2FMYA

Co-dependent transcription factor cooa from carboxydothermus hydrogenoformans (imidazole-bound form)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
ATQMRLTDTNLLEVLNSEEYSGVLKEFREQRYSKKAILYTPNTERNLVFLVKSGRVRVYLAYEDKEFTLAILEAGDIFCTHTRAFIQAMEDTTILYTDIRNFQNIVVEFPAFSLNMVKVLGDLLKNSLTIINGLVFKDARLRLAEFLVQAAMDTGLKVPQGIKLELGLNTEEIALMLGTTRQTVSVLLNDFKKMGILERVNQRTLLLKDLQKLKEFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of CO-sensing Transcription Activator CooA Bound to Exogenous Ligand Imidazole
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Dna binding protein
molecule keywords carbon monoxide oxidation system transcription regulator Coo
total genus 67
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fmyA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2fmyA01
1F9NA 2QBYB 5H6RA 5CVRA 2ZKLA 1YO5C 1NZCA 3E6BA 4J1WA 2PHLA 1J59A 1UB9A 1K78A 5FFZA 5AONA 1FX7A 1XSXA 5FDBA 3TNPB 4L9NA 1S6LA 3MZYA 4KWKA 3BJAA 5FQ0B 4EWDA 2HQNA 3KP2A 2H09A 1YUDA 4M74A 1E17A 3SQNA 1W5TA 4R52A 4HQMA 4QMAA 3F3XA 4MGKE 4H0EA 2WFPA 3CDHA 4MGRA 3OD0A 1BM9A 2QZ8A 3KP3A 5E16A 2RVCA 4JQFA 2QM3A 4B09A 2PLYA 3EETA 1ZLJA 4ESBA 2PAMA 1CAVA 1TNSA 4AQ2A 4BAYA 4HA8A 5FPZA 2K86A 1VJ2A 3E6CC 5A2QZ 3MWMA 1MD0A 1VR3A 4EGYA 5E1RA 1R23A 3WTWC 5BY5A 1IZ1A 4HYEA 2IJLA 1GHCA 3EHKA 2QCSB 5LLQA 3R61A 4FX4A 4G7HF 4CZZA 4RB3C 2QQ9A 4CXFA 4GYIA 4N0BA 4S05A 2DW4A 3V7CA 1WKMA 1J75A 1O3SA 4B29A 4BHCA 1J0RA 3U11A 5I0RA 1H9GA 5JSOA 3MFKA 3TDUC 4Y13A 3HT2A 4OLLA 4EROA 3MYXA 1Q43A 3PLQA 1W7PA 1T38A 1PP8F 5D8LB 4UHTA 3WTZA 4HDVA 5I8SA 2FQ3A 4XFAA 4HV5A 4M9ZA 1Z9CA 2LF7A 4UXNA 3VEPA 2UWMA 1USSA 3I54A 4A6DA 2B8MA 4IF4A 2DQRA 4GGGA 2KKOA 2F5CA 4LULA 2XGXA 1W5SA 4KT5C 4Q0VA 1DZTA 1QNTA 4YIFA 5D1IA 2VE9A 3I71A 5TJJA 3GZ6A 4P5OA 4CYDA 5HVQC 5EFUA 4P9GA 3HYIA 5BOXA 1NHAA 2R7FA 3GVAA 2V1XA 4O3MA 4EGZA 1UPIA 4ENJA 3SXYA 3HRMA 3SZTA 3CL1A 3ZMSA 2COMA 3FM5A 1UCXA 2KIUA 1ZRCA 2HOEA 3R6SA 3QPHA 1MJBA 1TQPA 1V4RA 5KHGA 5FLHA 1QXRA 4AIKA 1DP7P 4KIGA 3ETQA 4I01A 3V8KA 1QZZA 1KU7A 3OF1A 3P7NA 3BCWA 3REOA 2HQRA 3R0JA 4ZYHA 3H3ZA 4RGUA 2XKOA 3L9FA 5CVVA 1Z1DA 4HSLA 1B1BA 3LAPA 4GCVA 3EYYA 4XF3A 3CUQC 4UV9A 3T5XA 4HOBA 5DCMA 1YQAA 4XBFA 1LR5A 4XF0A 4IHSA 3EYIA 1DGRA 1ZGAA 2FBHA 2I45A 1REPC 3E97A 3ES1A 3VFZA 2O1QA 2FMYA 3FM3A 3I4PA 3T8RA 5KK1A 5FCCA 2ETHA 4G6QA 4A5MA 3FZ3A 3KCCA 4MHGA 4OFGA 1OKRA 1O3QA 5BPXA 2YX7A 4KFCA 2ISYA 1WGPA 3TO6A 1FZPB 1TNTA 3J80Z 4RB0A 1DUXC 1X7NA 2HGCA 2M30A 1XGNA 2EA4A 2Y48A 3ZMZA 1I1SA 4DNCA 2DFIA 3L00A 1ZZ6A 4Q29A 4GULA 4IEVA 3O14A 4FAGA 5I0SA 3VHRA 1SFNA 4Q0UA 3D82A 2GZWA 3O2PE 1OFNA 4O9EA 3V7SA 1YTYA 2D40A 2YU3A 4NB5A 3WGHA 2FEZA 1XSDA 3H8UA 3OCPA 2NYXA 2P7VB 1XSVA 5K5QA 3TO7A 3FJSA 1V3FA 4HN0A 4NVPA 3UKVA 2QDRA 3RI4A 4P96A 1ZREA 3CO6C 1ZNPA 1XDSA 4I0AA 1KYWA 3GW2A 1IAWA 2HJIA 4YSFA 4AXOA 2KRFA 4JK1X 3HHHA 4UUVA 1IPJA 3Q9SA 1GQGA 5I0TA 3TDZC 4KICA 3LAGA 4YNIA 4WZCA 5C6CA 2EV5A 4LUMA 3LA7A 3QP6A 2AXLA 2ZBKA 1BI0A 1FXZA 2ETEA 4EJUA 4LGWA 3TKYA 2RKHA 4ENMA 5ERIA 5LHGA 4TLFA 1ZYRF 4HMZA 2L01A 2IXJA 2RDPA 3LA2A 5DCMB 4TV7A 4HN1A 4I0BA 2ISZA 4RAZA 1XCVA 5D4SA 2UYAA 4P55A 3D0JA 5KHIA 2P17A 5CVUA 3WE2A 5FLXZ 5E8IA 4XEZA 3G7DA 3H1YA 3CUQB 4ESJA 2H0VA 3WGIA 2BNNA 2H27A 3C3VA 4L5IA 3H50A 2K0GA 4KU8A 2GWRA 2FSWA 3H7JA 1Z6TA 4I7HA 4IEPA 3IWFA 1E2XA 5HS9A 1CF7B 2ZFWA 3GFLA 5C8WA 4AQ6A 3WGGA 2Q0AA 1QY4A 1XCBA 2K4JA 5DYMA 5D5VB 2FQPA 4MGZE 4XF1A 1Q3EA 3DP7A 1V70A 4HX8A 4QM8A 1B59A 2FNAA 4KIBA 3QOPA 2BE5F 4OU0A 1HBXG 2EFQA 3JSPA 2E7WA 1G3YA 3E5QA 3HHGA 1NYWA 1G3WA 1XE7A 2IRFG 3WTVC 1CGPA 3H9AA 3F8MA 1YW9A 1U5TB 1ZLKA 1IXRC 4LA3A 2Z33A 1Q1HA 5F64A 1YWKA 3ELNA 5I91A 2D5FA 5KHJA 1CAWB 1Z05A 2DPUA 2M45A 4M6YA 1KU3A 1W7PD 1O5UA 2F2EA 5K1YA 4Y17A 3RZZA 3HRUA 2PBIA 4M73A 2L4MA 1JHFA 4ZYGA 3NSTA 2OZJA 1DZRA 3RYKA 3BPVA 3WTTC 4N9HA 1O3RA 1FBUA 2QUFA 2ZMEB 3U1DA 2QVSB 3WW4A 3K1PA 3TOBA 2IP2A 4M9SA 2Q30A 2RV8A 1YIOA 2KJCA 4F7ZA 1HSJA 4UBHA 4YRDA 4FT8A 2Q8KA 5JFRA 2D93A 4LFUA 3PNAA 2RC4A 4J1XA 4LLOA 4BQAA 3EUHA 4U7BA 3M1EA 4L0ZB 3F23A 2TDXA 2M1BA 1OI6A 2A61A 2A6EF 1IN8A 3KP6A 3TO9A 1TW2A 5L3FA 2DAOA 2HFHA 2VOPA 2JPCA 1K79A 4L9JA 3J81Z 4Y15A 1LDJA 4KA4A 4RGSA 1UW8A 1IXSB 1XDUA 1MDMB 2O0YA 1KYZA 2FBKA 4MQ9F 3ECOA 3QPTA 4IERA 4EV0A 4HAMA 2XAQA 1PUEE 3IKVA 2E9QA 2BBYA 1FP2A 5KHKA 4XF9A 3FZVA 1YHFA 5HI0A 2MBFA 1IRFA 5K5RA 2G9WA 1LVAA 4HDUA 2DQLA 1T0FA 4MTEA 2QQAA 1KA8A 4XSXF 4LG0A 3IKTA 5CADA 1LQ1A 3D5LA 3C18A 2VBWA 5J8CA 1CAUA 2CAVA 4HV6A 4PZJA 2EV0A 5LGNA 3QU3A 4XRFA 4MUVA 3RKYA 2OPKA 1U5TC 1HW2A 2RNJA 1YW8A 3GZ5A 3MAJA 5FLJA 2J5PA 4GXOA 1QGPA 3WTXC 3SMHA 1W7PB 5FFXA 2VN2A 1SFUA 4QX5A 4XLPF 2OU2A 4YFKF 4LB6B 3K1NA 3KLOA 2Q0OA 2HWVA 5HDNA 3WU0A 3ABTA 3IIAA 4K8FA 4U0WA 2D2WA 4IRHA 5DD8A 1RZ4A 3ZMVA 5HLHA 1SFXA 4HF2A 1J1LA 3KGLA 3Q9VA 4P9UA 2A69F 5ICCA 2XL9A 2E1CA 3JZVA 2Z3YA 3F6VA 2GC2A 3DXJF 3HIFA 1EH8A 2IW5A 1BIBA 1J9IA 4U7DA 3T8TA 1SAXA 3CO7C 2P4WA 2F5EA 1FC3A 2PG4A 5A2QK 1LDDA 1CAWA 5JI6A 1IN4A 4HF1A 3EBRA 3HTUA 4OIPF 2VODA 5IT9K 3KGZA 2UY9A 3L2HA 5DD4A 4K2EA 4WWCA 4ESFA 2P8TA 4WXDA 1NXMA 2PMHA 1RC6A 4CO8A 3LOIA 3I64A 3IHUA 1EP0A 4UVBA 2WV0A 3R4KA 1HKSA 1EYBA 3WW1A 4LG0B 4LEJA 1UCRA 1HSTA 4U0YA 1S7AA 2HYGD 2XKPA 5ILVA 1FP1D 2GC1A 1FY7A 3E6MA 2FNPA 4HZFA 1UD1A 1BJAA 3K9TA 3UKNA 4OIOF 2GQQA 4D7TA 2VOOA 3H1WA 3GUDA 4KU7A 1D8JA 1MZBA 4MGIE 4ZU5A 2FRHA 3EDPA 5JCTA 1UHWA 3BALA 3M9AA 2DLLA 1YFWA 2VC0A 3VB2A 1WWXA 3RPQA 1IPKA 2ZCWA 3KFWX 1DPRA 1YFYA 4M6XA 1YLFA 2VBZA 4CDGA 2VONA 3PVBB 2XRNA 3P9IA 5J8FA 4Z2YA 1BI1A 4QGNA 4G6DA 5E1ZB 2A68F 2JRTA 3B73A 4ZYEA 2PFWA 2C6YA 4PIXA 4RS8A 4ZZDA 3WG9A 3L2CA 2IXLA 4YFXF 3TGNA 5FD6A 5J7MA 5ICFA 4D0PA 1HXDA 1ZGJA 1O7FA 3OTFA 1OD5A 1HQCA 1T6SA 3S2WA 1Z91A 1Z6RA 1IN5A 1HW5A 3BY6A 2OQGA 1T39A 1ZZ9A 1CAXA 4IRIA 4Q47A 4G9YA 5I8TA 1SD5A 3UKTA 4X6RB 3RNSA 4UXAA 5KVRA 2O8XA 2QENA 2XLFA 2W25A 3TQNA 2IPQX 5H20A 4PIYA 2P6TA 5D5UB 1F4KA 2PEXA 4JVAA 2FOKA 3CLPA 2WC2A 4O6JA 4NQWA 1IN7A 4O5VA 3RDIA 1YW7A 1T2KA 1CAVB 2CSOA 4I09A 1OMIA 2EAAA 1MJ9A 2V9VA 3MDPA 4KWLA 5FPXA 4EM0B 5CU1A 2DCTA 5D8KB 2YSRA 3RKXA 3F8NA 1O57A 1L3JA 1RGSA 3JAMZ 3ECHA 5F1RA 3CTAA 4Q0PA 4LK1F 4ZU4A 2B9UA 4AWXB 5E17F 4QM9A 3SCHA 1U3EM 3NRVA 4L9TA 2PFBA 3ABUA 3RTRA 2O03A 2ADUA 4XSZF 4NHJA 2ELHA 5EEHA 3NW4A 3K1MA 2OA4A 3ES4A 5BPIA 1WQ2A 3LFKA 4BYYA 2V1UA 2F5FA 3F72A 2ZKZA 1Y0UA 4CHUA 3CJXA 2QJVA 4R79A 4F8AA 2D1VA 3BZ6A 1ZZCA 3ZMDA 4KN4X 3ERED 1RTVA 1EH6A 2P6SA 3ULQB 1NE4A 1U2WA 5HLIA 3MEXA 3GFMA 5ED4A 2ESNA 4QLCU 1UIKA 2PQQA 3LAJA 2QYOA 1G3SA 1YYVA 4JV4A 2STWA 5JAXA 3FMSA 1TQIA 2V1DA 1H1MA 5HDKA 1YFUA 3DL3A 1IN6A 4XFGA 2MLKA 3HQXA 2JSCA 4MZUA 2Q4SA 2Z5UA 5CVIA 5ICEA 4LTAA 3LWFA 4HX4A 2Y0OA 1R1TA 2CWEA 5ICGA 1R22A 4IEYA 1SMTA 3IL2A 4MNUA 3T0YA 2LKPA 2R3SA 1YFHA 4LA2A 1SMYF 1STZA 3CEWA 3IBMA 2M8EA 2XVCA 4E2QA 2UY8A 4IETA 3RJPA 2K4BA 3USSA 4RAYA 4LLGF 1TW3A 2RQPA 3W6JB 1GVJA 2V79A 2XLGA 4A0ZA 2BNOA 4A2UA 3TNQA 3R60A 1UIJA 2XAFA 4HLXA 5BMZA 3RIRA 4OIQF 1ZZBA 1H9TA 2GU9A 2LNBA 3CJNA 4OOIA 3BROA 1A04A 4JTNA 2XAHA 2QWWA 4Q0SA 4YARA 4L5JA 3TOAA 3SXWA 2YX4A 5E1WA 4A12A 1ZRDA 2L02A 1FSHA 3FMQA 2CGPA 3BB6A 3L7WA 3C1DA 2HTSA 1PP7U 2MH9A 1JGSA 1FSEA 4IEWA 4QGLA 3IWZA 5K5OA 1BC8C 3FHZA 4QGMA 2Q2EA 4L9VA 5KBFA 2OZ6A 5D5WB 5D6EA 4IEUA 4A5NA 2LF8A 3DQVC 4M72A 5DCFA 4R8HA 2X0LA 1RI7A 1ZRRA 4XETA 4Z82A 1JUHA 4KWJA 4FX0A 5DDGA 4U0VA 5E8GA 3IRQA 3AAFA 1BOAA 3WTYC 1AOYA 1FBSA 4L0YB 3M70A 3CLOA 4A0XA 2GIVA 1P2FA 4WX9A 1O5LA 3E5UA 3CO2A 2ESHA 3WE3A 5JHUA 2HKXA 2XASA 3ML6A 1FLIA 2V09A 3QRFF 2MNGA 2STTA 1X8MA 3LQRA 4I98B 3GWZA 3V7RA 3KE2A 2EWNA 1FPQA 3F8BA 5IT3A 2BV6A 2LSOA 1ZRFA 2IC1A 1U12A 1TQ5A 4AVAA 3Q5FA 3JSOA 2XIGA 5CLSA 3IDCB 1R36A 1K6OA 1CF7A 3WODF 2H6BA 3G73A 1TQMA 3U0ZA 1MJAA 3WU1B 3FE5A 2GH2A 3S7IA 3E6DA 4A6EA 5LGUA 2VECA 2YPRA 3H7YA 2UZKA 4KIFA 4IHTA 3MPBA 1P92A 1R1VA 3RKWA 1FT9A 3KEQA 4RB2C 2A3SA 3HRSA 1Y9QA 4YYOA 1L0OC 4UVCA 1PMIA 3SCGA 3SFZA 3BOQA 2CYYA 4ONUA 4IEOA 1TTYA 4AVBA 4HVRA 1DDNA 2Z2SB 4LD5A 1SQ4A 3ZN1A 3EQEA 4S04A 3U10A 1Q5OA 3HOSA 4GO1A 1KQ9A 5BS6A 1QBJA 3DPLC 1OYYA 2K27A 2PI0A 3O3KA 2PAEA 3O6BB 4XFFA 2DPDA 3GO5A 2DBBA 5HDGA 1B6AA 1SD6A 5ILSA 1FI2A 4MH0E 4I02A 3JTGA 2EFNA 4XLNF 5BQTA 3I5UA 1MGTA 1ONVA 1U78A 3ZPLA 3FHIB 2QBYA 4GYGA 1VTNC 1IF1A 3FFQA 4RGXA 3WW2A 4ASNA 3KMHA 1GXPA 5ILUA 1Y3TA 4EM2A 1NE6A 5DEQA 3H1MA 1USTA 3PFIA 1WLTA 1D8KA 4ORFA 3VOEA 2MC3A 1I6XA 1EV7A 1BN5A 1K7AA 1P4XA 4YIIA 2CW0F 5JSPA 4BNCA 5I8YA 1S29A 4G7ZF 4G8XA 3NL1A 1OYWA 3H92A 3ST7A 4ON0A 1I27A 1F1ZA 1ON2A 5TRDA 4A0YA 2PN6A 2EK5A 4I2OA 1UFMA 1KU2A 5EEGA 2IA1A 4HVQA 2KXLA 2KIFA 3I7DA 1HW1A 1QQIA 5BV6A 2R7DA 5DV5A 1ZG5A 1FOKA 3IDBB 4WK8F 2FU4A 4AVPA 2WTEA 1CAUB 5LRRA 4EVIA 4LMYA 4E2SA 5HOOA 4L2NA 4ZYDA 3GEZA 4RD7A 3COAC 2O6GE 2HKOA 4FHTA 4KDPA 5FGMA 4JBAA 5CVJA 4N9IA 3FXQA 2RGVA 5BPDA 5FD5A 2W84A 4IPAA 2OYZA 2VBXA 2PA7A 2CQKA 5L3GA 3H3UA 1U8RA 5DUKA 4KMUX 1R1UA 4IEXA 2CAUA 5T3NA 2GA1A 4ZU7A 3BJ6A 1DPUA 3K69A 4G94A 2OA2A 4HLTA 3LA3A 1XRUA 2QQBA 4BXUA 3FWEA 2HEOA 3I59B 3ISPA 2B5HA 4OIRF 1YFXA 2VT2A 3F21A 1ZZ8A 4O9GA 3C7JA 3LWCA 3NEUA 4HSJA 3KP4A 5CJ9A 4UVAA 2C0ZA 5JVTA 3EO6A 4D7SA 6PAXA 5J48A 2DTRA 1ZARA 4FBFA 4KN7X 2PMUA 3HT1A 4PGGA 5L3EA 1J3RA 2MHFA 2IXKA 3GXOA 1J3QA 4LLLA 1WRJA 2P7CB 4LLNA 1P4AA 4KUMA 3I58A 1S3JA 1WA4A 2W85A 5LRSA 3JW4A 2E1NA 1HKTA 2E7XA 2VT3A 1MKMA 1B4AA 2DI3A 3MQ0A 2XL7A 2PTMA 1Z7UA 1J5YA 5HS7A 3VODA 1ZVFA 1HKQA 3I59A 5D6FA 4BH9A 2W57A 1XN7A 1YS7A 4ENNA 1K78B 3I53A 4KL1A 1R5GA 2PYTA 2XV4S 1ZHFA 3KP5A 2HS5A 1LNWA 1H1IA 3P9KA 4L11A 4ETSA 3DV8A 1ZAOA 1XGMA 1BIAA 1LDKB 3F22A 4WVZA 4IRGA 2GC3A 1FNNA 1X3UA 4DINB 2EB7A 3HRTA 2ZXJA 2PJPA 3QP5A 4MQVA 4PDKA 5L3CA 2BYVE 4PJYA 4UV8A 3DEUA 1TLHB 4ZH4F 1LKNA 3ZDSA 2D5HA 2PHDA 4MEXF 3S0MA 2ZMEA 5K8SA 2WWYA 4HBLA 1WSUA 1OPCA 1WI9A 4XF4A 5JSRA 3BDDA 4ZZLA 1J7KA 2IXCA 2LDUA 5H6QA 4P9FA 3RYPA 2ZO4A 3CUOA 1U6GA 2JTVA 2Y0MA 1J58A 5LBQA 1GQHA 1ZZ7A 1DGWA 2P5VA 4WXHA 4HW0A 1BBYA 1XD7A 4WF2A 4IESA 1O3TA 4RGRA 1X8EA 2P5KA 1R00A 4HBNA 3F6OA 4CICA 3E5XA 2FMLA 1BC7C 4HF0A 2D45A 2IT0A 2OQRA 3RYRA 1ULYA 1EH7A 1IUYA 1QZYA 3MZHA 2VC1A 2IVMA 3WTUC 4M9XA 2QNKA 4WXCA 2Q1ZB 4Z07A 3KZYA 4YG2F 3J7AO 4Q4ZF 4KNYA 4EJWA 1ZH5A 3EJKA 1LEBA 3J81K 3U2RA 1QWRA 2OBPA 2P5LC 1OR7A 3DFGA 3HSEA 3V8LA 1RUOA 2XROA 2GC0A 2GAUA 3ZMUA 1KU9A 1ZN2A 1I1GA 2DK5A 1FBQA 1QO0D 1QPMA 5I0UA 1RUNA 3NJZA 2OD5A 1FWZA 2YR2A 4LB5A 2A5YB 1XE8A 5L3BA 4OMZA 2UXNA 5FQ0A 3BPZA 2FA5A 4EJOA 4E2GA 4META 1J3PA 3T1BA 3BWGA 1KGSA 4MX3A 3LQQA 1ZG3A 1RL3A 5F6FA 4IXAA 2EJRA 4MEYF 4EMSA 1GXQA 2QVOA 3GFIA 1KQ8A 3ELKA 5I93A 4L18B 1IRGA 3CF6E 3CUQA 3GX4X 1R5HA 1CAXB 1O4TA 1OYIA 2PAKA 1P4WA 3ZP5A 4JTOA 2M87A 2G7HA 3BP8A 3K0LA 2NNYA 1FYKA 4PGHA 5FLXK 3M8EA 4G7OF 2HYFA 1G6NA 2IXHA 2EFOA 2VPVA 1SD7A 4M71A 2BGCA 3SHRA 1SD4A 4LJZF 3FF5A 3ROUA 2G7UA 2CO5A 5EZWA 3FMRA 1B9NA 1G3TA 1XGOA 5LHIA 4OMYA 2L4AA 2EA7A 2ZJ2A 4I3PA 3KETA 4X6QB 3ACLA 1YS6A 1LJ9A 2UXXA 2M5WA 4EQQA 2OAZA 3PQJA 2H94A 3FXUA 1SEFA 4BHBA 4XFIA 3NKTA 1JHHA 1I5ZA 5D4RA 2IA0A 4LK0F 2GA2A 2JZYA 3SHFA 3LZZA 4AIHA 1PDNC 4KYWA 2XAGA 4RB1A 4EJTA 2FBIA 5HS8A 1D5VA 5E1XA 2F5DA 5IT9Z 2O61A 4XFBA 3W6KB 3QAHA 5CYVA 1LRHA 4WBBA 1ON1A 5AIQA 4DQ2A 5D5XB 3RPUA 2K02A 2ZNYA 1FYMA 5E18F 1L3LA 3C3WA 5L3DA 5JR3A 2HR3A 4Q48A 3DN7A 4KMFA 2DU9A 2JPBA 3GFJA 1BI2A 3ZQ7A 3EQLF 1LEAA 2A07F 1ZG1A 2N7GA 2NRAC 4QWQA 2MH2A 2MLGA 2D1HA 3B02A 3DPTA 2NAZA 2Z9OA 3BU7A 4AIJA 2DK8A 2XHKA 3HUGA 3HSFA 4QXKA 3SCFA 1B9MA 3ZN0A 3N4MA 3V4GA 5LHHA 2QLZA 3M3IA 5J6XA 2FXAA 1TBXA 2F4PA 2O8QA 4E70A 4XFHA 4Q5SF 5LGTA 2Z99A 2HTJA 5E20A 3BJOA 2EFPA 4CGZA 1D3YA 1YG2A 5FO5A 3GLXA 5FLIA 3JAMK 3OOPA 1XMKA 1UHMA 2CFXA 4XFCA 3NVCA 3IRRA 2CV6A 1PM7A 4FAHA 1KQ0A 3M8FA 3GF2A 2A6HF 2VBYA 1EPZA 4EWAA 1S7OA 2EVXA 3ZMTA 4MTDA 1JE8A 2L54A 2NS0A 2VXZA 1T98A 5AIPA 2HDCA 4UNOA 4UBGA 3HOTA 2ATFA 3OV8A 1RIOH 4BHPA 3KP7A 3JTHA 2MPFA 3GYHX 4MV2A 4MGYE 4PIZA 1MDMA 3KZZA 2Y75A 3E3VA 2MD5A 2FF4A 2EV6A 1P6RA 1XGSA 3GBFA 3HSRA 3BPXA 4EM1A 3WW3A 1F5TA 3PQKA 5J3UA 3F8CA 3NQOA 5BXXA 3FXRA 5FB2A 2IXIA 2FE3A 3DF8A 4HX7A 1U5TA 3SZPA 3S7EA 1BI3A 1RNLA 2ZNZA 3P9CA 2EFWA 4HVOA 1AWCA 2BEOA 4IVNA 2W24A 4IJAA 1IW7F 2DT5A 1LB2A 1FYLA 2GXBA 4AD9A 1CX4A 2DO7A 3WTSC 1J2XA 2CG4A 1C0WA 3MCZA 4OINF 2ET7A 5JR7B 2OZUA 2GXGA 2V6CA 2X4HA 2L3DA 2XLAA 2B0LA 1JXSA 1IXCA 5LEJA 2KJBA 4IEZA 4LUKA 4ENKA 1G4DA 5LEKA 2O3FA 4PCQA 2BNMA 3U9GA 2K7LA 2AS5F 3LSTA 2HZTA 4R1HA 2J5OA 1VP6A 4AVCA 3F8FA 3G3ZA 3M7GA 2PQ8A 2RN7A 2H6CA 3IC7A 3L09A 2ACJA 5KHHA 3K2ZA 2Z69A 2XUBA 3GYDA 3KEOA 4EJVA 4H7LA 3HTSB 3R0AA 4HQEA 2ET1A 1R58A 1ZX5A 5DUIA 2UYBA 3QU6A 1O7LA 3D0SA 4B8XA 2K9ZA 3V8JA 1ODDA 3QACA 1H0MA 2KIMA 1XB4A 2MA3A 4WCGA 4YFNF 1XMAA 1W4MA 2IA2A 3J80K 4EWEA 2NNNA 1R7JA 4BIFA 5HLGA 4IEQA 1S8NA 2EA2A 1YLLA 1X82A 3FX3A 4Q0QA 2XAJA 4HLYA 5AVPA 5BUVA 4U88A 2VE8A 3I0TA 3N97A 2VQAA 3DKWA 3KSCA 1SFEA 3KLNA 1EY2A 3OGJA 2JT1A 1QXJA
chains in the Genus database with same CATH superfamily
2VR4A 1YOVB 5CVRA 1MS9A 2LMDA 2FCVA 1NZCA 1J59A 1WLCA 2D3RA 4ATFA 1FX7A 3TNPB 1S6LA 2HLEA 4SBVA 1YUDA 2LS6A 3M8LA 4IGPA 1DDLA 4AU7A 1XTAA 2BOLA 5A7SA 4QMAA 2ZOEB 4H0EA 4YZ4A 3DU6A 1NXD1 1EAH3 4B09A 3EETA 1KS5A 1ZLJA 3K6GA 3AFKA 4DNYA 1CAVA 4D9JA 4BAYA 4HA8A 3M2MA 4KNCA 2MYSA 5A2QZ 4YEJA 2OUJA 4AW7A 3KF5A 3EHKA 2G1MA 4QQ2A 4MLOA 4G4FA 3CCLI 3AYAA 2DN0A 4RB3C 2QQ9A 1PGW1 4WM7A 5T50A 4GWMA 1OF3A 4GRIA 4V2VA 4PJMA 3V7CA 4HPQA 2BY0A 1T0FC 4IV1A 4B29A 4BHCA 2R1DA 4Z6YA 2RS32 1DQ1A 5FOJB 1H9GA 3MFKA 4QPIC 4Y26A 1T38A 1W9SA 4ZHNA 3TP0A 1DU3D 3N9QA 2QCOA 4UHTA 3VD4A 1UYZA 5I8SA 2IVIB 2XGCA 4M9ZA 2QBXA 2DOEA 4IF4A 1PO22 2GMEA 5E6HA 1CVNA 3RSJA 5FZ1A 2XGXA 1ERDA 4KT5C 2EIEA 1OLRA 3KS7A 1JXNA 1N77A 4LKFA 1FATA 2YXSA 2B7YA 4BB3A 1YXWA 3N35A 5LA2A 4ZC3A 1PO11 3AXEA 3HYIA 3FXKA 3RGBA 4O3MA 3BTJA 2XRLA 1TEIA 1R6RA 1O8PA 3ZSJA 4ENJA 4LKDA 2G4IA 2ZPXA 2ZEZA 1IZ3A 5EHDA 1F35A 2VCCA 4GWIA 2Y6JA 2ZGPA 3FM5A 1UCXA 2OQ6A 1ZRCA 5KHGA 3LOCA 1H2MA 5E3LA 5FLHA 2JWPA 3B9CA 1CR7A 4I01A 3RI8A 3OYBA 1PVEA 1KU7A 1SANA 3OF1A 4FPCA 4CPBA 2L9VA 4X8PA 3R0JA 4ZYHA 4BJ6C 3H3ZA 4FPLA 2XKOA 3OBZA 5FZEA 1Z1DA 1PO23 1CN1A 4OUMA 3CUQC 1IG0A 2HWF3 3DCFA 1YQAA 3HOVJ 3AYCA 3H0GJ 4XAAA 1DGRA 3GZNB 2I45A 3E97A 4X8NA 1JUPA 2BOJA 4XQDA 1SLIA 1W8OA 3VFZA 2W68A 3T8RA 5KK1A 1E5SA 2ORZA 3WCRA 3S1MJ 2VKEA 3H35A 4MHGA 4OFGA 2W4SA 4RS5B 2M30A 1FMD3 1ND2A 1A5JA 2WS92 2DFIA 1UKRA 3L00A 1IRZA 4Q29A 3IZOA 3O14A 3A4CA 4FAGA 4ES9A 2B9SA 2H1KA 4XKBA 1VBC2 2HWF1 1OFNA 1UOGA 1TG7A 3J8F2 2DWRA 2F4IA 3GXUA 2FEZA 2HDWA 2YZ4A 3CCRI 1X1PA 1JH5A 1ONAA 1RIRA 2ZXWH 4C91A 3B9IA 3UKVA 2QDRA 1VQNI 2Q1MA 3I3BA 4P96A 2ZJQF 1TWFJ 5DZGA 2HWF2 4BBRJ 1SG3A 1QGLA 1IPJA 1GQGA 4PI2A 1AXKA 5K0UA 4YNIA 5A3PA 1W8TA 2EV5A 3CJIA 3CCSI 4GWNA 4LUMA 3ZO0B 3LA7A 3QP6A 1FXZA 1BI0A 2XAUA 4A3ZA 3C7FA 5HPOA 2HOTA 1RKWA 5ERIA 4HMZA 1W03A 2IXJA 2RDPA 4GKYA 5IT6A 5DCMB 3AMMA 2A7AA 4HN1A 1WJBA 1NA1C 1VNDA 2BV4A 5GAEJ 1HB3A 3VDCA 4P55A 5CVUA 5E8IA 4YVWC 3ZQCA 3OL4A 3OUJA 3CUQB 3WGIA 3C3VA 2X6XA 3H50A 1DP0A 3DU5A 2DYRH 1S0BA 4AM3A 1S4CA 2LY2A 3IWFA 2BHYA 2ZFWA 4A3EJ 1XPXA 5KXCA 1BJQA 3H0DA 4BMBA 3N9OA 5D5VB 1TZOA 5AFBA 4MGZE 4XDQA 1KITA 1WLWA 3NJVA 3ZXGA 1SACA 2R7EB 1OHFA 3MIDA 4HX8A 5ERLA 4KIBA 1X4PA 1O4YA 2EFQA 4AUXA 3E5QA 3HHGA 2BBAA 4AAPA 1NYWA 2RJKA 3ZYIB 1ENXA 4UWDA 3BG9A 5F2SA 4CDXB 2DDAA 4NMIA 3ZN6B 3F8MA 1YW9A 2R7VA 4IV3C 3GTKJ 5A3LA 1Q1HA 4C3IJ 3UESA 1PX3A 1QNWA 5KHJA 2CS3A 2AREA 1KU3A 1W7PD 2F2EA 4Y17A 4N8MA 3V0BB 5IY5H 4JDMA 2R7SA 4XXAA 3ZDVA 3NSTA 1RXFA 4LBQA 2ECCA 2A5WA 1AL21 3H9QA 5FUIA 1KDKA 3PURA 4Q1RA 2IP2A 4M9SA 2XJUA 2Q30A 3W2WA 3CP2A 2KJCA 1DU6A 2BP6A 1GLNA 4DZPA 2Q8KA 3MLJA 5JFRA 3PNAA 1W8NA 2VMIA 4LLOA 1D5YA 3AXDA 3EUHA 3F23A 5C71A 4IUGA 1OI6A 3BR2A 3TEYA 1XYPA 1PO12 1D4M3 3MIHA 5EG0B 1DGLA 1G8XA 4L9JA 5FYYA 3VKLA 1LDJA 3GLLA 1MS3A 2VL4A 1ENSA 4ZZ5A 1XDUA 4ZONA 3JRIA 2QQKA 3ECOA 3QPTA 4YVWA 2QGUA 2O5RA 4IE0A 5HXVA 2VXDA 1GMMA 2E9QA 3VZOA 3C7GA 2C6SA 2X6WA 2CQXA 2YC0A 1YHFA 2RS13 1WW5A 2R5YA 1D0XA 2R1BA 3LEGA 2G9WA 3WNKA 4HDUA 4YRVA 4DY5A 4LG0A 2HYXA 2CUJA 3D5LA 5J1XA 1RUF2 2VBWA 1CAUA 1Y7BA 2VUMJ 2K9SA 3VBHB 4PZJA 4NC7A 1LOFC 2CUFA 3WX5A 2EV0A 2L9RA 2EZIA 3QU3A 3RKYA 3R4DB 5DDJ3 4R9DA 3RI9A 1T8IA 1HW2A 3GZ5A 5FROA 3AP4A 4NNJA 3WDWA 3WTXC 3CC4I 3JBG3 3O1SA 1ST8A 2HWB3 3OY8B 1W7PB 3BC8A 2Y34A 1HN1A 4N7IA 1CIYA 3VKOA 5HDNA 1NG6A 2QUOA 3OIQA 3ZQGA 4C1XA 3O8HA 1LU1A 4K8FA 4U0WA 1W6QA 3ZYBA 4NO4A 1ZTRA 4FSJA 2ADDA 5KC5A 2VZ1A 5ICCA 3NAUA 3HR9A 5FY5A 4BY7J 2ZAHA 3DXJF 3HIFA 1AYM2 1F31A 4U7DA 4JOMA 4A3IJ 1SAXA 1UYPA 4XMIA 4PQQA 1MMNA 5FZFA 3DF0A 2P4WA 3LIGA 1FC3A 4BQWA 5IVYA 2CQNA 2P6CA 2QQNA 5JLWA 1FYUA 2P4EA 4B4CA 4YFWA 4K2EA 5BNNB 4QXBA 1U0JA 2P8TA 4XM3A 1RC6A 1IV8A 5FJ8J 2FQ4A 5GTIC 3LOIA 5E3OA 2GH8A 3IHUA 1VMFA 3BIEA 2Z4FA 2M0CA 4W50A 2HPMA 2EQRA 1ZRIA 1ND2B 3ZFFB 3OPWA 5GTHC 4EZHA 1FP1D 1A3KA 2O8OA 2ZGTA 4HZFA 2HEYF 1YNAA 3OBTA 5JI7A 2ZMLA 4F93B 3JR9A 5F3EA 3GUDA 1D8JA 3VBSC 1OCCH 4XJZA 3ZFGB 3KV5A 1UHWA 1AX2A 1AR62 5JXIA 1XNTA 3INAA 1OKOA 2NOJB 2ZCWA 3KFWX 4FPHA 4XOGA 1RUC3 1AVBA 1OQEA 2VBZA 1YRZA 4DEQA 3PVBB 1S2BA 1BI1A 4G6DA 5CQGA 1X3ZB 5KHDA 2XPUA 5LBCA 2JDAA 2JEMA 2ZGOA 2DUOA 3EMRA 1LFBA 1DFQA 4XJWA 2C6YA 4QQPA 1AYN2 2OV7A 5D8AA 1MH4A 1ETXA 3VZKA 2Y38A 2VUCA 5FD6A 2OCCH 2B63J 4D0PA 4FPOB 3FL7A 1UN1A 5E3MA 3B93A 2HZDA 5J1UA 2IXSA 2EINH 4Q8LA 1Q8VA 4UFHA 1DGWY 1UMQA 2ZEWA 1IN5A 2YROA 2OUHA 5FZ9A 4HANA 2OQGA 4LO8A 4FPKA 4Q47A 1UQXA 2VKVA 1T33A 2VQCA 4UXAA 5KVRA 1DYOA 3URFA 2WFF3 2YYOA 4NPRA 4CDUC 2W25A 4RHV2 3TQNA 2W46A 5E3NA 2P6TA 3S1RJ 4RDUA 2FOKA 5F9TA 2WC2A 4NQWA 1IN7A 4BQ3A 3RDIA 1T2KA 1CAVB 4I09A 1OMIA 3ACIA 5A3WA 1LHWA 1AR72 4L5EA 1WW7A 2E31A 4ET7A 3WD5A 2DCTA 3ZFEC 1PVC2 2VZQA 3Q8EA 1RGSA 1SLLA 2VLAA 5EQUA 3ECHA 5F1RA 3MVPA 2LY1A 2JKBA 3RZMA 5C3PA 4ZU4A 4AWXB 3SCHA 3Q8CA 2BVVA 2PFBA 3ABUA 2VZUA 3HWJA 4IV1B 4Y5SA 1KFXL 1EUTA 4NQWB 3W2AA 5CIRA 1UZZA 2DA1A 2FDGA 4FPFA 3ATGA 1NZIA 3LFKA 4BYYA 1OPMA 3HB9A 2V1UA 4E8DA 5L9VA 1TL8A 2L9NA 1EJ9A 1H1AA 1MBGA 2DU1A 2GXAA 3B7MA 2EZHA 3ZOBA 2D1VA 4RM3A 3BZ6A 1ZZCA 3TW6A 4KN4X 1UOBA 1RTVA 2P6SA 5DAWA 3OYKA 2Z1DA 1U2WA 2KLOA 4C2UA 4MHRA 3ZIXA 4QLCU 1UIKA 3CCQI 1YJ9I 1X50A 1QVTA 2FD5A 5FUNA 1H6XA 3FMSA 2V1DA 1CD3G 2MLKA 1R081 4MZUA 3BTCA 5CVIA 3RS6A 3SH3A 4J01A 4LTAA 1QZEA 2HVSA 3VL9A 1PYVA 4FOWA 3C8XA 2CWEA 2XG3A 3IL2A 4HPKB 1FOD2 4LA2A 3WNMA 1STZA 3CEWA 2WAAA 2EIGA 2M8EA 2XVCA 2R0QC 4A93J 1GNYA 4E2QA 3HM5A 3GTQJ 5JUVA 2K4BA 4RAYA 4IQJA 1VBC3 2WUHA 4YG3A 2RQPA 3TBDA 2V79A 2BNOA 3M3QA 4ZS2A 1SBDA 1UIJA 5BMZA 3NV1A 2GMPA 1CONA 2GU9A 4M0HA 5C5UA 3BROA 1A04A 4FCAA 2BZDA 2XAHA 4NIIA 3T4HB 5AC91 1B72A 4Q0SA 4YARA 4CP2A 1ND3A 5BNGA 1GP6A 2VNOA 4NR1A 4A12A 1NLRA 3BB6A 3L7WA 1LHNA 1Z78A 1PP7U 1QU3A 1K4TA 3DBLB 3M7AA 4P08A 3VBSB 1D7PM 5IPAA 3FHZA 4QGMA 2CNAA 3HOBA 5KBFA 3ZMOA 3W58A 4DS0A 4IEUA 4RQPA 4D5CA 4XR6A 3VBFC 3UT0A 3J26N 5J98B 4KWJA 1EV11 4XLHA 1YJKA 3AMQA 3WF1A 5FV3A 4WM8B 3DEEA 1BOAA 3HOYJ 3WTYC 1AOYA 4A0XA 5KAFC 1P2FA 4WX9A 3E5UA 3ECQA 3WE3A 1Y39A 3JD72 2W87A 2HKXA 2W0XA 1V6IA 2W08A 3NV3A 2DVFA 3QRFF 4FPGA 3ZRGA 2MNGA 2STTA 3T08A 1WFXA 1X8MA 3J7LA 1QVUA 5FZIA 4I98B 1S0GA 3ZPYA 2AYHA 2Y6KA 3F8BA 1FPQA 5IAVA 2IC1A 4EN6B 1NX9A 3SKVA 2XF5A 2VCBA 2EAKA 3IDCB 3IH2A 1CF7A 1U0AA 2IS6A 1VMHA 3G73A 3WU1B 2Y31A 5A80A 1UKGA 2QKLB 3K4LA 5LGUA 4B3NA 2R16A 2VQGA 1P92A 4CYCA 1QIQA 3RKWA 1WJAA 1FT9A 5K7PA 1Y9QA 4YYOA 4UVCA 1PMIA 2BZTA 2CYYA 3EXUA 2W5FA 3WF4A 1TTYA 4JCKA 2DVDA 5ACA3 1VRH1 2JA8J 2HWD3 4C1WA 1SQ4A 3OGVA 4CDXA 3ZN1A 3CZ6A 2WWUA 5C3OA 4S04A 1Q5OA 1QA6A 5DN2A 4A6OA 2R5ZA 3O3KA 5CFDC 2VZRA 3OR2C 3W9AA 4FCYA 5FLMJ 5BNPC 2UURA 4TSVA 5FYCA 1B6AA 1AR71 2EIDA 2L9SA 5CYYA 3JTGA 4OQ9A 4M3EA 1RESA 4FQGA 4LE4A 1IF1A 1QJU2 2NP0A 3WW2A 4LMFA 4AGGA 1JT0A 3FDYA 2R7OA 2E7QA 3BYWA 4FVVA 3IAM2 5ILUA 4EM2A 3H1MA 1USTA 3DPRA 4P9LA 2DXIA 3Q0VA 2JIJA 5EWSA 1RUC1 1OLME 2HWD2 4XUNA 2WY8Q 2ZGNA 3OD4A 4QT6A 4G8XA 1VBE3 2AENA 1QQP1 3H92A 2OTJI 2R7ZJ 5FRMA 5FTTC 1F1ZA 3SEEA 2X1CA 1ON2A 1K5MC 1HLCA 4N4NB 2XJVA 4BQQA 1BKZA 2E7AA 3L2VA 3R05A 4UOJA 4CH7A 1R1A1 4TLGA 2R7DA 2VMDA 3Q0WA 4IEJA 5GLWA 4BE1A 3LKJA 3UJOA 3ON7A 3U1KA 5HOOA 3B5LB 3FBYA 4CP1A 3COAC 4A7ZA 1VBE1 2E1MB 1US3A 4XLCA 4A3KJ 1FOD1 1R1A2 1LAJA 5DM7F 2RGVA 3B00A 2H8RA 2ZAAA 5FD5A 1EUUA 4IPAA 2DVGA 4GB31 2OYZA 4AGRA 2CQKA 5L3GA 2VOVA 3H3UA 1JYIA 2Y60A 1JZ6A 2RDQA 2RREA 3JXSA 5LA0A 5T3NA 3ZSEA 1DPUA 2JDHA 4CUAA 3I4MJ 4QSHA 3OEAA 2OA2A 3LA3A 1XRUA 1APLC 5TSWA 2OKXA 3SEQA 2B5HA 2VT2A 1O4ZA 2R92J 2IZWA 4II3A 5AC92 4GD4A 3KP4A 1SFPA 3MF9A 4UVAA 3T0AA 5JVTA 2W00A 3EO6A 3PUQA 2E19A 4D7SA 1PZ7A 4XKVA 5F27A 2DTRA 1ZARA 3H0OA 1X1BA 1BJZA 2IXKA 3GXOA 4GB33 2P7CB 1WRJA 3PL8A 3VBHA 2ZGKA 4KUMA 3BPSA 1ZR2A 3JW4A 4A4AA 2E1NA 2NMOA 3UL2A 2VT3A 5C3EJ 3TEWA 1B4AA 2DI3A 1BEV3 1D0HA 3MQ0A 1J5YA 5FKOA 1JKPC 3BTZA 1HKQA 3I59A 1YS7A 4ENNA 4KL1A 2PYTA 1QMJA 4A3JJ 4D1QA 3JRBA 4HKWA 3P9KA 4NJ4A 2WZ8A 4BL0B 5LATA 1ZAOA 4A3GJ 2KMUA 1XGMA 3GTLJ 2XOMA 3LFIA 4Q4V2 4WVZA 2GC3A 2AEZA 2EB7A 1I5PA 4IV3B 2ZXJA 3KYCB 2YY1A 4AEDA 1XPWA 4YG6A 1LNSA 4UV8A 1TLHB 5JDBA 2XPWA 3O7OA 5GLZA 3K4ZA 4XC9A 1P7IA 4QD2A 4NIGA 3ZDSA 2P5BA 4XE9A 2YUSA 3OYCA 4PF5A 3OGSA 3A01A 4AFBA 4LK7A 2HDDA 3PMSA 3CDLA 1QJX3 5T5OA 5FO8B 3FLPA 5JSRA 5H6QA 3H36A 4HXCA 5LBQA 1QH6A 2E33A 5B66C 4F91B 3SITA 4WXHA 4HW0A 2OQ7A 1PMJX 1BBYA 2KL4A 1O3TA 1AR83 2BWCA 5JPMB 4GALA 2EXKA 5FZ7A 4NROA 2R0HA 4IL6C 3RYRA 2D45A 2IT0A 3S2DJ 1QZYA 4JX6A 3FHAA 2WAOA 1FNYA 2Q1ZB 4YG2F 5FIXA 3VDDC 3J7AO 4Q4ZF 4XONA 4KNYA 4EJWA 1ZH5A 2GP5A 5IP9J 3PNTA 3S3MA 3HAGA 1QWRA 4GKXA 3OL3A 3L2RA 4JYKA 2QQVA 3ZMUA 1AR92 1XNAA 1W8WA 5HV4A 1ZN2A 2E1OA 1GZTA 2PELA 4FASD 2XPJA 1K3IA 3NJZA 1FWZA 2DT6A 2R072 2YR2A 2PHRA 4LB5A 5FWEA 1EKEA 4O7XA 4RYDA 4E2GA 4B3XA 1J3PA 2JICA 4UFMA 3IDAA 1LESA 1H8TA 3WR0A 2ZHLA 5GJ6A 3LQQA 1UZYA 2A75A 4QX2A 3AYEA 1QDOA 3FLRA 4DO0A 4EMSA 3NWKA 1QHHD 3ELKA 5I93A 1NUKA 4TYSA 1FOWA 1GUUA 3NAPC 2WRAA 4N90A 3JRAA 4IE5A 1R5HA 4PLMA 4EATA 3U1XA 2G9ZA 3ABKH 3ZP5A 4JTOA 3SKJE 1S0FA 3IPVA 3BP8A 2FDHA 4QDQA 4PGHA 3M8EA 5FZ3A 4GJYA 3TMOA 1MIJA 3EUAA 2HYFA 2RDNA 2IS1A 2GALA 1RUH2 1Z7LA 3VBRB 2VPVA 5IVCA 2BGCA 5CPRB 1SD4A 4BE0A 1POQA 1NY71 3DKYA 1L7QA 3ZKUA 3K3NA 3FF5A 4PJLA 2TRTA 4PUSA 2VZVA 4FPEA 3ZXJA 4UB8C 1XGOA 1HQNA 2PN5A 2CY6A 4C2MJ 2OC6A 4I3PA 4X6QB 4I3GA 4RN5A 2Q8EA 1H89C 1SZBA 1Y8QB 2DMUA 4NBQA 3DBHB 1MR5A 3M4OJ 2RG4A 5EYYA 3C7OA 4IE4A 2JZYA 1GYKA 3AZWA 3SHFA 4YGCA 2DUPA 5FZOA 1PDNC 4EJTA 2QA4I 4XYXA 1VQLI 1QNYA 5FY1A 2FBIA 3J7YJ 3I2DA 1W04A 2O61A 4MSVA 1TVGA 2W91A 3QAHA 5CYVA 4WBBA 1ON1A 1TMF2 3H5AA 1KZHA 1N75A 1FYMA 2J22A 2IAIA 1ZBA3 3C3WA 4AI2A 5JR3A 2HR3A 2VULA 3POYA 1BI2A 2D3PA 1HCRA 1RUI2 1KONA 4UW3A 1LECA 4EN7B 2MH2A 3MGUA 3PFYA 1UXXX 2D1HA 3B02A 3DPTA 1Z3XA 4AIJA 2DK8A 4W6XA 2XHKA 1RHI2 4IGQA 3PUBA 4H2AA 4NHYA 1W6OB 3SCFA 4R9CA 3CDZB 1B9MA 2VBPA 1WPKA 1AKHB 3ZXEA 5LHHA 1QU0A 1AYN3 3KB5A 4BA6A 3L2UA 5FZBA 4LBMA 4MGQA 2ILMA 1M4WA 2O8QA 5LGTA 2X5IA 2ZXQA 4F83A 2EFPA 4CGZA 2WT0A 3JU9A 3J9SA 2Q5TA 3ILNA 3HVDA 3OOPA 1XMKA 3NVCA 3PSIA 1TMF3 2JIGA 1KQ0A 1W8UA 4EWAA 3ZMTA 2RV9A 2UWAA 2NS0A 5A1AA 5AIPA 3CCJI 3HOTA 5IP7J 2MPFA 3JTHA 2CSGA 4GXLA 3KLSA 5LA9A 4B47A 2TNFA 5FJKA 1POV3 1YRNA 2Y69H 1GU3A 2FOWA 3OYNA 3KT1A 2FF4A 1DQUA 4FFGA 3CQZJ 4RAFA 3HSRA 5CFCA 3CCUI 5FPUA 4PHZA 2XPVA 3WG2A 2VKHA 1BW5A 5FB2A 2IXIA 3VBRC 4HX7A 4DYQA 5CZKA 3SZPA 2I74A 1D0GA 1RNLA 1WZ2A 3HN1A 4HVOA 2LTNA 2W24A 4IJAA 1T2XA 1LB2A 1FYLA 2WS93 1J2XA 4IQ4A 1DLCA 2BU9A 4ZTJA 2VQUA 4IQPA 4IV3A 2MGQA 3TWIA 3ETPA 4A7KA 2OZUA 1OCRH 2UV1A 1NH3A 2XLAA 4KQ7A 3OPTA 4HK8A 2XSDC 4N43C 3WP6A 5M5XJ 1G4DA 1HN0A 2R071 4RQPC 3W59A 4LBKA 3UR3C 4JDOA 5IUQA 4KGGA 3PDQA 2QSFX 4AVCA 2A71A 4YLZA 2PQ8A 1SDWA 1BBT1 2H6CA 1HQLA 4GFBA 3IC7A 5KHHA 4FOVA 4BEHA 2FMDA 1AHSA 4EN9B 3KEOA 4GH4A 4EJVA 2ZX4A 3HTSB 4CCJA 3WSOA 1YI9A 2YC4A 5GPCA 2DA3A 1C57A 4UFLA 5A32A 3D0SA 4U87A 1U5XA 3A7QA 3VYRB 3J7AY 3V8JA 1ODDA 2FCUA 4LO6B 3AP5A 3DYMA 1DG6A 2MA3A 5K7FA 1JKQC 1XMAA 3PVOA 4AFDA 2NNNA 5FUPA 4BIFA 4F92B 2UU8A 2WZR2 5IVVA 3OY8A 2EA2A 5HCBA 3FX3A 2OX0A 2RR11 2XAJA 3H8RA 1M06G 2D6NA 1SFEA 3USUB 4M4PA 1FPN3 3OGJA 1LHVA 3CESA 3A1YA 4LG3A 1F9NA 2B45X 1YO5C 3TL4X 4E7JA 1ACIA 5FFZA 2BHZA 3OSGA 4YZ3A 4L9NA 2DYCA 4EWDA 3EB7A 3BJAA 5FQ0B 3HPGA 4P9IA 3KP2A 2H09A 4M74A 4Y22A 4MFEA 3SQNA 1W5TA 1H8TC 2TBVA 5A3OA 4HQMA 5E79C 3EUHC 2ZBJA 5AVAA 1Z77A 3MF6A 3CDHA 4AIDA 2QZ8A 3KP3A 5GAHJ 1F5FA 5E16A 1NG0A 2RVCA 2NVTJ 1N47A 1RMU1 1RUJ3 5FYUA 4NHKA 1XSQA 1W0PA 1I3AA 4RA2A 1GANA 1UMZA 4XUPA 2R061 5LK5A 3RG0A 2J1TA 1WJCA 1WJDA 1LU2A 4YM1A 5HNFA 3ZR6A 2R7TA 3WTWC 5BY5A 3DXUA 5DABA 3F0CA 4OMCA 4AYBA 4QKBA 4G7HF 1JBCA 4OZOA 4QQOA 2XJRA 3F2ZA 1XNBA 2VZPA 1WKMA 3S8PA 5CA6A 2W3JA 2C1FA 3NAPA 1E5RA 4DGWB 3MIEA 2AH2A 1QJY1 4XN0A 2KZGA 1FIAA 1BEV2 1S0IA 5IVFA 5JZGC 3HZJA 2R4GA 1UY2A 2O0OA 2DT7B 5D8LB 2VASA 1JUIA 1H0BA 5CFDA 4HDVA 3N9LA 3VBFB 4XFAA 4HV5A 1RUJ2 1Z9CA 1PO13 4UXNA 3VEPA 4A6DA 2B8MA 2DQRA 1W6NB 2KRHA 4BE3A 4GGGA 4Q4V3 2YPJA 1XQNA 2W92A 3I56I 3RWNA 1AR81 3W5NA 2JB8A 1QJY3 3WUDA 5D1IA 3O1RA 4XUOA 2VE9A 5DUVA 5TJJA 1HXS2 3JB4C 4CYDA 3DPUA 1A6QA 1JTXA 4JX5A 4Y4RA 1W9TA 5HVQC 1Y8RB 4CDQB 1UY1A 1BVP1 3LL7A 1NLSA 4DB5A 1H2LA 4QAWA 4DRVA 3WDUA 3SXYA 3HRMA 3B6CA 4AAXA 3OYGA 2YU1A 2LFBA 4INDA 2X05A 1ZKGA 2AQEA 1OPOA 4FQ4A 3PIPF 5B4NA 4W6YA 3R6SA 3UK9A 3QPHA 1MJBA 1TQPA 1V4RA 5EG0A 3O0XA 4QB2A 1QXRA 4N43A 3ETQA 1OA3A 1QZZA 2V72A 5DDJ2 3P7NA 3BCWA 2WO1A 4RGUA 3DPRC 4CDUB 3NAPB 4HSTA 3L9FA 4Y1YA 4HSLA 3LAPA 3EYYA 4F55A 3T5XA 4XBFA 1LR5A 4XF0A 1ZGAA 3ZXLA 2FBHA 3R0RA 1XBFA 1TWGJ 4AL9A 2VOWA 4H3WA 1MACA 2FMYA 3FM3A 1MQTB 4G6QA 3I4NJ 1EV12 1X1DA 3BUCA 3FKJA 3OOXA 2YX7A 4WM7C 3MFCA 4LHKA 1FNZA 4KFCA 2ISYA 3TO6A 1TNTA 2VTFA 2X6YA 2JDUA 4OI2A 4A7YA 2A6TA 1XGNA 2Y48A 1IG7A 3ZMZA 4DNCA 1OJLA 1GT0C 5FRAA 2BGOA 2VJ5A 5JPNB 2OXBA 1ZR4A 3SDGA 4CCMA 3D3AA 1RXGA 3V7SA 3KWVA 1YTYA 4YW3A 4GZ9A 3VV1A 3WGHA 4QB6A 2DCEA 2VMFA 1PVXA 1SFKA 1SEUA 4IO9F 1ND3B 5GZDA 5FZDA 3OGRA 1ETWA 4FTHA 1XSVA 5DAQA 1D4VB 4B1LA 3FJSA 5FZ8A 3A0BC 1V3FA 1IDZA 1D1AA 4GMP1 4B4PA 2VZSA 3OY9A 1PGL1 3CP8A 1XDSA 4I0AA 4PK4A 1K4SA 2WNUB 1MW7A 4JK1X 3HHHA 4M4RA 1X1CA 3GTGJ 4UUVA 4BLJA 4C0HA 5I0TA 1UMHA 2YS9A 4KICA 5L7OA 1FTTA 2NOGA 1ZA7A 3IM0A 5C6CA 4BU2A 5FYTA 2P0WA 2ETEA 4EJUA 2RKHA 2NS7A 4PCRA 4EE2A 4MIMA 2OCEA 5DG1A 2DDBA 5FFOC 3Q0UA 2K9QA 3K3OA 5J1RA 4I0BA 3OR1C 4RAZA 3WG7H 1A6IA 2HXIA 5FLXZ 3G7DA 3H1YA 2JD4A 2BNNA 1W6PB 4NRMA 5B5EC 1LGCA 2GWRA 2FSWA 3H7JA 4QHOA 1CQTA 1NQJA 2WR9A 1E2XA 5HS9A 1CF7B 2LREA 5K4LA 3GFLA 1CX1A 5C8WA 4C3HJ 3RZJA 4S2DA 2Q0AA 1QY4A 1XCBA 2X09A 5M5WJ 2WQ4A 1C8M1 5DZEA 2FQPA 1RR8C 3POBA 4JGYA 3PNVA 1Q3EA 2XVKA 4XN3A 3BR1A 4XOTA 4QM8A 2CH0A 2XUMA 3NMBA 3QOPA 1OBNA 4OU0A 4NWVA 1N3PA 5IYYA 3JSPA 3JRCA 1G3YA 4RFT0 5SV8A 4XJ8A 4Q26A 2LM3A 1XE7A 3I3MA 3RZHA 2HWD1 3H9AA 4II2A 3BG3A 1WJFA 4GMP0 1UAAA 5F64A 5HODA 1WH5A 1B09A 3T2PA 2M45A 4M6YA 4E7HA 2TUNA 1O5UA 2HWE3 4Q4Y3 2PBIA 3SEZA 4XIDA 3AKTA 3POEA 3VD9A 3BPVA 1WHUA 2VB6A 2IGNA 5JWPA 2EZLA 3WTTC 4N9HA 2QUFA 1UG2A 3WW4A 3K1PA 3WDYA 2RV8A 2NVUB 5JHFA 1UZVA 4FI9A 4FT8A 1A8DA 5EGOB 4BQAA 2RS51 3IKWA 1JYWA 2M1BA 2A61A 4P9JA 3ACGA 4YGBA 3TO9A 1REEA 1TW2A 1JJ8C 3D1NI 2YBPA 2E26A 3DCQA 2HFHA 2KZVA 4XW3A 3KV4A 4CDWB 4RGSA 1JI8A 1NCRB 1IXSB 1UU4A 4P5HA 4DBQA 3UNGC 1KJRA 2FBKA 4IERA 1PK6C 2ENRA 2P81A 4HAMA 2XAQA 1WUVA 5C4WB 4A3MJ 2BBYA 1FP2A 1KGYA 5KHKA 5CFDB 4GH4C 3UV9A 4XF9A 1GZ9A 3POJA 1N25A 3VZMA 1OH3A 1SFOJ 1LVAA 1T0FA 4MTEA 2QQAA 3WQBA 3NV4A 3DXTA 5T5JA 1LQ1A 4QPGB 3C18A 1FX5A 1B8IA 3LF7A 3PUHA 3AL5A 4L0PA 5L9RA 2AEYA 3MW4A 4HV6A 1V6MA 3OOUA 2JRMA 3QQAA 3QBQA 4YPJA 3AB0A 3KCYA 1U5TC 4LIVA 2RNJA 1AF9A 2M3AA 4FISA 3M3CA 4YW7A 5FFXA 1SFUA 2EXIA 4QX5A 4KI5M 4XLPF 2OU2A 2CV0A 4YFKF 4CTEA 2M7BA 3M3EA 1JZ7A 3KLOA 2WNVC 3MO4A 3WU0A 2GN7A 1ODNA 3IIAA 3KYLA 2VH9A 2JA6J 3ZMVA 1IKQA 3K70D 3VBRA 4K20A 3KGLA 1RRJA 3Q9VA 4P9UA 2XL9A 3VDBA 3JZVA 2Z3YA 1IPSA 1V5GA 5JIAA 1EH8A 2EIKH 2WO7A 3P1IA 2PHTA 5FZKA 4AQSA 2F5EA 2I07B 4BE2A 2JG8A 2YU9J 4HF1A 4H14A 3EBRA 3HTUA 3AG3H 1UYYA 3SQOA 3KGZA 1OFCX 1FPN2 4WXDA 3DEWA 4KGQA 2PMHA 3USUA 3PIGA 4CO8A 2Y6FA 2R042 4TWTA 5IVJA 1VF9A 2WV0A 1PIV2 1V0AA 1N1VA 2Z79A 5FMCA 3F9KA 4LG0B 3T09A 1UCRA 1HSTA 2HOSA 1OOPB 2VE1A 2A3XA 5A33A 3E6MA 4KMQA 1UD1A 1BJAA 1FPN1 4QPWA 4XNFA 3UKNA 4W8JA 1I1EA 5FLVA 5IYBJ 3AJZA 4D7TA 3J7NA 4FXGB 4BGDA 4BDVB 1B35A 1HXS1 3BALA 3M9AA 2DLLA 1IS5A 5GZFA 4RR3A 3WDTA 2VC0A 2IEKA 3VB2A 3L2YA 4XABA 1YFYA 1R082 2XRNA 5J8FA 4Z2YA 2UWCA 4Z1VA 4QGNA 5E8AA 4N7UA 5E1ZB 2A68F 5F5IA 3ZYFA 3B73A 3L2WA 4LHLA 4PIXA 4BZ4A 2DDUA 3VDDA 1SPPA 1KQRA 4Y52J 5FJHA 2IXLA 1YQ2A 2JE8A 3ZIWA 3VBOB 4AG4A 1PIV3 1IRXA 2CDOA 1JHJA 3G1LA 3KM5A 1O7FA 1Y1VJ 5J37A 3L9JT 2AZ5A 4QPIB 1WI3A 1HW5A 3KVAA 1T39A 1ZZ9A 1XU2A 1Z3YA 3I2GA 3ZQFA 3IH4A 1SD5A 3PO2J 2GOXB 4KWUA 2F5VA 2IPQX 5H20A 3AZYA 4OQ8A 1Y4WA 2PEXA 2WAEA 1LHOA 4O6JA 3GCWA 5LK7B 2CSOA 3NWSA 5FYMA 2JMWA 4JGZC 2AUYA 1Z7S1 1ZYBA 1QXPA 4PJ0C 3MDPA 2MD0A 1E3PA 5FPXA 2VNVA 4C30A 4Y5TA 2JVHA 2GN3A 4IHWA 4W4ZA 1TME2 1O57A 5M0TA 3O1UA 3CDIA 1FOXA 3ZFFC 3CTAA 1CQ9A 4Q0PA 4KG8A 4RR3B 3MKYB 2B9UA 1R5ID 1T6GC 2KHMA 4L9TA 1W6QB 5EPAA 3WNLA 3RZOJ 2Y6HA 4BY1J 5F1JA 1XB9A 4XSZF 4X6AJ 4CSWA 2ELHA 5A6XA 5EEHA 2YPDA 1W3XA 1MBHA 1WQ2A 4RLFA 2ZKZA 3I2IA 4JAAA 4CE8A 4CHUA 3LFUA 2QQUA 4Y1XA 2QJVA 4F8AA 4DQAA 5DM6F 4HONA 3ERED 5BNNC 2WSUA 3ULQB 4ZKTB 1X2NA 3VD5A 1NE4A 3KT7A 4O65A 1PJRA 5L73A 3LAJA 2QYOA 3A22A 3QH6A 4CUCA 5IFTA 2YHJA 5HDKA 1YFUA 5J36A 1HX6A 1DGRM 3AMHA 3GHMA 4OHVA 4CP9B 1U5ZA 2OJED 2Z5UA 5LBEA 5K0UC 1W06A 2Y0OA 1COV2 1YITI 4G6TB 5ICGA 4IEYA 5FY8A 4MNUA 3T0YA 1D1CA 2LKPA 2R3SA 5CFCC 3H5RA 4QKDA 3ZYHA 4DXZA 3JBG1 3S3OA 3NV2A 4CU8A 2UY8A 4IETA 3ZLIA 1JU3A 3USSA 1W8ZA 1MMAA 3T0DA 4A3LJ 4RQPB 4A2UA 3N7MA 3RZGA 2HNHA 4CDUA 3FKIJ 3K70C 2LNBA 3CJNA 4OOIA 3WHCA 2ERFA 5L7OC 1XX5A 3NNJA 4XLAA 2E2HJ 1X3WB 4J00A 4UB6C 2ZC2A 4L5JA 5J09A 3SXWA 2YX4A 1JGGA 4QHBA 4PFPA 1WVRA 2Y33A 5T5PA 1W8HA 2CHHA 3C1DA 2HTSA 2MH9A 5A3TA 2WDBA 4A3XA 3IWZA 1GFF2 5K0UB 2ZTNA 2Q2EA 4L9VA 3WZ1A 2KP6A 2CGOA 5D6EA 1UYXA 4A5NA 5CFCB 5DCFA 2DA6A 2X0LA 1LENA 1ZRRA 4FP3A 4Z82A 5DDGA 3BT9A 2BGPA 3AAFA 2G9GA 2JDPA 1JUMA 5GAGJ 5F0CA 3OIPA 1GDTA 2OT7A 1I39A 1QQP3 3FBNB 3ZXKA 5EP9A 1FLIA 3GZUC 2P3IA 4GA9A 3LQRA 3JQXA 1SCRA 1LFUP 2VQTA 3V7RA 4DPNA 1QEXA 1RUE1 3T1LA 5J1YA 3KE2A 2EWNA 4P00B 2M0MA 2NN8A 2DUQA 1U12A 1TQ5A 2VQLA 1VMJA 3Q5FA 3JSOA 3O0WA 1K6OA 1RETA 3AFGA 3I9V2 1ULFA 1TQMA 3N7KA 3S7IA 3E6DA 1OFSA 2QKDA 4TN7A 3H7YA 2UZKA 2QF7A 4IHTA 3MPBA 4AC0A 1QRYA 3QYBA 2QQ8A 4RB2C 1WMFA 3OBRA 3NNFA 4AGVA 1Z0XA 2EBIA 3BOQA 1AR93 4IEOA 2JE7A 1H8AC 2D44A 3AKPA 1JW6A 1DDNA 2DVBA 1G9CA 3HOUJ 4E27A 2FDFA 5CKNA 3HOSA 4AVSA 1KQ9A 2SBAA 2WFF1 3DPLC 1OYYA 2IWGB 2PI0A 4ZTFA 2PAEA 4LOSA 2KM2A 3KV6A 4FFIA 3KIOA 2VTXA 3KHBA 4XFFA 2Y9ZA 2JA5J 3ASIA 1IGOA 1VQMI 1MVQA 1CIWA 5HDGA 1FI2A 3BGAA 1WZXA 4I02A 3UKGA 3PU8A 3QPLA 2W1WA 4Q4W3 2WFF2 1ONVA 3T1MA 1NY72 2QBYA 4RLQA 1MEC2 1MSFC 2Y8KA 3FFQA 1X36A 4RGXA 5APAA 2CGNA 1ZBE1 1X19A 2ADEA 2BFUL 3WNXA 1NA1A 3AVRA 3PFIA 1WLTA 1LEMA 1D8KA 2VUJA 4ORFA 1UOJA 2MC3A 3AMPA 2K9MA 3BTIA 2ZHMA 2RS53 4QX1A 2Y6GA 1QOOA 4ISRA 2YG0A 3VHNA 1R4NB 4KITB 2CW0F 4WM7B 5I8YA 4G7ZF 3NL1A 1OCTC 1OYWA 2J42A 4MXWB 4KJZA 2H0BA 1S7EA 3QPSA 4QX8A 4A0YA 2PN6A 1WCKA 3GCMA 1UFMA 1KU2A 2QZ3A 3ITQA 5EEGA 1ULPA 1PGL2 3A02A 3CMAI 4BEHB 1D2QA 3BN6A 1NA1B 2KIFA 2NVXJ 1QQIA 5BV6A 5FYBA 4UFJA 5DTDA 1ZG5A 1FOKA 3H8OA 2LC2A 4I0WB 4AVPA 2WTEA 4CCDA 1K61A 4E2SA 4E7SA 4L2NA 4ZYDA 4RD7A 2NM1A 4FHTA 3W21A 5FGMA 5CVJA 2DA2A 5BPDA 4LJHA 2W84A 1T6BX 3ZR5A 1ND2C 4M00A 4LO5B 1EAH2 4CZCA 5DUKA 2LLKA 2ZMKA 1R1UA 1Z7S3 3CMYA 5H9RA 3P5BA 5LWBA 2M2EA 4ZU7A 3BJ6A 3ZYJB 2XMLA 4HLTA 4BXUA 3B94A 1K45A 4YW1A 1UL9A 4OIRF 1YFXA 1W5CC 1ZZ8A 1ZK8A 2GIZA 2WAQA 3C7JA 1SC7A 3NEUA 1N3QA 3D4KA 3LWCA 2VCAA 2JDKA 6PAXA 4LNVA 3BTAA 4YVWB 2PHUA 1OF4A 3SNMA 1J3RA 2IGMA 5JMCA 1J3QA 4LLNA 2XBO2 5H2FC 5HV0A 3WF2A 4HNTA 1S3JA 2VW1A 2FZ1A 1M1EB 5LRSA 2X1DA 1Y56A 2E7XA 4RL7A 3JRGA 3OYFA 4XMAA 1MNMC 3VDAA 2V9KA 2Z16A 4RAGA 3VN4A 1LOCA 5SV5A 1ZVFA 3PVEA 3A01B 3HL2A 2W57A 5DG2A 1XN7A 3IMNA 2Q8OA 2FZ2A 4OHZA 2LROA 4OI0A 1DBNA 2DJNA 1NLQA 1H1IA 3LSKA 2CWMA 3MEPA 4LHNA 4MHUA 2F48A 3DV8A 1WCUA 2E6VA 1VZ0A 3LDKA 5K9YA 3CU7A 1AZDA 3FBIB 2IFRA 1F8VA 1ZGWA 1LDKB 3S5QA 1W36D 4L8QA 1W0OA 4DINB 1MZFA 4A6SA 2PJPA 1D1BA 1R083 2NYYA 4MQVA 2E36A 1XYOA 2LG4A 3DEUA 1LOFA 1LKNA 1VBA1 3OYHA 2D5HA 3T2OA 1XC6A 3S0MA 2ZMEA 5F5CA 5K8SA 2WWYA 1AJKA 4HBLA 4XF4A 1OPCA 1WI9A 4ZZLA 2BUKA 2E7TA 3ZN4A 2GP3A 2VOXA 3CUOA 2Q2EB 2JTVA 2Y2ZA 1GQHA 3UNPA 1ZZ7A 5FYZA 1DGWA 2D6OX 4PDWB 2ZGMA 4WF2A 3OSDA 3OJBA 3K4NA 1E0EA 2I10A 2DMNA 2CDPA 2WLPA 1R00A 1PNFA 4IXLA 4CICA 2FMLA 1GOHA 2ZJCA 5JOYA 1IUYA 1YQ6A 2D6MA 3MZHA 4K1YA 2VC1A 4QPQA 3PU3A 1OCOH 1VE0A 4D6QA 1Y6IA 2QNKA 1K12A 2LH9A 4WXCA 3VZLA 2BDRA 3FK6A 4XQWA 4PBPA 1F9KA 1TT5B 4C3JJ 3EJKA 1LEBA 3NNGA 3CMMA 3J81K 2P5LC 1OR7A 3DFGA 3V8LA 2GC0A 2GAUA 2ME0A 4OCTA 2Y64A 2PHXA 1FMWA 1QDCA 5GLUA 1OXCA 4AI1A 1FBQA 2QFEA 4Q5OA 3S1NJ 2CU5A 4AI3A 2A5YB 4NDLA 1XE8A 5F5QA 2UXNA 5FQ0A 2WSVA 4BDZA 3BPZA 1UF2C 2Y0IA 1QHDA 3VKNA 4MX3A 3K7AJ 3T3YA 1ZM1A 3HDDA 1K5JA 1HF0A 3J8F3 4IXAA 2EJRA 1VQ5I 4AE2A 4M3GA 2VKDA 1X9TA 4CVUA 2VI6A 3S1QJ 1KQ8A 2EIMH 4QU2A 4L18B 2NVQJ 5EXOA 1IRGA 2HWC2 3CJTB 1YJWI 2KD7A 1JTYA 1CAXB 1O4TA 1OYIA 3A4UA 2FUG2 4URTA 4AHWA 4PJNA 4XLFA 4LORA 4N53B 3K0LA 1FYKA 1RMU2 2BPA2 2OW4A 3TW7A 3AP9A 3J7ZI 1P7JA 3BR0A 3KZIC 1SD7A 3SHRA 1GV9A 5L36A 4B48A 1UY0A 2LBFA 3FLTA 3J8F1 3RMXA 4AWDA 3F95A 3FMRA 1G3TA 4UF0A 4L99A 4DUXA 5LHIA 2L4AA 4GDFA 1MMDA 3D5RC 1VAMA 2ZJ2A 3KETA 2UXXA 1U8BA 2M5WA 2YMZA 3LFMA 3VBUB 5C9AB 1R093 1X58A 1S0EA 3W2VA 4F3JA 3CIHA 2C24A 5HNHA 4XURA 1I5ZA 3GZEA 4AHXA 4LK0F 3THTA 3VGIA 4FPJA 3LZZA 4AIHA 2R0FA 4KYWA 2XAGA 1L7RA 2VTXJ 5HS8A 4FXKB 4S0HB 4AHYA 4XFBA 3RJRA 1TZLA 1P9QC 5C44J 4LQRA 5D5XB 3VBUA 1I9RA 2JJ6A 1L3LA 2WL1A 5L3DA 2VIXA 2PLV2 3Q3SA 3N36A 3ZFEA 3RCOA 3ZQ7A 4DY3A 3MIFA 4OVEA 4QWQA 1TWCJ 5FZ4A 3UYJA 2ID4A 3A2KA 2NAZA 4D94A 3BODA 3VHOA 1UZWA 3M3YJ 3HUGA 5F0HA 3I8TA 5DQ0A 3HSFA 5A3NA 4NN0A 1E3OC 1YRNB 3ZN0A 5CKTA 2YBSA 4WM8A 3SLIA 5FREA 2QLZA 1NG7A 2WNUC 5D21A 5FY7A 3I4IA 4Z2WA 1DQ6A 2F4PA 1YIFA 4A69C 5GADJ 1SVLA 1DU0A 1LGNA 2O9LA 2W52A 1D3YA 4QPGA 4D8MA 4JQRA 4UT5A 2CV6A 3W5MA 4Q4W1 3IH3A 3CBNA 1RINA 2VBYA 1NQDA 1EPZA 3IT8A 5DXDA 2JDNA 2L54A 1ZQ3P 4UNOA 5A32B 1FEXA 2ATFA 4IKFA 2JDYA 1GSLA 4MV2A 3OYJA 2DOFA 2RM23 3RSNA 1D4M2 3WNPA 1FV3A 5CNAA 1LULA 1ENRA 3E3VA 4XVHA 2AQFA 2EV6A 2HVQA 3ZXFA 2XJQA 4ZYAA 4AFAA 1W36C 2KDOA 4EM1A 3WW3A 1NCRC 1JN2P 1W0UA 3NQOA 1MH3A 4Y1ZA 2EPFA 4XJ9A 2A05A 2WZEA 1I3HA 2K2SA 3H3VK 5FXXA 3X2QH 1ENQA 4Q4V1 1BI3A 4CEYC 2QQWA 1PGSA 3P9CA 3VBOC 3OYLA 1UNBA 3HEFA 1AXZA 4I76A 3TOJA 1AWCA 2PXJA 2LY9A 2DT5A 4AD9A 4RGKA 2DO7A 3WTSC 4B43A 4CEWC 2WNOA 2CG4A 2XJTA 4NHMA 1MVEA 2AGSA 5JR7B 4Q8KA 5C3RA 3QYEA 5KWRA 2X4HA 1MS0A 4DJAA 2Q8DA 2QEXI 4DRRA 3LSGA 2RDSA 1MZEA 1ACCA 2KJBA 4IEZA 4HKLA 3CNAA 2HQ5A 4ENKA 4I99C 2O3FA 4PCQA 2DF7A 3U9GA 5IYDJ 2K7LA 3LSTA 3FMGA 4XTMA 3F8FA 2RN7A 1DQ4A 1YQCA 3L09A 3K2ZA 5KCMA 4H7LA 1JYCA 3WQ1A 1SLTA 1IHMA 1R58A 3VD7A 4CCNA 1MBJA 4RR3C 3AZXA 1S0JA 1V9U1 1JZ2A 4XHBA 3U21A 1COV3 3O1VA 1H0MA 1ASJ2 1AYM3 2KIMA 1WCMJ 2HU9A 4Y22B 4YFNF 1W4MA 4V2FA 3ILRA 4EN0A 4EWEA 2JA2A 2VVEA 4ZDPA 3A0NA 1E3HA 5FBJA 3TN92 4KBZA 1ORKA 1W6PA 5AVPA 5G04L 2WINB 2Q8CA 3KSCA 1F2NA 1EY2A 3AG4H 2IGOA 4Y24A 3P3NA 4UUTA 5H6RA 3RZLA 3WU2C 2ZKLA 1W6OA 5DAVA 1K78A 3K4JA 3LOBA 2RS33 5L7OB 1XSXA 5FDBA 4KWKA 1DGWX 2HQNA 1LTEA 3U4SA 1MQTC 3LSEA 1E5HA 1PK6B 3F3XA 1D0ZA 4MGKE 4D6SA 3LB9A 4X1EA 3G6JB 1OR7C 1GWMA 4P5YA 2WFPA 4QPYA 1BM9A 4JQFA 2XJPA 5EV7A 2QM3A 5C4XJ 2X5IB 3WNNA 3DEMA 4KT6A 4ESBA 2PAMA 1IDYA 4AQ2A 2BY1A 4OHYA 3ZX7A 3DBRB 2WA0A 1RUC2 1VJ2A 3E6CC 1TME1 3MWMA 2WQZC 4OHXA 3BI3A 3ZYPA 3NWTA 4QHZA 4EGYA 5A6QA 1IZ1A 3IIIA 1GHCA 2QCSB 3R61A 4FX4A 3HBKA 4WVWA 4CZZA 4Y4YA 4CXFA 4BQ1A 4GYIA 5FZCA 4COVA 4N0BA 4FPYA 4YVSA 4S05A 4W6WA 2DW4A 1GZWA 2BJSA 1DGRN 3B69A 2KISA 3WVJA 4E7IA 5JSOA 3TDUC 2DCYA 4BJ0A 4CUBA 3HT2A 4OLLA 4EROA 3MYXA 2VOKA 2K46A 3IV5A 1Q43A 5CKQA 3WINE 1SCSA 4AFCA 3OSFA 3N05A 4G3YC 3KYDB 5M3MJ 2A3WA 3WTZA 3ZFFA 1OQDA 1BBT2 1WBLA 3ASNH 4GMP3 2ZGSA 1DYKA 4E4SA 1DLLA 3DLLF 5FZOB 3CZUA 3HNBM 4LXLA 2UWMA 1USSA 3I54A 1AYN1 3P5JA 5CAZA 5A7WA 4P1WA 1XNCA 5C3SA 5D8AB 4FTEA 1V6JA 2NPIA 4YIFA 1HRV2 3K51A 5TISC 3WT3A 5FYHA 1V6LA 3LDBA 4NC6A 4P5OA 1ULDA 5T55A 3CC2I 4P9GA 1MSEC 3IAPA 5BOXA 2R7FA 4JQTA 2V1XA 4EGZA 1AL0G 1I6HJ 1B8IB 3TEZA 1UPIA 4HETA 5DS9A 5FMBA 3CL1A 2IUWA 5D2AA 1W8FA 3PMEA 3WF0A 2KIUA 3DKQA 1W1WE 5JLXA 2FBEA 4AIKA 1DP7P 4KIGA 4W97A 1W6MB 4QX3A 4XORA 3REOA 2HQRA 4H55A 5FAXA 5CVVA 4GCVA 3LSPA 1RUD1 4CXXA 1UWWA 1XJAA 5LBBA 1BXHA 2J7MA 1REPC 2V4VA 2HH9A 3T2QA 1JYVA 3ES1A 3ZYGA 4BCUA 2O1QA 5IJRA 3K4BA 2IFWA 2CWSA 2VVDA 3FZ3A 3VBFA 1OKRA 1O3QA 5BPXA 2VOTA 2BBVA 3PO3J 3I3DA 5FY9A 2LD5A 4RB0A 3PL0A 1DUXC 5BNPA 1X7NA 1FOD3 5EYRA 3DYOA 3RQ0A 1I1SA 2VMGA 4HRIA 2PHFA 4M6VA 5FKBA 5FZHA 1L7LA 4D7MA 2BXYA 4IEVA 5FZMA 4OWRB 5I0SA 1SFNA 4UI9L 2HWE1 3ZSLA 4O9EA 3CC7I 4NB5A 1BVVA 2KIQA 2XDVA 4SLIA 4A41A 2ZXHA 3H8UA 4CDXC 1J09A 2NYXA 5A1FA 1G9BA 3TO7A 2KPMA 2RMU2 4HN0A 4JX0A 1PUFB 1W2NA 3WOGA 1WJ5A 2GSYA 1YE9A 1GV2A 1ZREA 3CO6C 1WCDJ 2XB5A 3ZM8A 1SVOA 1KYWA 1J83A 2MG4A 3GW2A 2HJIA 4YSFA 2DMPA 2V7FA 3TDZC 2FX0A 3LAGA 3PIJA 1VB2A 2YUEA 5K7ZA 3S2HJ 3ACHA 2M4GA 2AXLA 2ZBKA 1UPSA 4LGWA 3CJIC 4TLFA 1F5JA 3RRDA 4RA0A 1YEWA 2B42B 2L01A 3WCSA 4CCKA 1VBB3 3LA2A 4YM3A 5F04A 2ISZA 5D4SA 3THPA 2HOAA 1R49A 3D0JA 5KHIA 2P17A 2WAQN 1A35A 2H1LA 1W9WA 4XEZA 2H0VA 1E57A 1XS9A 1NOVA 3LMMA 4L5IA 1K6YA 3C7EA 2K0GA 4A3FJ 4KU8A 4Q1PA 3MN2A 3WGGA 1RB8G 2I2SA 3BG5A 2BWAA 4JHZA 1RUG1 4QWNA 3BTLA 2HVRA 4YWAA 4YW2A 5A3UA 2LBFB 2FDKA 1U5YA 4O61A 2FNAA 4MG2A 2QZ2A 3RJ2X 4D5FA 2BE5F 1HBXG 1E5IA 1PMHX 2L2OA 4OAZA 2IRFG 3CQOA 3POFA 3APBA 2DTYA 1VBB2 1ND3C 1N78A 1U5TB 3ZN5A 2X29A 1IXRC 3JUUA 5I91A 3ELNA 2ZXIA 1S0DA 2D5FA 1Z05A 4R9BA 5ACA2 2DPUA 4CUGA 1NAEA 1CPNA 5K1YA 3RZZA 3HRUA 1HC8A 4M73A 2L4MA 1JHFA 2RS12 4B7KA 1DZRA 2VMEA 3RYKA 4DXRA 1QJX2 2W1OA 4OHWA 1C8NA 2DCZA 1PO21 1O3RA 2AXTC 3U1DA 4F52A 4E4DX 1H2NA 2Y6LA 1MZ6A 3BIWE 2WO3A 3W6VA 4F7ZA 1HSJA 1MBFA 2XB0X 4UBHA 1WD4A 1BHGA 2ZZQA 4YRDA 3SZGA 2DBIA 1ZBE3 2D93A 4LFUA 4J1XA 4BQ2A 3ZFGC 4Y20A 2LOOA 4YG0A 4OUEA 4U7BA 1LPQA 1GKBA 4L0ZB 4AYBN 3GM8A 1IN8A 3KP6A 4OUSA 4E7ZA 3RPUD 1PUFA 5J3LA 1XOYA 5L3FA 2DAOA 3VYSB 4K7JA 3SH5A 2NQYA 2VOPA 2JPCA 1K79A 4LOCA 3KCXA 5C5TA 1MS5A 2E2IJ 4DFSA 2OPWA 2O0YA 4JC1A 4BKXA 1IGNA 1KYZA 3KEYA 1KD7A 3AKQA 3VWBA 4EV0A 1HXS3 2CV2A 3IKVA 4CEWA 2ZJRF 4RFRB 3I49A 2WB1N 2E63A 1VRBA 2MBFA 3OWTA 5K5RA 1BOBA 3BTYA 1KA8A 2HXOA 4XSXF 3S5AA 3VUOA 3SC7X 2D6PA 4QXHA 4QKFA 3ASOH 4COYA 3KQRA 1GLHA 3CJIB 1REFA 2DVAA 1S1AA 4MUVA 2TCTA 2WWJA 5J40A 2KRCA 1YW8A 3MAJA 5FLJA 3JB8A 2K9NA 5A7PA 2PMWB 4LK6A 1VPHA 3SMHA 4UY8I 4BISA 4EYUA 1JT6A 1FTZA 2VN2A 2ZA9A 4BXXJ 4LB6B 2XONA 4AEMA 1JKOC 1W9FA 2HWVA 2DV9A 1SLAA 1S2KA 2D2WA 2X10A 4IRHA 1RZ4A 1EV13 5HLHA 1SFXA 3BR5A 1J1LA 3BZCA 1I50J 1POGA 3N7JA 3F6VA 1UY4A 2V1NA 2W1QA 3K4MA 3S15J 2IW5A 1BIBA 3OGGA 3WUCA 2XB6C 4UF0B 3CO7C 2W7NA 5EF6A 1XU1A 4R4ZA 2CFOA 2BY3A 1HJFA 3QODA 2W48A 5A2QK 1CAWA 5JI6A 5LW9A 4OIPF 1GUIA 1QQP2 4RGGA 3FBMA 5DD4A 5IP6A 3Q8FA 1YIPA 4ESFA 2ID6A 4DUVA 2ZHKA 4BXSV 5GPAA 2G0EA 1LJ7A 2ZFUA 1EP0A 4AI9A 3R4KA 1HKSA 1Q8SA 3GBGA 1IQDC 2E32A 4WVMB 5CQEA 2K40A 3L1PA 2L7KA 2GC1A 3GNEA 4MYEA 2FNPA 3CKHA 2ZMEC 1RUD3 4EQVA 4OIOF 1VLNA 1RPWA 3MKZA 5JR2A 3C2UA 3HNMA 4JX4A 1MZBA 4MGIE 4ZU5A 1D2SA 2FRHA 3EDPA 2VJXA 3VBOA 3KZ4C 3PTRB 4RHV3 3CMGA 2RS31 1TMF1 1YFWA 1CPMA 2DFFA 3NQHA 1WMXA 3WHTA 3ZXSA 3K46A 1AX1A 5F5AA 1NCQA 4M6XA 4PSXA 3L2QA 5C9AA 1YLFA 4E7KA 4CDGA 5ABJC 2QKMB 1AL23 1DZQA 1G9FA 3RZKA 3O1PA 2L9LA 4QIWN 1SLBA 1QH7A 4ZYEA 3G1OA 1U9NA 4XPVA 4RS8A 4YZ2A 4ZZDA 2BFUS 3WG9A 5C4WC 4YFXF 3TGNA 5J7MA 4UW4A 4A3CJ 5ICFA 1KJLA 2LR8A 4CEYB 1IV6A 1HXDA 3CJRB 1OD5A 4CXYA 1HQCA 1T6SA 3S2WA 3HN3A 1Z91A 1BA5A 4NIDA 4YVSB 1BLZA 4FETA 2MABA 1RUD2 2WNVA 2XGEA 4ZXEA 4XOPA 4LE3A 1WW6A 1CAXA 1CZVA 3W3CA 4G9YA 1IOAA 3LGRA 2O8XA 5GZEA 2QENA 4QDSA 3AX4A 3PM1A 2XLFA 1MEC3 1AR63 1C8M2 2YV8A 4PIYA 1LUJB 3TB0A 1F4KA 2RS11 4JVAA 1OD3A 3CLPA 1HLVA 4HOOA 5LB6A 5GZCA 3AKRA 3V0AA 1AL22 2V9VA 2DCJA 4KWLA 5DUWA 4EM0B 4QX7A 3V56A 2EZKA 3Q8AA 5D8KB 2YSRA 2LKXA 2PX9A 2VBDA 4HKOA 3PUIA 3F8NA 2HWE2 1L3JA 3HJEA 2R7QA 4QX0A 1UZCA 1ETOA 2BVBA 2E2JJ 4CCEA 4LK1F 2W82A 4IHVA 3NRVA 3RWKX 1GZWB 2C9AA 3WQ0A 5EJZB 4XDOA 1AU7A 2ADUA 2MEV3 2YFUA 2WQ8A 2CJJA 1OUXA 4NHJA 3I2KA 3K1MA 3CCMI 3ES4A 2F5FA 3F72A 3CJXA 3AL0B 3KX2A 4R79A 2CV1A 1C8M3 5EJ1B 1EH6A 2PLV1 3ZVXA 3DYPA 5HLIA 5ED4A 1GWLA 4XRSA 2ESNA 1O91A 3S32A 1GVDA 4G9SB 2WT1A 3DTKA 2PQQA 4XBLA 5JXGA 2KDZA 1G3SA 1YYVA 5FKMA 3R4UA 1KFUL 4K40A 4JV4A 1OOPC 5JAXA 4H7MA 3RKQA 1H8TB 1PVC3 4XFGA 2MEV1 1IN6A 3OYMA 2JSCA 1V6NA 2I8DA 1B72B 4FP2A 5ICEA 3LWFA 4HX4A 5IVEA 2X85A 3JCUC 1QJEA 1R22A 4BXFA 1FMD2 4NC8A 1YFHA 1VQ8I 1AJOA 1SMYF 3THCA