVA 3M07A 5SV8A 2XH6A 2LLKA 1DQUA 2DURA 1AR61 1SLTA 1AYM2 1ZRIA 5FYHA 1LEBA 4N9HA 5FZKA 1R4MB 4NIGA 4YG2F 5I0SA 4AHZA 2VBDA 1N1SA 1S9HA 2ZBJA 4W6YA 3SMHA 4V2FA 1M1EB 2GIZA 3ZQLA 4Q26A 2QZ3A 4QIWN 5FKMA 1W5CC 1GYKA 1QHDA 2DVAA 4DYCA 2ZX3A 2ARBA 4I7HA 5IT3A 3RSJA 5CQEA 1TMF3 4L11A 2XBO3 2Z5UA 3M1CA 1PO22 2VZSA 4LO4B 5D5WB 2WO3A 1UW8A 4URAA 2XASA 1FPN3 1IN8A 5F3IA 4MTEA 2XL7A 1YQ6A 1YCIA 2W1QA 2KFDA 1N1TA 5LHGA 3T4VA 1HDKA 2QUFA 2EF6A 3UESA 4EM1A 2B42B 4XDQA 2HU9A 3GFLA 5HS9A 1S1AA 2DA3A 1F9KA 4H2AA 3HB9A 2BNNA 1YI2I 1HCRA 3JZVA 1IRGA 1WVRA 4HF2A 2ZX1A 2Q2EA 3RPUD 4FISA 1ASJ2 1O4TA 3C8XA 4XL9A 4B09A 1XE7A 1UZ0A 1GUIA 1TG7A 2Y31A 3DKYA 3EYYA 1DQ0A 1WJAA 3S3MA 4ITVA 2KMUA 3ZQIA 1V0AA 2WJSA 1GVJA 1MBGA 3ES4A 1ETOA 1C1FA 3FFZA 1VMHA 2ISYA 1QU0A 2VMIA 5FYTA 3P5JA 1DP0A 3JRCA 2DMPA 1R1A2 2HZTA 3CDIA 4PI2A 2A05A 3AG3H 4OI4A 4IJAA 3DXJF 3TKYA 1JKPC 2ECBA 3JR9A 4Y4YA 4D7TA 3QLQA 4CP0A 1HV0A 4ZKTB 5FPVA 3AG1H 4AQ6A 3MYXA 2LREA 4UWDA 1S2BA 3ZSJA 3N05A 3HT2A 2HQ5A 4XLFA 1SLLA 2OPTA 1IV8A 1Q1VA 1W2OA 3AKTA 4Z8BA 3BPXA 3PUHA 3HZJA 3P9KA 4KIFA 4I99C 1I5PA 3A22A 5FP8A 3CUQC 1UX7A 1UY4A 2Z33A 4N43C 1SC7A 4CEWB 1R083 1YIFA 1S0DA 3E3VA 2RG4A 4NMIA 1K6YA 1BR1A 1U5TC 4BQ2A 2ZMEA 1GUUA 1CJDA 3VDXA 1I39A 2P34A 4UVCA 4BOWA 4PFPA 3WF2A 4FASD 2QSFX 2VUMJ 4QKBA 1AVBA 4LNVA 2ZJRF 5K7HA 2QWWA 3KV4A 5GLZA 1QH6A 3SJMA 1QQIA 2CS3A 5F3EA 4JX5A 4NWVA 5BNPC 4NVPA 5DG1A 5IVBA 1OR7A 4FPCA 1C8NA 3HRMA 1QJX3 4HPQA 5ERLA 2UXNA 3DKWA 4IW3A 1R1TA 4ITCA 4XM3A 4L2NA 3ILRA 5FKKA 5FY5A 4DO0A 3VBUB 5A6YA 1RXGA 2RM22 1B9MA 4Q0QA 4IV3B 3OGSA 1KU3A 2D6OX 1TQPA 4YVSC 3HWJA 2XUBA 4WM8A 3VB2A 2XAHA 3MIBA 2Z99A 4HF0A 4DY5A 2RV8A 1VBC1 4Y7NJ 4FBFA 3ONQA 4AVTA 1W6NB 5LFAA 4FTBA 1DBNA 1WJEA 3G1OA 5E1XA 1QIQA 4DFSA 4XRMA 4XQWA 4P5YA