2FMYA

Co-dependent transcription factor cooa from carboxydothermus hydrogenoformans (imidazole-bound form)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
ATQMRLTDTNLLEVLNSEEYSGVLKEFREQRYSKKAILYTPNTERNLVFLVKSGRVRVYLAYEDKEFTLAILEAGDIFCTHTRAFIQAMEDTTILYTDIRNFQNIVVEFPAFSLNMVKVLGDLLKNSLTIINGLVFKDARLRLAEFLVQAAMDTGLKVPQGIKLELGLNTEEIALMLGTTRQTVSVLLNDFKKMGILERVNQRTLLLKDLQKLKEFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of CO-sensing Transcription Activator CooA Bound to Exogenous Ligand Imidazole
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Dna binding protein
molecule keywords carbon monoxide oxidation system transcription regulator Coo
total genus 67
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fmyA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2fmyA01
4MTEA 2ETHA 3GYDA 1ZRDA 2E7WA 3JAMZ 4IPAA 4MGZE 4LLGF 3HOSA 1LB2A 1R23A 1KYZA 2KXLA 2HGCA 1B4AA 1QZYA 2OQGA 3CO7C 2ACJA 2FOKA 4UVAA 4QM8A 1UCRA 2AXLA 1O3QA 1EH6A 4ENMA 4Y15A 4HW0A 4ZYDA 1S8NA 2COMA 4HX7A 2EV5A 3H3ZA 4BXUA 5J7MA 4Z07A 2E7XA 1XGOA 2ZMEB 3CLOA 4OOIA 1W4MA 4LUMA 2IPQX 1IN7A 3J80Z 4N9HA 2L01A 1YFUA 3TQNA 3KLNA 4RAZA 3LAGA 1ZG1A 4FAHA 3ELKA 2YSRA 4HBNA 4GYIA 3W6JB 2RQPA 3RIRA 4MQ9F 4IEXA 3SCGA 5F64A 3ROUA 4FX0A 2UXNA 3P9IA 3CEWA 1PMIA 4ESFA 2JPCA 2KJCA 3NEUA 4HAMA 5ILVA 3R61A 4L11A 4LB6B 4A5NA 1Z7UA 1REPC 2MNGA 2RNJA 3HHGA 1HXDA 5LHIA 2XAQA 3F72A 1V70A 5JHUA 4CICA 1BBYA 2K27A 3K2ZA 2XAFA 1QWRA 3NW4A 3R60A 2JZYA 4E2SA 4L9VA 5FCCA 3MFKA 1LEBA 4MGKE 2RVCA 2HFHA 2RKHA 4NVPA 3TOBA 3WGIA 3K1NA 1OFNA 3SCFA 3IDBB 1K79A 1IW7F 1PUEE 3KZZA 3USSA 3F22A 2Y0MA 2Z2SB 3COAC 2K7LA 1ZARA 1JE8A 4RGUA 4YSFA 1IXSB 2LKPA 4IEUA 4XFGA 3HSFA 2GIVA 3WTZA 3GFMA 1P6RA 1BC7C 4KICA 4NQWA 1E17A 3PLQA 2JSCA 3E5XA 5J8FA 1TW3A 3C7JA 2ZBKA 4A12A 1XE7A 1FLIA 3I7DA 3RYPA 2K86A 3VODA 1J3QA 5DV5A 4X6QB 3ZMZA 1KGSA 1UD1A 1Z1DA 3ETQA 1DUXC 1KU3A 1A04A 5HOOA 1ZX5A 2B8MA 4I09A 4OFGA 5FLXZ 3MEXA 3ECHA 1T0FA 4XFBA 2M87A 4LD5A 1IF1A 3L9FA 4F8AA 5DD4A 2V1UA 1FSHA 3S7EA 1STZA 2XVCA 1UHMA 4IXAA 3KGZA 3MQ0A 4I0BA 4L9NA 1ZZBA 5E17F 3D0SA 2P5KA 3KETA 3V8JA 2G7HA 3FMSA 4M6XA 5FPXA 1ZHFA 4KNYA 4WXCA 1J3RA 3LQQA 5FQ0A 3IIAA 5BUVA 1IRFA 1J1LA 3HT1A 2QVSB 3TNQA 4UVCA 2XROA 4OU0A 1SAXA 1RZ4A 2OU2A 3MPBA 2ZNYA 3KP2A 5D5VB 2DLLA 2ELHA 4CGZA 1OMIA 4I2OA 2VE9A 3ERED 1ZZ6A 5HVQC 1U5TB 1HQCA 1LQ1A 1H1IA 3SZPA 3SMHA 4L18B 4HOBA 4GULA 3ZPLA 3HRMA 2FBKA 4LA3A 4JK1X 2XIGA 2O3FA 1HSTA 1IN6A 4KA4A 3Q9VA 5E1RA 4WF2A 3J81K 1DPUA 1OKRA 3E6CC 3F8MA 2Z69A 3DN7A 1X8MA 4LA2A 4QGMA 2H09A 4BH9A 2IT0A 3ZMDA 4O5VA 3DKWA 3REOA 4ENKA 3QACA 3C3WA 3K0LA 1J7KA 4YIFA 3UKVA 2QCSB 4RB3C 5CVJA 1ZN2A 5ED4A 2KIUA 1R5HA 5H20A 1ZYRF 1RI7A 1XSXA 4K2EA 3GBFA 4OIPF 1C0WA 1ZRFA 4E2GA 4ZH4F 4L9TA 4RD7A 1DPRA 4EM1A 2IA0A 2CAVA 3ZDSA 4ZU5A 5K8SA 5E20A 2CG4A 2DK8A 3UKTA 3GEZA 4PZJA 5E1WA 5TJJA 1ZAOA 2IXKA 1BN5A 3T8TA 1YS7A 4B8XA 5E1ZB 3IL2A 1EP0A 2ESHA 3CLPA 3CL1A 2NYXA 5ERIA 3WODF 1YQAA 4KWKA 4XFHA 2ZJ2A 6PAXA 4RB2C 2MHFA 5BV6A 3MCZA 4YG2F 3ELNA 3EYIA 1I1GA 3E6MA 3NSTA 2HKXA 2TDXA 1IN4A 2O61A 2CSOA 4RB1A 1I5ZA 2STWA 1QBJA 5LEJA 5FFXA 5HDKA 5FPZA 1P4WA 5D8LB 3L09A 1HW2A 3BPXA 4L5JA 4GGGA 2O03A 4IRHA 2ETEA 2IXIA 3RKYA 4KUMA 4IEYA 3M7GA 2QQBA 4HSJA 3FXQA 2EB7A 4KN4X 2XAHA 1BC8C 4HN1A 3KFWX 3B73A 2ET1A 1Q5OA 2ZKLA 2OZJA 2YU3A 2JT1A 4MQVA 1E2XA 2JTVA 1DGRA 1LDDA 3QU3A 3AAFA 1WQ2A 4FHTA 2FRHA 5J48A 2V1XA 2A6EF 2VC0A 2VC1A 2WFPA 2GAUA 5FD6A 1T39A 5KHHA 2MA3A 3I53A 4O3MA 4A6DA 3TDUC 2F5FA 2VBYA 4META 2BE5F 3L2CA 4LLLA 3BJAA 4UNOA 1K78A 2BEOA 3F6OA 1U5TA 1MKMA 4BAYA 1QXJA 3CO2A 3RYRA 4XF1A 3WW3A 4U0VA 2Q8KA 4XF9A 1UIKA 3JSPA 2F4PA 4RGRA 2QYOA 4M72A 3U11A 2IRFG 2GC3A 3VB2A 1FBUA 2ATFA 5KHIA 3S2WA 4DNCA 1XSDA 4AVCA 4Q4ZF 1CX4A 5I91A 2ADUA 3WU0A 5BPIA 1MDMB 4XLPF 3K9TA 4KN7X 3EBRA 2CO5A 1Q1HA 2RDPA 2VONA 3RZZA 3FFQA 2OZUA 3MDPA 1JXSA 4HVRA 3BOQA 1RGSA 2FMLA 4RB0A 4XSZF 4D0PA 5HDGA 3BPVA 4EQQA 3CF6E 2VBZA 3DL3A 4ETSA 4MH0E 4MGIE 3KZYA 1TQPA 1B59A 1JHFA 1CF7B 4CDGA 1O4TA 2V79A 1MJBA 4IVNA 3PQJA 3GW2A 2Q1ZB 1CAWB 3IKVA 4ZU4A 4KIBA 1X8EA 2PG4A 1ZLKA 4WVZA 5KHGA 4N0BA 2B5HA 5LGNA 1PDNC 2MH2A 1GHCA 4O9EA 3SCHA 5FDBA 1H9TA 3EYYA 2CQKA 1FZPB 2Q2EA 4PIXA 3I59A 3L7WA 1MJAA 4HF1A 2HJIA 2DFIA 4KT5C 2W25A 1ZRRA 4BYYA 4XEZA 5I0RA 4LGWA 3GFLA 3WW1A 4YARA 3SFZA 4U0WA 3PQKA 5JI6A 1G6NA 2UYAA 2CWEA 2VBWA 4I3PA 4IEVA 4WX9A 2HDCA 4J1XA 3W6KB 4BNCA 1O5UA 2Z3YA 4L0YB 3LAJA 5KHKA 1D3YA 5EZWA 5JSRA 3I54A 2V09A 2QVOA 4EGYA 3CJXA 2BV6A 1NXMA 3HYIA 1YIOA 1ZH5A 3ES4A 4IHSA 3FF5A 5JSPA 4Y13A 3DP7A 1XMAA 2DO7A 1XSVA 5ICCA 1D5VA 4JQFA 3RJPA 1IN5A 1FWZA 3ZMUA 4JV4A 3TO9A 2PQQA 1GXQA 2QWWA 4KYWA 1LNWA 3KEOA 2PYTA 3FHIB 3KMHA 1L0OC 2Y0OA 5LRRA 4HLYA 2G7UA 1R58A 4A5MA 4HX4A 3OOPA 1U5TC 2R7FA 2X0LA 3L00A 4HSLA 1U78A 5I8TA 3E5UA 1EY2A 4XLNF 4ESJA 1XGSA 3E6BA 3FMQA 1O57A 1SFUA 4XETA 3ZMVA 2B0LA 4HN0A 1FY7A 1O7FA 1XMKA 4QLCU 1KYWA 5L3BA 1ZG5A 4G6DA 1WWXA 1FYMA 1HBXG 3F23A 2C0ZA 1W7PB 2XHKA 1EH7A 4MNUA 2FBIA 3N97A 4B29A 3LA2A 4L5IA 3RDIA 5KBFA 5T3NA 2VN2A 5D4SA 3IC7A 4RGSA 1VTNC 3BALA 3OF1A 2B9UA 1XDUA 3RKXA 5I0SA 2DPUA 5L3DA 3LA3A 2ZCWA 5ILUA 1YFYA 1B9MA 3F6VA 4UV8A 3HTUA 3FJSA 3ECOA 3LFKA 4CZZA 1ZZ7A 3GO5A 4BHPA 4YFNF 2F5DA 4EMSA 1HKSA 2IVMA 3GFIA 4G9YA 3FHZA 4ZYEA 1XCBA 4P9UA 3TO7A 2MLGA 2M30A 2XKPA 2UY9A 1K6OA 4MZUA 2A6HF 5E16A 1TQIA 2L3DA 2WC2A 4FX4A 1XGNA 3K1MA 1KQ8A 3KP4A 1Q43A 2FXAA 3OV8A 1FOKA 3RYKA 4ENJA 3RPQA 1CAVA 2ZMEA 5I0TA 1ZVFA 3NKTA 3ZQ7A 4Q0QA 1OYYA 1GQHA 4E70A 2DCTA 1R36A 4KIFA 1YW7A 3F8BA 1CF7A 3ML6A 3IHUA 2BGCA 2HEOA 5L3EA 3S0MA 2FMYA 1PP7U 1TTYA 1DZTA 3IWZA 2KIFA 4BIFA 4AQ6A 1CAVB 1VP6A 4M9XA 2Y75A 2D5HA 4O9GA 1T98A 1S7AA 2QNKA 5J6XA 2K9ZA 1NZCA 1BOAA 3H7JA 4MGRA 5JR3A 1QQIA 1FI2A 1IPKA 2M1BA 2NS0A 4G7HF 3ZMSA 1SMTA 5E8IA 5D5XB 2Z33A 5BS6A 4TV7A 1SEFA 4YFKF 2A5YB 2MLKA 4A2UA 4AVBA 2GU9A 1F1ZA 2PBIA 1FXZA 1R1TA 4QGLA 3FZVA 2I45A 5LHHA 2ISZA 2BNOA 2GC1A 2XAJA 5D8KB 4Y17A 1YW8A 1K78B 2UYBA 3D5LA 2X4HA 1F9NA 1SD7A 2EV6A 1QZZA 3DPLC 3BJOA 3HRTA 5HLGA 3FMRA 4I0AA 2Y48A 2R3SA 3ST7A 3QP5A 1Y9QA 3HT2A 1GQGA 2GXBA 3TOAA 1ZZ9A 4XRFA 2OPKA 4HVOA 3RKWA 4ENNA 1X3UA 2LF8A 4LULA 2K02A 5A2QZ 1NE6A 1WRJA 4MEYF 4MTDA 4A0YA 3PNAA 1NE4A 4BHCA 1W5SA 4MV2A 4IEQA 3H1WA 2BYVE 1U6GA 3NVCA 4OIRF 2DI3A 1LJ9A 4LJZF 1J58A 1XB4A 3KE2A 3DV8A 1G3WA 4IRIA 2NNYA 1R1VA 2HOEA 2F5CA 2Q0OA 2EFWA 1QGPA 2UY8A 3IRRA 2XL9A 2XL7A 3D0JA 3GF2A 1BJAA 3GZ6A 2M5WA 2GA1A 1YLLA 1LKNA 1I6XA 3PFIA 2J5PA 2GH2A 2VT3A 4PGGA 4UV9A 1Z9CA 1OYIA 1NHAA 3QU6A 2EA2A 4MUVA 4I7HA 5TRDA 1J75A 2VQAA 3I4PA 2PJPA 1CAUA 2QBYB 2EFOA 2P7CB 1CAUB 4M6YA 1IAWA 4EWAA 5CVVA 4PIZA 1IUYA 4XF3A 4HDVA 2GC2A 4Q29A 1LR5A 1EH8A 2HQNA 4ORFA 4PCQA 4EJUA 2L54A 2ZKZA 1LRHA 5DCMA 2IA1A 5CLSA 4EJOA 5ICGA 3NJZA 3BWGA 4WXDA 2GXGA 3BROA 3HSRA 3E5QA 5I0UA 2BNMA 1BI3A 2CFXA 5JSOA 1KA8A 1EYBA 2L4AA 1LEAA 5FB2A 4XF0A 3FXRA 1HW5A 4PGHA 3H8UA 4AQ2A 1FYLA 4AIKA 1ZGJA 4JTOA 5DD8A 1SFXA 2HTJA 3WW2A 5IT9K 4BQAA 4JVAA 3OGJA 3WTSC 1Y0UA 1Z6TA 2RV8A 1KQ9A 1YW9A 4P5OA 1EV7A 3M70A 2XASA 4XFFA 1XDSA 4QM9A 5JCTA 4LG0B 2PA7A 2H6BA 4XFAA 4EVIA 3VEPA 3EQEA 2IJLA 4IHTA 2DU9A 5ICEA 3LAPA 4HLXA 5CVRA 1O3SA 2DQLA 1RIOH 5AIPA 1HW1A 4HLTA 1X7NA 4EGZA 2A61A 2E1CA 3J81Z 3F8CA 3DF8A 1HSJA 4IJAA 3GZ5A 2D93A 3O6BB 3HRUA 4WCGA 3J7AO 3HRSA 3F21A 1R5GA 3BDDA 1LDJA 3EHKA 1K7AA 3ZN0A 4J1WA 2HYFA 5FLIA 3HQXA 4P55A 2WV0A 2F2EA 2ET7A 3CUQC 5HS8A 2Q0AA 4AWXB 3NL1A 4R79A 5DDGA 4LK1F 1YFWA 4YRDA 3KP5A 3FM5A 5I8SA 2C6YA 1I1SA 3S7IA 1FP1D 2IA2A 2FNPA 2VT2A 5HS7A 3M3IA 2XLGA 2XAGA 1J3PA 2HTSA 2XLAA 3T1BA 3H7YA 4HF2A 4WWCA 1U3EM 4QXKA 3R6SA 2M8EA 2P6SA 4RGXA 5ILSA 5BQTA 1J59A 4X6RB 5FFZA 4UBHA 1VR3A 1DDNA 3RNSA 5CVIA 3E3VA 3C1DA 3F8NA 3GX4X 1PM7A 3H50A 3I5UA 3C18A 1VJ2A 2PTMA 3SQNA 3BU7A 4EM0B 4AIJA 1D8KA 2DQRA 4OMYA 4EM2A 3SZTA 2VPVA 3I59B 3BPZA 1SD4A 4HX8A 1DGWA 2W85A 2CAUA 1ON2A 3JSOA 1G3YA 1B1BA 3I58A 4MHGA 2PHDA 1XN7A 5L3CA 2VOPA 3HHHA 4Q48A 1YTYA 4HDUA 2IP2A 1AOYA 4FBFA 4IERA 4IEZA 4P96A 1RUNA 3SHFA 2FA5A 2P6TA 2IXLA 3NRVA 4KFCA 1NYWA 3IRQA 2K4BA 2OBPA 1W5TA 2PEXA 3KSCA 3DEUA 3I0TA 4AIHA 4U7BA 1MGTA 3M1EA 1DP7P 4QX5A 5FLXK 4LEJA 4OMZA 4KMUX 1TW2A 2QM3A 3WTWC 1CGPA 4I02A 4XFIA 4IRGA 3V7CA 4EJTA 3FE5A 4EWEA 3O14A 3DPTA 2VOOA 1IXCA 1V3FA 3G3ZA 2HWVA 3JW4A 3B02A 2KJBA 3WU1B 5HS9A 4L2NA 5BXXA 5BPDA 2XLFA 4KU7A 1FNNA 1SMYF 5K5RA 2BNNA 4HBLA 1H9GA 4CYDA 4N9IA 2PAKA 5J8CA 4G94A 5E18F 2W57A 2UWMA 4U7DA 1J5YA 3HSEA 3QPTA 1Q3EA 3ABTA 1QXRA 2H6CA 5LLQA 5CADA 4O6JA 1ZZ8A 4YFXF 2HYGD 1TNTA 4HZFA 3U9GA 3G7DA 5BMZA 3WTTC 2RGVA 3ULQB 3BY6A 4DINB 1YG2A 5KHJA 1EPZA 1J2XA 3MZYA 4AVAA 4FAGA 1CAXB 5FO5A 3J80K 4UHTA 1UHWA 5FLHA 4A6EA 4S05A 3LQRA 4B09A 1KU9A 5AVPA 2OD5A 5DEQA 1UCXA 4HQEA 4R8HA 3C3VA 4UUVA 3R0AA 3TGNA 1UIJA 5BPXA 4HV5A 4FT8A 3EJKA 4U0YA 2FEZA 4IETA 2XGXA 2MPFA 4XSXF 5L3GA 1JUHA 3LSTA 5FD5A 4OIQF 3BB6A 3CO6C 2QBYA 2GA2A 4H7LA 3JAMK 2MD5A 3G73A 4PDKA 1D8JA 1FBSA 5LGUA 2FU4A 4I98B 2D40A 5KK1A 1GVJA 4HQMA 1AWCA 4EROA 3TKYA 4EWDA 5K1YA 3U2RA 3LWFA 2J5OA 2D2WA 2EJRA 3BJ6A 4D7SA 1WA4A 4ASNA 1FYKA 3EQLF 1FPQA 3O2PE 2E1NA 4LUKA 1PP8F 1B6AA 3FX3A 3ACLA 2BBYA 1HKQA 5LEKA 2HQRA 1BI0A 2O0YA 2DBBA 3QPHA 1DZRA 4UXAA 5F1RA 3CUQB 5H6QA 2PLYA 1IZ1A 2HZTA 5JR7B 1WLTA 1O5LA 3MZHA 4GCVA 2D1HA 4LLNA 2VXZA 1RL3A 3WG9A 2QJVA 3LZZA 4Q47A 1JHHA 4LG0A 2JPBA 4ON0A 5I93A 2H94A 1JGSA 2PN6A 2ISYA 3H1YA 3H3UA 2EFPA 5EEHA 3T5XA 4G7OF 2A69F 1TQMA 3IWFA 3CJNA 4KMFA 2PHLA 3UKNA 3N4MA 3SXYA 1YYVA 2DPDA 5LBQA 4MGYE 1XCVA 4KU8A 2HR3A 2V6CA 3FM3A 1U8RA 2OA4A 3LA7A 4ONUA 4LK0F 1P4XA 3WTVC 3HTSB 5BY5A 1QNTA 1SFEA 4TLFA 3BCWA 5HLHA 2EA4A 2MH9A 3KLOA 2EK5A 2D1VA 2KKOA 5D4RA 2QZ8A 4HF0A 4HVQA 2L4MA 1X82A 2LNBA 2XKOA 2EV0A 3KGLA 2A3SA 1UFMA 2FQPA 3H9AA 2FBHA 4R52A 4Z82A 1IN8A 5E8GA 5E1XA 3KP7A 1J0RA 3F3XA 1R22A 2ZFWA 3CUOA 4XFCA 3DQVC 3OTFA 3OCPA 1T38A 2EVXA 5DCFA 4Q0UA 3GXOA 5JFRA 1Z6RA 4XF4A 3TO6A 2HS5A 4WXHA 2G9WA 1YUDA 4WK8F 1CAXA 3ABUA 4AVPA 4OLLA 2O8XA 4M73A 1J9IA 1S6LA 1IRGA 3MAJA 3SXWA 1XD7A 4MX3A 3VFZA 5JVTA 2PAEA 2PMHA 1W7PA 2LSOA 1S7OA 3ISPA 4OINF 3NQOA 3M8EA 3MYXA 2DW4A 3GVAA 5DUIA 3KEQA 2DT5A 2V1DA 3V8LA 1R7JA 5LRSA 4HMZA 4D7TA 3WE2A 5DUKA 4QGNA 2YR2A 1G3SA 4GXOA 3EDPA 3HUGA 2P8TA 2LF7A 4G7ZF 5IT3A 1QY4A 2PFBA 3P7NA 3FZ3A 3H92A 1XE8A 3QOPA 4Q0PA 1SD5A 2K0GA 4UVBA 1RNLA 3EO6A 4IEWA 4L0ZB 1U2WA 5LHGA 2YX4A 1ON1A 4HYEA 4RAYA 3IBMA 1LVAA 2DK5A 1FC3A 2IW5A 4M9SA 2OAZA 4CXFA 3QAHA 1H0MA 2VODA 1Z05A 5CU1A 1ZREA 2F5EA 2EA7A 2EAAA 3L2HA 3FWEA 4H0EA 1L3JA 1OR7A 2FNAA 4LLOA 4Q0VA 2AS5F 2W24A 2VE8A 1U12A 1T2KA 1TNSA 3GWZA 3EUHA 1XRUA 5J3UA 5HDNA 2E9QA 5EEGA 5C8WA 5EFUA 4ZYHA 4K8FA 4GYGA 5DCMB 1I27A 4AXOA 4CO8A 3FXUA 2CV6A 4F7ZA 1FBQA 1IXRC 1TQ5A 4BHBA 4Z2YA 4YIIA 4HV6A 3E97A 2NNNA 4Q0SA 1V4RA 1YLFA 2NRAC 4HA8A 3O3KA 2MBFA 4ZU7A 4A0XA 1TBXA 3QRFF 3U0ZA 5JAXA 3JTGA 1BI2A 1QPMA 1UW8A 2P17A 2MC3A 3WGGA 2WTEA 4Q5SF 4UXNA 2QQAA 4E2QA 2M45A 1R1UA 2Z9OA 5KVRA 4IEOA 3CDHA 4NB5A 2EFQA 2QENA 2QUFA 2Z99A 1SQ4A 2ZXJA 1W7PD 3K1PA 4ZZLA 1MZBA 2STTA 2D5FA 2Z5UA 1RC6A 4CHUA 4M74A 4MEXF 4KIGA 1KU2A 3TNPB 1O3TA 1MD0A 5ICFA 5K5OA 2VECA 2CW0F 1SFNA 2P7VB 3P9KA 4RS8A 1BI1A 5FLJA 1R00A 4LFUA 1YFHA 3KCCA 2P4WA 2XV4S 3ES1A 2N7GA 2FSWA 2FE3A 1F4KA 4EV0A 1QO0D 3Q9SA 3HIFA 3M9AA 2OZ6A 1ZZCA 4WZCA 3I64A 2PAMA 4ESBA 2RC4A 3R0JA 1P2FA 4M71A 4XBFA 4ZYGA 2DAOA 3D82A 2GC0A 4KWLA 1B9NA 3RTRA 2QDRA 2YPRA 5IT9Z 4PJYA 2Q4SA 2A07F 2PQ8A 3BZ6A 2VBXA 3DFGA 3EETA 3ZN1A 4DQ2A 2IC1A 1BM9A 5K5QA 5CYVA 1ZRCA 1IPJA 4NHJA 3MWMA 2R7DA 2DTRA 2IXHA 1OYWA 2Q30A 2GQQA 1Z91A 4JBAA 4KL1A 2ZNZA 2XRNA 3GYHX 1S29A 5CVUA 4R1HA 1LDKB 4LMYA 5C6CA 1WGPA 1O3RA 2PI0A 3WTXC 5AIQA 1YFXA 2FQ3A 4IEPA 1RTVA 2O8QA 1Y3TA 4AD9A 2IXCA 3QP6A 3V8KA 1KQ0A 2LDUA 1BIBA 3CUQA 1G4DA 5I8YA 3K69A 4G6QA 2UZKA 4QMAA 1P4AA 5D1IA 5CJ9A 4EJWA 5AONA 1RUOA 2H27A 2WWYA 1HKTA 2FF4A 4IF4A 1USTA 1ODDA 3E6DA 5BOXA 1L3LA 1YWKA 4PIYA 3F8FA 5H6RA 1S3JA 3GUDA 4YNIA 3JZVA 1UPIA 3DXJF 3WE3A 2RN7A 4LB5A 3CTAA 2A68F 3M8FA 3RPUA 3V7RA 2O1QA 1FX7A 5LGTA 1F5TA 2OA2A 5L3FA 4M9ZA 1KU7A 4G8XA 4GO1A 2ZO4A 4ZZDA 3LWCA 3U1DA 2QQ9A 5D5WB 3KP3A 1OD5A 4UBGA 3WW4A 2GZWA 5D6EA 4LTAA 1ONVA 1YS6A 1UB9A 3V4GA 1ZGAA 2L02A 4A0ZA 2XUBA 3GFJA 3H1MA 3PVBB 1ZNPA 5FGMA 1G3TA 1O7LA 2P5VA 2H0VA 2IXJA 5D6FA 3P9CA 3U10A 3HOTA 2OQRA 3Q5FA 4P9GA 4S04A 5DYMA 2ESNA 2W84A 4IESA 5D5UB 1YHFA 1OI6A 5HLIA 3KP6A 4WBBA 1WSUA 3T8RA 3VOEA 2K4JA 2GWRA 2CYYA 5F6FA 4JTNA 4EJVA 3IKTA 4KDPA 1CAWA 3OD0A 3ZMTA 3VHRA 5A2QK 2KRFA 2YX7A 1FP2A 2EWNA 1WKMA 1ULYA 3WGHA 1YO5C 2NAZA 3SHRA 3ZP5A 2PMUA 2O6GE 1USSA 2OYZA 1SD6A 4P9FA 1MDMA 3V7SA 1GXPA 1ZLJA 2P5LC 2UXXA 4YYOA 2HKOA 1FSEA 5FQ0B 4I01A 2V9VA 5HI0A 3IDCB 4QWQA 2QLZA 3R4KA 2PFWA 3RI4A 1H1MA 1BIAA 2JRTA 2CGPA 1T6SA 1TLHB 3BP8A 4L9JA 1XGMA 3WTUC 3LOIA 1P92A 2EFNA 4OIOF 1ZG3A 3GLXA 2D45A 1MJ9A 3JTHA 1WI9A 1FT9A 3T0YA 4U88A 3TDZC 2KIMA 3WTYC 1OPCA 3I71A 4KWJA
chains in the Genus database with same CATH superfamily
4MTEA 2YU1A 3OYBA 3H0OA 4HNUA 4XBNA 3ZQFA 2E7WA 3DTEA 3ZXDA 3S1NJ 3Q9OA 1D0YA 1R23A 4SLIA 1XNAA 1POV3 4FPEA 3I2HA 2OQGA 4LOSA 4J01A 2ACJA 2FOKA 2W1QA 2JDPA 3TEZA 1QNYA 1O3QA 2AXLA 2AZ5A 3OBZA 3WHBA 2WWJA 4ZYDA 5A7WA 4HX7A 3H3ZA 3A22A 2E7XA 1XGOA 2W00A 4JX6A 1W4MA 1RJ8A 2IPQX 2PHRA 5ACA1 1IN7A 4MFDA 3O1OA 3W59A 3LAGA 4QPIB 1TWAJ 1E5HA 3N35A 3R4DB 3W6JB 5LY2A 4AWDA 3WNOA 4P14A 3V42A 1HXS1 4ZHNA 1AR62 3C7OA 1UF2C 2WAAA 5F3CA 2VXDA 1JKQC 5JHFA 4D9JA 4M0HA 4Y33A 1VQ4I 2E6VA 4YLZA 1W9YA 1I50J 1TWHJ 2IGKA 1QDOA 3KD4A 4UFKA 4DB5A 4HAMA 1GDTA 3R61A 4L11A 2NVYJ 4A5NA 1Z7UA 2DTZA 1REPC 2MNGA 3HBLA 1B35A 1FOXA 3ZN6B 2RNJA 1HXDA 3SH4A 2WA0A 2R7OA 4AIDA 3K2ZA 2XAFA 4E2SA 5C33A 4PFOA 5FKLA 3PFYA 2RVCA 1JOPA 3IDBB 1K79A 2XH6A 1PUEE 3BR0A 4ATEA 1QMJA 3COAC 2COBA 2M34A 3CESA 2XBO3 4XJ8A 4D8MA 2CQ7A 4JGYA 1FX5A 2E2JJ 1SLCA 3WTZA 3GFMA 4WVVA 1P6RA 4GKXA 4KICA 4NQWA 4BKXA 4XOGA 3HGGA 1OQEA 1TVGA 2GSYA 5A3LA 2PLV3 2CQNA 4MLOA 4AC0A 3I7DA 2K86A 3LFUA 2ZX2A 5DV5A 1WD4A 4A3FJ 4W97A 1UD1A 4V2VA 4Q4V1 1DUXC 4C8DA 4NPMA 4FPGA 2B8MA 3INAA 4I09A 4N53A 5IFTA 3NAUA 3PMEA 2ZXHA 1G86A 4N90A 3WP5A 2XF6A 3PUSA 5B1AH 1T0FA 1NQJA 1IF1A 2CDOA 3L9FA 4GB32 5GTHC 2V1UA 1F5JA 2PX9A 3IKWA 4IZZA 1ASJ3 5LK7B 3S7EA 4C0BA 3OOUA 1STZA 1F9KA 4I0BA 3HOVJ 2ZX0A 4Q4X3 4GALA 2W47A 3TOJA 4CUAA 4M6XA 3O1PA 1ZHFA 4WXCA 5FQ0A 2C24A 3IIAA 1J1LA 2VBPA 3D1NI 2QVSB 2EXJA 5CNAA 3TNQA 1H2MA 4Q4Y1 4BE3A 2OU2A 5CKTA 2JA5J 1AYN2 3HNMA 5FYSA 1GZCA 2VE9A 1LHWA 1ULDA 3ERED 3OB8A 5FZMA 3AL0C 5DDJ2 4LBQB 3OG2A 2Y6KA 5BNGA 4A3EJ 2VJIA 4AE2A 1W8UA 4GULA 4HPKA 4LA3A 2GOXB 5E89A 2DOAA 2XGCA 2WNVA 1R71A 3B5LB 3UETA 1HSTA 4PDWC 3AZXA 2P5BA 1CIYA 5E1RA 3J81K 5LASA 5E3OA 3MLJA 2LH9A 3F8MA 1OVPA 2Z69A 4LA2A 1SLAA 2UURA 3PSFA 4UF0B 2ICWG 5F1JA 2FDJA 1XOYA 4UYBA 2VW1A 1JBCA 3C3WA 2Y9ZA 3K0LA 5A7SA 3UKVA 4YVSB 5CVJA 1ZN2A 4QB1A 1ACIA 2KIUA 2JG9B 5FMOS 4PJLA 3O1TA 3GBFA 5EJ3A 4ZH4F 4RD7A 4TXWA 1B8IA 5E3MA 5IW0A 4LBMA 2DK8A 3UKTA 4KISA 4NNJA 5TJJA 1JYXA 5T5JA 5JPMB 4GWIA 3T8TA 3P3NA 2ESHA 3CLPA 1AHSA 5A7OA 3LL7A 4AK3A 1V6IA 2TCTA 1VBD2 3H9GA 3LNQA 6PAXA 1JHNA 3MCZA 3VBOA 3PTYA 1BQPA 1MBHA 1I1GA 4DEQA 4S2DA 1W0PA 3OYAA 1V6OA 5LEJA 1P4WA 2UWCA 2X05A 1HW2A 5GZGA 5FY5A 4A7YA 4IRHA 3WCSA 2Z16A 4OZOA 1RUF3 2QQBA 2Y6HA 3QPLA 2ZJQF 4JGYB 3BTIA 1U9NA 4X6AJ 3FXQA 4KN4X 2M4KA 2GP3A 4B4PA 2XMLA 4ET7A 2RS11 1NK3P 3AMPA 3OS2A 2ZKLA 1E2XA 5FLVA 2JTVA 1LDDA 2VE1A 3QU3A 3AAFA 1KGYA 2FRHA 3H8OA 4AI3A 2VC0A 2WFPA 2GAUA 1T39A 2H1KA 3AYCA 1S0FA 4QX1A 4RS5C 1ETKA 1H88C 2VBYA 1Y56A 4CP0A 2CNAA 2JDMA 3ZYRA 2BWAA 1BKZA 1IRZA 1R091 1CZVA 4G3YC 1QZEA 4BXSV 5SV5A 2J1RA 1YIJI 2VW0A 4XF1A 1JYCA 4XF9A 1UIKA 4BDYA 3CZJA 3FXMA 2OXBA 1W8OA 3ALQA 4V2GA 3M2MA 4DNCA 1XSDA 2ZXWH 3BTYA 1CR7A 5I91A 3BG5A 3DPRB 4CSWA 3WDUA 4XLPF 1V55H 2F4OB 1O59A 1Q1HA 1P7JA 4LITA 5ABJA 2KQRA 3FFQA 3CCQI 3MDPA 2BTVC 2VI6A 4HVRA 2FMLA 5K7PA 2OUHA 3ZSJA 2M8GX 4KBBA 4E8DA 3W3CA 2A5WA 4MGIE 1TQPA 1B59A 1JHFA 2VCAA 1CF7B 4CDGA 2A71A 4W6WA 2VQHA 1CAWB 2YPDA 4ZU4A 3UJQA 2WS92 5SV8A 5KHGA 4GIQA 5IAVA 1D4M2 2OPTA 2NLRA 3SCHA 5FDBA 4NIDA 3EYYA 1FZPB 3I59A 4Q4V3 1WWYA 3S1RJ 3SH3A 2DFIA 5FY8A 4GH4A 5F08A 5DXDA 1OLMA 4BYYA 5I0RA 1FATA 1F15A 2YGLA 4YARA 1UAIA 5D8AA 1O4XA 1FMVA 3DLLF 4LO8A 4DYQA 3SFZA 3M8LA 1Y7BA 2PLV1 1G6NA 3ZPOA 4F93B 1LFBA 4M0NA 4JYKA 3KYDB 1W8WA 4I3PA 1JZ4A 3SYTA 4WX9A 1D0ZA 1Y8QB 2HDCA 5DAWA 2XVGA 4X0GA 4J1XA 2AHQA 4AYBN 3ZYFA 2XVKA 2MD0A 1AKHA 4CCMA 4B1MA 3EMRA 2XUEA 2XBO1 2DV9A 4CU9A 2V09A 5JLWA 3C2UA 4LHKA 2E5ZA 3C2BA 4EGYA 1FOD2 2BV6A 1UY2A 1WCKA 1F2NA 4Q2FA 2WLQA 1BVP1 2C5DA 1PZ8A 2VB6A 4HONA 3ETPA 3WF1A 1F31A 1POGA 4XOTA 3ZMUA 4R4ZA 1QDCA 2ARAA 3ZPYA 3M4FA 1RUF2 1RUF1 1RXGA 3VBFB 4YZ1A 3KMHA 2B7EA 4HLYA 4RS5B 1R58A 4RN5A 1U5TC 3BQYA 2QEXI 2R7FA 2VZPA 2X0LA 4HSLA 1U78A 3A0HC 4IXLA 4JCKA 5I8TA 4XLNF 4ESJA 4P9XA 1SFUA 2JN6A 5HLTA 1DG6A 3ZMVA 3S3NA 2UV1A 1LE8A 1O7FA 2D6KA 3E1F1 3KVBA 1ZG5A 2QQNA 4LNVA 1WJ5A 4FOWA 2C0ZA 4HRIA 1OH3A 4AVTA 2XHKA 1EH7A 4MOAA 1K83J 4MNUA 2D6MA 2L0KA 3RDIA 2VTXA 2VUCA 1YJ9I 1UZ0A 3OY9A 4BMEA 1IRXA 2GIZA 1H8TA 4BJ5C 3M07A 4U87A 1V6KA 3H5NA 4NE9A 4S2FA 3LA3A 3OPWA 3H9QA 2ZCWA 1C8M1 1B9MA 3F6VA 2BHZA 1YRZA 3GLLA 3LFKA 1ZZ7A 1JYIA 3FLRA 3H9JA 1OFSA 5F37A 5GLUA 2QF7A 2H1LA 2WS91 5L7OB 4EN0A 3CCSI 3C7FA 3VDXA 1PVC2 4MSVA 4XJ9A 3ZCOA 2DMNA 2UY9A 3V0BA 2ILMA 3PUAA 1K6OA 2RJKA 1RRJA 5FYHA 1OCCH 1TQIA 3J7ZI 4UUTA 4RSUA 3BU0A 4RHV3 1QF3A 1TMF1 3ABKH 1XJAA 4AAXA 4K1YA 3K1MA 1KQ8A 4HEA2 5FBJA 1FOKA 2NVXJ 1OXCA 3RPQA 1UZWA 5FR3A 4PJNA 5I0TA 3NKTA 5HXMA 5C3PA 1GNYA 4HNVA 2DCTA 2YU9J 5M5WJ 1GZWB 3AYAA 3BPSA 4KGQA 5E3LA 1SFYA 3B01A 3W5NA 4Q4Y3 3S0MA 5HPOA 1TTYA 3IT8A 2KIFA 2VTFA 2RNGA 5FTTC 1VP6A 2Y75A 4O9GA 3V64A 5M0TA 4QXCA 2EIBA 2W1WA 5FLMJ 4XDOA 5FPVA 4JKKA 5H9QA 1QQIA 1N1YA 1DQ5A 3QPSA 3MVPA 1IUFA 1HB1A 5IWFA 3IDEA 5LWBA 4XJZA 3VV1A 1D7PM 1Z7S3 2ZSHB 3OD4A 5E8IA 5BS6A 4TV7A 1JOJA 1SEFA 2NM1A 3HC7A 4BQ5A 4AVBA 2GU9A 2CWSA 2PBIA 2GALA 2XOMA 3OY8A 2WL1A 2K9QA 4QGLA 3FZVA 1TNRA 3MIDA 4M3CE 4CCCA 2BNOA 2DVAA 1JS9A 4Y4RA 5FZAA 1QHHD 4E7IA 4B4QA 2EV6A 4FPYA 5JOYA 1W39A 3DPLC 1JZ2A 2HWF2 3HRTA 5HLGA 1NCRA 1PIV3 2VNVA 1PO12 1WBFA 3ST7A 3QP5A 3WUCA 2WJSA 2MG4A 1GQGA 4IDZA 1W3XA 4HVOA 3RKWA 4XUOA 1HRI1 5DZEA 2ZGTA 4L99A 1ND2C 3KV5A 4IV1B 3PNAA 4CUCA 3FXOA 4MV2A 2ID3A 4IEQA 4Y20B 2GNTA 5H2FC 2W92A 3AVSA 1GWKA 3NVCA 4OIRF 1LJ9A 1XB4A 2YUSA 2DWRA 1GMMA 2NNYA 1R1VA 2JMWA 3K4ZA 4JGZC 2DCZA 3J7AY 2XL9A 3RQ0A 1LOFA 3GF2A 3RQIA 3GZ6A 3VD4A 1YLLA 1YC61 2J5PA 2VT3A 3BTLA 2XF5A 5FKMA 3MKZA 1NHAA 4MUVA 2EF6A 1ULFA 1BR1A 5FPAA 1J75A 2WYSA 4BQ1A 1R082 5DAXA 3HG9A 3LSIA 3K77A 2WV1A 4NAMA 4QKDA 2AQEA 4MO3M 5A3UA 2V9PA 4AI9A 2OQ6A 1H8TB 2XONA 1IUYA 2GC2A 4YW6A 3LDBA 1QJFA 3N7LA 2IAIA 2L54A 2ZKZA 1LRHA 5DCMA 4IHVA 5ACA3 5GZEA 5BYNA 4LJHA 5J40A 4WXDA 1S1AA 4PJMA 1JZ5A 2YDEA 4GFBA 5FZDA 5I0UA 1C5IA 2CFXA 2YBKA 3VBSA 1KA8A 1W2AX 1MEC3 3AFHA 3A0KA 3W5MA 2XQXA 3NNMA 4WZFA 4AQ2A 1FYLA 1NLSA 4JTOA 5DDJ1 3BR2A 5DD8A 2HTJA 4DO0A 2R1DA 3OR1C 3OGJA 3Q0VA 3WDYA 2RJLA 2DDBA 2EQRA 1IG3A 1EV7A 2XASA 3BTXA 3ZYBA 3JXSA 3VKMA 4EVIA 2CY6A 2VKHA 1LNSA 1U8BA 2DU9A 5ICEA 3K3OA 4HLXA 5B1BH 1EA3A 1LJ7A 4IHWA 5ABJC 1HW1A 2HOTA 1GP5A 3BTCA 4N8MA 2A61A 2BV4A 4XMIA 2BW3A 1MS3A 2GN3A 3J81Z 1Q8VA 4COYA 3LQCA 2A3XA 5JLXA 1YQ2A 1QRYA 1FNYA 5FMBA 1AR91 3BDDA 2WT0A 3EHKA 5JDBA 3AC0A 4PK4A 1K7AA 1IV6A 1QVTA 5D21A 2C9AA 3HQXA 1AXYA 4ZYAA 2QTWB 2NPIA 3CUQC 5F2SA 4AWXB 4LK1F 1SMVA 1VZ0A 2ZEXA 1RUG3 3M3IA 5HS7A 2CQXA 4KGGA 3KQRA 4AHYA 2XAGA 1J3PA 3AVRA 2ID4A 4PLNA 5FZEA 3H7YA 3MBWA 3ZYIB 2ZB9A 4HF2A 4WWCA 4QXKA 2DU1A 5C8CA 5BQTA 4QB2A 4JDOA 2VQUA 4RLFA 4NAOA 2R7UA 3A7QA 1IQDC 3H50A 1VF9A 1VJ2A 4WM7C 3LSMA 4EM0B 3HR9A 1VQ8I 2ZGSA 3SZTA 1DGLA 3KT4A 1SD4A 3KM5A 3O7OA 1DGWA 3GZEA 3THTA 1GP6A 3CCVI 5KAFC 1ON2A 3JSOA 4XUPA 1VI0A 3I58A 4MHGA 4PDWA 3WP4A 2WB1N 5LA1A 5FXVA 2VOPA 3F95A 1AOYA 4IEZA 2BHYA 3DYPA 5FY7A 1VBE1 2DOEA 3H0GJ 2PLV2 2DBNA 2G9ZA 3VDDB 4AU7A 1W5TA 2PEXA 3KSCA 4KBZA 2E34A 4AEMA 3I0TA 4OULA 4AFDA 1DU6A 3MPPG 2Q8OA 4BPZA 1US2A 4QPQA 4XFIA 2WY7Q 4URAA 3FE5A 2XJRA 3K6GA 4E7KA 1IXCA 1FPN1 3G3ZA 1MEC2 4AAPA 5FRMA 4OHVA 1B09A 5FROA 5BXXA 3UT0A 3WF0A 3PSIA 1H0BA 1SMYF 5K5RA 2BNNA 4DXZA 4RM3A 4N9IA 2PAKA 2XPUA 3ZFFA 4U7DA 5TGTA 5LA0A 4A3CJ 3ABTA 1WPKA 1QXRA 1JZ6A 5LLQA 5C4XJ 1RESA 1ZZ8A 5GLWA 1WMEA 1APLC 3VWBA 1W04A 4F91B 5KHJA 2HEYF 2WNUC 1J2XA 4FAGA 1AX2A 1GKBA 2RR11 5EZGA 1VQNI 4NRQA 4A6EA 1YE9A 3LQRA 4B09A 5AVPA 3MN2A 4HQEA 1OCRH 2W5FA 3ABMH 5IY5H 1Z3YA 1GUIA 5BPXA 1AA7A 3FHAA 3J9SA 3G1MA 3WR0A 2VC9A 3BC8A 1JUHA 5A3PA 5FD5A 3BB6A 2B7YA 2E36A 3CO6C 3GCMA 2IFWA 4L0PA 5ERLA 2RM22 4H7LA 5HODA 2A6ZA 2JRMA 4FPOB 1D8JA 4Y5TA 2NOJB 4C9YA 1KITA 4OI2A 1PO22 5GP9A 4W8JA 4UY8I 1XNKA 1Y4WA 4RYDA 1OKOA 1XNTA 5KK1A 4IQJA 1GVJA 2RS12 3I2DA 3KIOA 4ASMB 4Q1RA 3TKYA 4AG4A 4BLIA 2Y2ZA 1URXA 5T52A 4YW2A 5J98B 3EQLF 4URTA 4V1PA 2GMEA 3ZSEA 3BT9A 1S0GA 1B6AA 2B4KA 2BBYA 4LHNA 3LF7A 1BI0A 1WJDA 2MW8A 2ERFA 1JZ8A 5F1RA 1SLIA 1RVF3 3CMMA 5JR7B 1WLTA 1XXNA 1O5LA 1PYVA 3MZHA 1N1TA 1WVRA 4GCVA 4LLNA 2VXZA 5DZFA 3WG9A 1ZR4A 4LG0A 4ARXA 1MBKA 1JGSA 1H30A 3EPZA 3UGHA 1PZ7A 4XR6A 3PNYA 2ZACA 2GNMA 2HI3A 2A69F 1VIWB 4RLQA 3IWFA 4B3XA 2PHLA 3N4MA 5IAXA 3QBQA 1OKQA 1XCVA 2WA3A 2CUFA 1FIAA 2HR3A 3FM3A 4XKBA 2OA4A 4ONUA 3ASOH 3TBDA 1P4XA 3WTVC 5HLHA 2HWE3 2LUWA 3N9OA 2D1VA 2KKOA 3ITQA 4PT6A 3OYWB 1ACCA 4HF0A 2LM3A 4HVQA 1U9OA 2E5NA 1GSLA 3DKQA 4NIIA 3CU7A 4LE3A 2A3SA 2FQPA 1IN8A 1ETXA 2DVBA 3F3XA 2ZFWA 2JSPA 4EJRA 2GH8A 1MS9A 2V4VA 1T38A 2WNUB 4RGKA 5F5QA 2V5DA 4JAAA 1VMFA 2R073 4XF4A 2E60A 2IS6A 2EAKA 4WK8F 2VXRA 1RUC2 1VRH3 2HWC2 1AYN3 3ABUA 4C2TA 3OBRA 1PM4A 1DGRN 3K3NA 2M3AA 1TME3 1W3VA 1S6LA 2J22A 3IPVB 4EN9B 3MAJA 1F36A 3HXLA 3V0AA 3X2QH 5JVTA 1YJWI 3CMGA 1S7OA 4AFMA 1HCRA 4D5FA 1GUUA 5LW9A 1SPPA 3S2HJ 3MYXA 1R1A3 2K9MA 3J8F1 2NS8A 2JDYA 3KEQA 2VOTA 1JTYA 3AZZA 2MYSA 3I2GA 2R7EB 3ZMOA 1CQTA 3UYJA 3WY6A 5L36A 4YGEA 5FXZA 2VIXA 3DEMA 3WE2A 4YELA 5DUKA 4YVSA 2IGOA 2XF7A 3HUGA 3PJQA 4G7ZF 1QY4A 1FIPA 2W39A 1XE8A 4KITB 1SD5A 2K0GA 4UVBA 1RNLA 1UX7A 3PVOA 2F5VA 3W2AA 1UAAA 2YX4A 1VBC3 4HYEA 2DK5A 1FC3A 4Q4V2 4Y1XA 2IBDA 4M9SA 2VUAA 1H0MA 3VL9A 1Z05A 4ARYA 4OVEA 5CU1A 5BNPC 1ALYA 4PI0A 2R7RA 5FMCA 2F5EA 1VB4A 1WJFA 2EAAA 3L2HA 1O4ZA 3FWEA 4H0EA 4BISA 4LLOA 5HCFA 1UELB 4Q0VA 2QBXA 4Q8KA 4JQRA 3GWZA 4C3IJ 2FD8A 4ZYHA 4E9KA 4K8FA 3O0XA 3VUOA 3SITA 3IM0A 4F7ZA 2RS31 1TQ5A 3L2QA 4BHBA 2PMZA 1VBA2 3WU2C 3ZFGA 1WBLA 3WP3A 1V4RA 1YLFA 2NRAC 4CDQC 4HA8A 3O3KA 1W6PB 3RZDJ 4X1EA 5J3LA 3QRFF 2VL8A 4UUSB 3U0ZA 3JTGA 2F4LA 3KX2A 3BTAA 1UW8A 4YWAA 3NWKA 4TWTA 2QQAA 3MO4A 2PHUA 2P2KA 3LFIA 2HWD3 1QOOA 2Z99A 3CDIA 4DJAA 3C2HA 4U36A 1BYHA 5CB7A 1UOJA 3SFIA 3B6CA 2QZ2A 5KC5A 4PQ9A 3SEQA 4M74A 4YG6A 4KIGA 2UWBA 1O3TA 1MD0A 1AXKA 1DBNA 5GALA 2CRGA 1AR61 2VUMJ 5JI7A 5L9BA 4K1ZA 3BR1A 4CU8A 3VBSC 4NIGA 2FSWA 4EV0A 3HIFA 5FZIA 4GWMA 2OZ6A 1HDPA 3WF2A 4C3HJ 3JU9A 5FWJA 3S3OA 2JECA 1I1EA 3R0JA 4M71A 2R7SA 4XBFA 1S0JA 4ZYGA 3D82A 4EATA 2EXIA 1GVDA 2FDKA 3WP6A 1IV8A 4Z92B 1W9FA 2PQ8A 4D94A 3DFGA 3R05A 3EETA 3ZN1A 1OC1A 1RHI2 5BNPA 4YFZA 1AJKA 2ZGKA 2AENA 2M4GA 5CKNA 4K3UA 2LALA 4AGVA 2IXHA 5C8CB 2O7OA 3H3LA 2WIIB 1MZFA 5JR2A 2CSGA 4C30A 1QU3A 2PJRB 4LBOA 2E53A 2ZNZA 1K12A 1QHDA 3GYHX 4OCTA 1S29A 4R1HA 4FTSA 4DUWA 1WLDA 1EV12 3GHMA 1IO2A 1KDMA 1Y3TA 2JD4A 4OWRB 2TBVA 3S17J 1GICA 4C90A 1BIBA 1COV1 1B72B 1X3ZB 3K69A 1SBDA 4NWWA 4CCLA 1UMHA 3MHZA 2WUHA 4JDNA 1SLBA 1RUOA 2MABA 2X53S 4Y1ZA 3WT3A 1ODDA 5EJZB 5I0DA 1L3LA 4PIYA 3MLKA 3F8FA 3K4CA 5CAZA 3FLPA 3JZVA 3WE3A 4LB5A 3I2IA 3U14A 4I76A 1FX7A 2M9HA 3VBFA 4M9ZA 4OQ9A 4UWDA 1M06G 2BPA2 5FP8A 2VQLA 2ZO4A 2WNVC 5GLVA 3CBNA 3ONQA 5D5WB 3LKJA 3WW4A 5D6EA 1YS6A 1SHWB 1G7YA 1WCUA 2XUBA 2R043 1IOAA 3OUIA 4PI2A 1GNHA 5KR7A 2OJED 4HANA 5FGMA 4IOAF 3KPHA 2IXJA 4XW3A 3DPRC 3U10A 3HOTA 2RDRA 3O8GA 2D3SA 2AEZA 1MQTA 2QFEA 4R4XA 3Q5FA 4PLOA 3O1UA 4PQQA 4LO5B 3QH7A 4IESA 2LC2A 2V5YA 2Y30A 5D5UB 1T6BX 4AOCA 2I74A 3UJOA 5E79C 2RMU1 3VOEA 5F6FA 2GNDA 1VQ5I 1CAWA 1PO13 2HNHA 1D1AA 3ZMTA 4SBVA 2VQGA 5A2QK 1HC8A 3KT1A 4AEDA 1VE0A 2EWNA 3ZR5A 3WGHA 3ACHA 5IT6A 3SHRA 2DFBA 2UU8A 3ZP5A 2ZAAA 1SD6A 3FBYA 1PK6C 3DECA 5FK8A 1LOGA 2HPMA 2VMFA 1FSEA 2EXHA 5HI0A 4IL6C 3C2GA 5JPNB 1NAEA 4A3IJ 4QWQA 2DT6A 3TP0A 3ZN5A 4GA9A 4O7XA 4QD2A 1MH3A 3TEYA 5K7FA 4OIOF 3ZRGA 4JGZA 1MJ9A 5C70A 1FT9A 4U88A 3VBOB 3WTYC 4R9BA 2HXOA 3ZO0B 1CPMA 1BVVA 2P3KA 4YVSC 1ZRDA 3JAMZ 4ZS3A 3V0BB 2LRDA 4LLGF 5DN2A 3HOSA 1UYPA 1MW7A 1B4AA 5FKOA 2QSGX 4UVAA 1MEC1 5F39A 1AX1A 1EH6A 3CJRB 3NMBA 5DPNA 2COMA 2EV5A 1V6LA 3EUAA 1UMQA 5JXHA 5EHDA 4LBJA 1GLNA 3HOUJ 3OYJA 1FYUA 3J80Z 2X85A 2E1MB 1GV2A 3ILFA 2B63J 3KLNA 2HVRA 4ITCA 4MGSA 3ELKA 4CEWB 4HBNA 3GJAA 1JW6A 1K5MA 1HA8A 3RIRA 4IEXA 3SCGA 1NY72 5B2GB 4XDQA 5DABA 2CHHA 5IHRA 2CV1A 4HL0A 2VJ5A 1VBE2 3VPRA 2ZXIA 2VZSA 3GCXA 2D44A 2R0QC 3MIHA 5F27A 4IV3B 4XLHA 2WRAA 5IK4A 1DLCA 5LK5A 4LB6B 2FZ2A 4XK4A 1S4CA 2W52A 1R1A1 3VZJA 3JCUC 3F72A 1OURA 2Y6LA 2JG9A 1XMXA 4E4HA 5JHUA 1BBYA 1GOGA 3B93A 2DYSH 5IYYA 4YGDA 4MGKE 5K7HA 2HFHA 3Q3SA 2RKHA 2E31A 1KZHA 2WAQA 3K1NA 1OFNA 3SCFA 3ZM8A 1IW7F 2LP0A 4AM3A 2YC2A 1KS5A 3V65A 2Q5TA 4RGUA 2YC0A 2ZZJA 4XFGA 4LMFA 1LOAA 4NHMA 1VQPI 1QU0A 3RZOJ 4QHZA 2I07B 2ZHMA 4QQ2A 5FP9A 4C2UA 4I3GA 3ZQGA 5D8AC 1TW3A 2VMDA 2DJNA 5T55A 4B1RA 3IMNA 1KGSA 1Z1DA 1KU3A 1X19A 5HOOA 3N36A 1ZX5A 2HWE1 1TG7A 5FLXZ 2O9LA 3MEXA 1AR92 3ECHA 4A7ZA 1MZ5A 3OPZA 4XFBA 3S93A 1V00A 3ACFA 3D5SC 2A5ZA 5DD4A 2RVAA 3OUHA 4QX8A 4IXAA 2JA7J 4L9NA 1ZZBA 1SCSA 3KETA 2O14A 3FMSA 5FMDA 3FUOA 2JUCA 5GKAC 1HJFA 5CFCA 5CFDC 3LQQA 3EXUA 3H1CA 1IRFA 2VKDA 1RMU1 3VKFC 3L2UA 3PURA 4H4KC 4UVCA 4OU0A 3U4XA 1W36D 1RZ4A 2AO9A 3K4NA 4FFHA 4XAEA 2RE9A 2Q1MA 1ZGWA 4I2OA 1YI9A 1POV0 1X9PA 5HVQC 3N9QA 2M2EA 3MKWB 4K20A 4ZTFA 1LQ1A 3AK0A 2KT0A 2WZR3 3SMHA 4MADA 3MIBA 1GP4A 2O3FA 4CCJA 2C1FA 3MUZ1 1TMF3 1RUD1 4P9YA 4QPWA 2DURA 4WF2A 1IG7A 3HGYA 4YG0A 1IQAA 3MICA 1X8MA 2ZGNA 1Z3XA 4QGMA 3O1VA 2OTJI 4BH9A 4YM1A 4XRSG 4XQFA 3REOA 3QACA 1JGGA 1EUUA 1N1SA 4YIFA 1WI3A 1BEV3 5FZOA 4RB3C 5ED4A 1TEIA 4Q27A 1ZYRF 1RI7A 2WLPA 2ZC2A 4K2EA 3H35A 3APBA 1C0WA 5LATA 5IVBA 2LTPA 2QKDA 4XQ4A 1W6OB 5FYYA 1DPRA 4JOMA 2Y6FA 4FPJA 1H8VA 1YX3A 3ZIXA 2QQWA 2CAVA 3ZDSA 1JUSA 2CG4A 4RAGA 1ZA7A 3OBTA 2XVLA 5C4WA 4IHYA 4N43C 2G9FA 3A23A 1BN5A 1EP0A 2VJXA 1ULPA 4FE4A 1ETOA 3AXEA 3HBKA 3USUA 1YQAA 4XFHA 3ZYGA 4BQQA 4MHUA 4YG2F 3LPFA 4D6RA 4XM3A 1IN4A 2L9SA 1RUG2 5FFXA 5CFCC 5FPZA 3L09A 3BPXA 2VXJA 2NMNA 1LOCA 1FPN3 2ZS6B 4IEYA 2YROA 4HSJA 1O91A 4W50A 3B73A 3DEEA 2ET1A 1Q5OA 2OZJA 4Z2AA 2JT1A 4MQVA 1GZWA 5T50A 2Y6JA 1DGRA 1TWGJ 1XPXA 4BM8A 1EAH3 1FOD3 4Y22A 1ENQA 2V1XA 5FYBA 2VCBA 2P3YA 5KHHA 4BY1J 3J26N 3VDCA 3HAGA 4AZZA 2QQPA 1S9HA 4A6DA 3ACGA 2F5FA 3NAPA 1Y1VJ 4META 3L2CA 4UNOA 3Q0UA 2CU7A 1U5TA 3C7EA 1MKMA 1QXJA 3CO2A 3ZMNA 3OYDA 4CCKA 2Q8KA 1XTAA 2F4PA 4RM2A 5FBZA 2HWB1 3CCJI 3DYOA 1RIRA 4NPRA 3LSPA 3JR9A 5ANNA 1X36A 2ATFA 3S2WA 3ZFGB 1CX4A 2VQCA 1UL9A 3A0BC 3ZOIA 3WU0A 3LGRA 1CX1A 4DBRA 2H8WA 2MEV3 4HETA 1WHUA 3AMMA 2A6WA 5F32A 2VONA 3JRDA 1AZDA 5L19A 3BOQA 3PVEA 3V56A 5CBLA 4CEYC 4XSZF 4D0PA 4RFRB 4EQQA 2VBZA 4ETSA 1RUI2 2CV2A 2ZGQA 2V79A 1PVC1 4BQ3A 3IKVA 1ULCA 2AH2A 4KIBA 1BR4A 2L2OA 4G6TB 4UFHA 4RAFA 3VBUA 1JUIA 2VVFA 1ZLKA 3F9KA 3L1PA 1ULOA 4O9EA 1BBT2 2VZVA 5EXOA 2Q2EA 3ZQIA 4PIXA 4WM7B 3AP5A 4AFAA 4KT5C 4XEZA 2D6NA 2VZ1A 3GFLA 3WW1A 4FQZA 2E71A 2VOVA 5K0UA 4XBLA 5A70A 2UYAA 1R093 2YXSA 1A3KA 5IVCA 3IAM2 3T4HB 2JG8C 4ES8A 1QOTA 3B69A 2Z3YA 1H1AA 3LAJA 5KHKA 1D3YA 5EZWA 3I54A 3FBIB 5JOWA 3CJXA 3BG9A 3ACIA 2RM23 1YIOA 1W2NA 4NC6A 3FF5A 1H2LA 2X1DA 3OOXA 4Y13A 3AG4H 2WN2A 2QQUA 1RKTA 2M0CA 4KG8A 1DFQA 3RZJA 1XSVA 1D5VA 2RS13 2Z42A 3WNPA 2HLEA 3TYJA 1XNCA 3HVDA 4JV4A 2PQQA 4AVVA 5FUPA 1HRV3 1MMGA 3OYMA 3CDZB 5JVGF 1UYYA 2G7UA 4M4RA 3DU6A 4A5MA 4HX4A 3ZXEA 5FUIA 3T1LA 1JODA 4R9CA 1EY2A 3HJEA 3T2TA 4BB3A 2HBTA 3P3PA 1RJ7A 4Z6YA 5IP9J 4HPKB 4HN0A 2JDZA 3RJRA 1BHGA 2XBO2 5K7ZA 2F4MB 1KYWA 1DDLA 2ZX1A 1P9QC 1FYMA 1E5IA 3F23A 3VDAA 4OUMA 3WNNA 2VQ0A 3I4IA 2HVQA 3LA2A 2VULA 1K5JA 2A05A 2VN2A 1QKQA 5D4SA 3IC7A 3BCBA 2FOWA 4RGSA 4Y1VA 5C3QA 3BALA 2X6OA 1XNDA 2R16A 3RKXA 5I0SA 2WZEA 2W94A 4Q26A 5KNLA 1NA1A 2VAUA 3OS1A 2LFBA 4UV8A 2WAOA 4V2WA 3ECOA 5DG1A 4BHPA 3G4SI 1VRBA 4XKCA 2F6CA 1HKSA 4EZ4A 1ZKGA 2MSYA 4BEHA 3FHZA 4ZYEA 2GDFA 2RDSA 2XKPA 4BDVB 3CLQA 3QYFA 1Y43B 2JKXA 1ASJ2 5IATA 2QCOA 3FIWA 3AKRA 2BFUL 1RUI3 2LRPA 2WC2A 3AB0A 4RA2A 2FCTA 1IGOA 3THPA 3BLYA 1CAVA 2ZMEA 2XHNA 1RUE3 2ZGPA 2JG8B 4ISRA 3N3HA 3DTKA 3HM5A 1OYYA 3I3EA 1R36A 4KIFA 1YW7A 3F8BA 2ZJPF 1Z7S1 1HDKA 1SVMA 4NHYA 1R1A2 1HLVA 2FMYA 4UW5A 1PP7U 1DZTA 3POSA 4BIFA 1KEXA 2QSHX 4WM8A 3WQBA 4AQ6A 3J7LA 2D5HA 4R9DA 2JE7A 1VBB1 3BODA 1VBB3 2QNKA 5J6XA 3K2OA 3LSHA 1WW7A 2DUOA 3H7JA 3S1QJ 2PN5A 1FI2A 1IPKA 4EN7B 4MIMA 1W6QA 2NS0A 3T08A 3CQOA 4UF0A 2CFOA 1C5HA 3ZMSA 1NH3A 4ZXEA 3I3BA 5D5XB 2JXAA 4GKYA 5FYMA 3VYSB 5GLZA 3GGLA 3M8JA 1QJU2 4RS5A 1DQ2A 1F1ZA 1W99A 3RMXA 4CPBA 2VMCA 2G4IA 3H5RA 2K3PA 1TT0A 2DFCA 2XAJA 1UKGA 2ZMLA 3MGUA 1YW8A 1K78B 3RZHA 2X4HA 1F9NA 1SD7A 3FK6A 1RUI1 2VW2A 4DS0A 4CDWB 1W0OA 5JMCA 1SANA 2Y48A 1ETVA 2W7NA 2QA4I 4ZONA 4OI1A 2GXBA 4QQPA 3TBIA 2VUDA 2LF8A 3CMAI 4M01A 1X2MA 3K70C 1HX6A 3IDAA 2FCUA 1BK1A 4GXLA 4FCAA 3GZTB 1R5ID 1BOBA 1JUPA 3H1WA 5FK7A 1MQTB 2BYVE 3CC2I 3NAPC 1YJLA 4V19K 4RR3A 2DI3A 1J58A 1C8M3 1W0TA 3KE2A 3DV8A 4IRIA 2R042 1OVSA 2OUJA 2VASA 3ATGA 3JD73 3TEDA 2HOEA 4XBQA 2F5CA 4WVMB 2BGPA 2UY8A 3IRRA 1LKNA 1ST8A 3ZSLA 1I3HA 2V9KA 2BVLA 4NRMA 1OYIA 5CFDB 3KB5A 4I7HA 2RQQA 2YHJA 3O8HA 3MF6A 3U37A 4Y3OA 4N4OB 3RSJA 4A3BJ 1G9CA 5L7OC 1EUTA 1CAUB 3CD6I 1HXS3 1IAWA 4CDUB 4B48A 4HDVA 1MBGA 1LR5A 5BNNB 1XQNA 3J7MA 4FPKA 3WQ0A 4ORFA 3T0BA 2IA1A 1KDKA 1XG1A 1D1CA 3NJZA 2XJQA 3HSRA 3FFZA 2DU0A 1A8DA 4KMQA 4DXTA 1D2QA 1EYBA 2P0WA 4QAWA 1OHFA 1LEAA 5FB2A 1HW5A 4Y1YA 3HL2A 3N05A 3WNMA 5IOZA 1MBEA 1RUH1 1X1PA 3WW2A 3HD8B 3AP6A 2XDVA 3A03A 2YY1A 5CIRA 3WTSC 1KQ9A 1YW9A 4DOUA 3I4MJ 4M3CF 2JIJA 4XFFA 5IVEA 2L7KA 3AG2H 4LG0B 4LBLA 2PA7A 1YQ8A 2DA6A 2X51A 2PHWA 1OD3A 3PIGA 3VEPA 2IJLA 4IE4A 3AKPA 1O3SA 1YO8A 2DQLA 1RIOH 5E88A 3CP8A 1XU1A 2BDRA 4EGZA 4HOOA 3RS6A 2WA4A 4NC8A 1ZBA2 2WNEA 1MNEA 3DF8A 1HSJA 4IJAA 1HB4A 1ZA4A 2D93A 2WKKA 5C5UA 4JGYC 1QPIA 2DCJA 3F21A 3WG3A 3B94A 2R7TA 3PJYA 3DKXA 1COV2 4J1WA 4YZ4A 2HYFA 2WV0A 1CQ9A 4P02B 1S7EA 1L7LA 2XSDC 3NL1A 4XMYA 5DDGA 1AR83 4YM3A 1JKOC 5I8SA 2DA2A 2C6YA 4HKWA 1FP1D 2IA2A 2XLGA 1REEA 4BQOA 1DU3D 4XMAA 1RUD2 2M8EA 1SVLA 3Q8EA 3CCUI 2P6SA 2KHMA 4YIRX 2AREA 3W20A 4RGXA 2NQYA 5FYZA 4X6RB 1N75A 2WT1A 5FFZA 4UBHA 1RHI1 3OS0A 1LCLA 2WZ8A 1DDNA 4F3QA 3E3VA 5FZOB 3C1DA 3I5UA 3C18A 2B39A 2PTMA 4AQTA 3V0AB 1GV5A 3M3EA 1D8KA 1RUE1 1W8HA 2VPVA 3WUDA 3I59B 3BPZA 5DMYA 4HX8A 2QGUA 1QJY1 2CAUA 1ZBE2 1F5FA 2PHDA 1LEDA 4CU6A 3WHUA 3TW6A 1E57A 3OEAA 3RZMA 1YTYA 1RITA 1VAMA 1J1TA 4FBFA 3HUGB 4XZUG 2QZ3A 1JU4A 2E33A 3P5BA 1EAH1 2IXLA 2DUQA 3PHMA 1I39A 2A3WA 2ADDA 5J4VA 4MGQA 1U0JA 2K4BA 4HFSA 2JUGA 1YXWA 3IH3A 3DEUA 3OYGA 2D5VA 4AIHA 4U7BA 5GZCA 4KQ7A 3M1EA 4QX5A 4OMZA 4KMUX 1TW2A 2JWTA 1CGPA 4I02A 3V7CA 1RVF2 5HCAA 1BMV2 4XIKA 5C9AA 1JYNA 3DPTA 2VR4A 1CONA 3VD7A 1OF4A 3JW4A 1H8TC 2VCCA 2KJBA 3WU1B 4XN3A 4L2NA 5JVVA 1XB9A 3ABZA 4LBQD 4Y26A 5FWEA 5BPDA 2XLFA 1FNNA 4KNCA 4CYDA 2ORZA 1E3HA 3CZ6A 5J8CA 3L9JT 2XAUA 2UWMA 3QPTA 1OPOA 1PMJX 4XC9A 1OQDA 4ANJA 2VY0A 2LY2A 3AL6A 2CUEA 4O6JA 1WFXA 4YFXF 1YJKA 1W6PA 1NCQC 1TNTA 4HZFA 3U9GA 1KQRA 3WTTC 4JKMA 4LORA 4AI2A 3LSRA 1EPZA 5F0HA 4AVAA 4NDLA 4NMIA 3J80K 1WGXA 4YM2A 2ARXA 2TNFA 1R4MB 5FLHA 3OYHA 2WYFA 4D7MA 1UCXA 2KMUA 2X1EA 2VNRA 4UUVA 3VBFC 4HV5A 4FT8A 3EJKA 1V9U1 2WINB 2IS1A 2ZGMA 2MPFA 3POBA 4XSXF 1BEV1 3J4UH 1V5FA 1OLTA 1DYPA 4RQPA 2A7AA 4YW1A 1AYM2 2QBYA 2LTNA 1LTEA 4B3NA 4FO9A 2K5CA 5HCBA 3JAMK 1YHQI 4M3GA 2AYHA 4AFBA 3MW4A 3GZAA 4I98B 4OQ8A 1IS5A 1Y1WJ 1YNAA 5L9VA 4HQMA 2MGQA 4EROA 1RINA 4EWDA 3QCWA 2CDPA 3LWFA 5J37A 2J5OA 2D2WA 3BG6A 3AMHA 3O2PE 2E1NA 4LUKA 3OYNA 3ACLA 4FOQA 1G2HA 4L8QA 1DZRA 3AM2A 1D4VB 5H6QA 2GP5A 1I9RA 4L92A 4LHLA 1V9U3 2EINH 3BG3A 4NC7A 2ZEYA 1JJ6C 2RDNA 1MNDA 1C8NA 2QJVA 1LHVA 2JPBA 5I93A 3NV2A 2ISYA 4JZRA 3S8PA 3H1YA 2J42A 4PJ0C 2IS2A 1OPMA 2Z1DA 1TQMA 3MUY1 2JDAA 2FMDA 3GZUC 3M1CA 2D97A 4KU8A 2V6CA 4JX0A 3AKZA 3LA7A 1T95A 3AG1H 3WEZA 3WQ7A 2C4XA 3HTSB 1QNTA 3UNGC 2MH9A 1UZVA 3KLOA 1AR71 1IDZA 5D4RA 2E7AA 2ZMNA 2O0OA 3K2AA 5D2AA 2ZZQA 4XLFA 1X82A 3VHPA 2EV0A 3GF6A 3H9AA 4R52A 4DYRA 5E8GA 5E1XA 1J0RA 1R22A 4UW4A 4QDSA 5HV0A 3CUOA 2R5YA 2VPLA 4XFCA 2VMHA 3OTFA 4XAAA 5C44J 3K4KA 4Q0UA 3GXOA 3MFAA 5FO7B 1HQNA 3O12A 5EDNA 3OSFA 2GN7A 4H14A 1GYKA 5A3WA 4DUVA 1R6RA 3WG1A 2HVSA 1OCZH 4XCBA 3VFZA 2Q1FA 2L7MP 1UXZA 2PMHA 4JQTA 5G04L 4GB33 3HPNA 4DRRA 2E2HJ 3NQOA 1UOFA 2DW4A 2V1DA 2NXNB 4HSTA 1R7JA 2V4JC 4D0QA 5LRSA 2DCEA 1A6QA 5M5XJ 4HMZA 1C57A 3LDRA 4D7TA 2WFF3 4XJAA 3MMYB 1G3SA 4GXOA 3GTKJ 1H89C 2LF7A 1BEV2 4E4DX 4CA0A 3S57A 1XPWA 2AC1A 3PUQA 2Y31A 3AKTA 5CG8A 1P7IA 1LFPA 3EO6A 3TL4X 3EB7A 4IEWA 3GCWA 1GFF2 4L0ZB 2FDHA 2LMDA 1U2WA 1MACA 1CZTA 2XC7A 1RHI3 2V72A 4L97A 3OGGA 4P08A 4D6QA 4CDWC 1B72A 2VODA 1CVNA 3AL5A 1WA6X 1FMD1 1ZREA 2DOFA 1MMSA 1W6NA 1QOSA 2P37A 1EV11 2G19A 3A0NA 4I0WB 1L3JA 1OR7A 2FNAA 2VE8A 1WJCA 1T2KA 3OPTA 1TNSA 1LKXA 3EUHA 2E9QA 5EEGA 5TISC 5EFUA 1I27A 4AXOA 4G12A 2IS4A 1K45A 2QQMA 1FBQA 4OI0A 2X6XA 2FJ1A 3OGSA 3VZMA 1ENHA 1QJX2 4J19A 4NPLA 2L9RA 3AP7A 4ZU7A 1MS1A 1QPMA 3MZ8A 3DYMA 2MC3A 3FHQA 3WGGA 2CGNA 4E2QA 4IEOA 5KVRA 1JOBA 2L7ZA 3CDHA 3G1OA 2R063 2CH0A 1ERDA 5CFCB 1NOVA 2EFQA 3H8RA 4XTMA 1HRV2 2ZGLA 1W7PD 4B43A 3OEBA 3K1PA 2K9NA 1DQ4A 2XPVA 2JDHA 2STTA 2D5FA 3PU3A 4G4FA 1EAH2 1BCXA 4MEXF 5DUWA 1M1EB 4NROA 2FX0A 2VECA 2CW0F 1RUH3 2P7VB 1PGW1 3HOXJ 1BI1A 4KI5M 2KPMA 1R00A 3MI8A 1DGWY 2XV4S 1RUJ3 5CZKA 1F4KA 1ZBE1 1Y39A 4M3DA 4ESBA 5GLTA 4GD4A 1K4SA 2HU9A 5HNFA 3H0DA 4QKFA 3DLAA 2GC0A 1V54H 1B9NA 2E1MC 1LEMA 2QDRA 1JYWA 2YPRA 5IT9Z 4PJYA 1UZCA 1GANA 1BK0A 2A07F 3I2FA 3SLIA 4EE2A 3DTIA 3FISA 4BQNA 3VDDA 1KFUL 2CMPA 3KCYA 4F3JA 3ZXKA 3LMMA 1BM9A 5K5QA 2QQLA 1HV1A 3SJMA 4E7HA 3U1KA 5FJ8J 1OBNA 3CCLI 2R7DA 2XUMA 1PVXA 1HN1A 1OYWA 3A1YA 5A7QA 4JBAA 1E3OC 4XABA 5J1UA 3CCMI 4KL1A 2XRNA 2X5IA 3NNFA 4NBQA 1A8MA 2HH9A 4LMYA 5C6CA 3UKGA 2PI0A 4XHBA 4A42A 1ND2B 4H55A 4DUXA 4IEPA 1RTVA 4AD9A 2JVHA 3V8KA 2NMOA 2LDUA 5FKBA 3QYEA 1BBT3 3CC7I 1BA5A 2WAQN 5I8YA 1OQ1A 4G6QA 4BACA 2CQQA 1WKYA 2G1MA 2VKEA 5D1IA 3BR3A 3ZDVA 4MFEA 1GBGA 2DJIA 5KXEA 3WLUA 5FZ4A 2H27A 4WM8B 3N7MA 4IF4A 1ZBA1 3E6DA 3WDTA 3VBRB 3I55I 5FRNA 3CP2A 3S2DJ 1S3JA 4IQ4A 3GUDA 1JKRC 1UPIA 3DXJF 3S6PA 1OH4A 2GMMA 1OA4A 4FXKB 3RPUA 2DFFA 2CW7A 3QODA 4MXVA 1F5TA 2OA2A 1UMIA 4IE0A 2DT7B 5ABJB 3AXDA 4ZZDA 3LWCA 2QQ9A 4LTAA 1TME2 4A6OA 4XDPA 1ZGAA 4A0ZA 4E6KG 3ZSKA 1KRIA 1WZXA 3C7GA 4BJ6C 3P5JA 1MMAA 3VD3A 1G3TA 5EF6A 1O7LA 1G59A 5AFEA 4YFWA 2H0VA 1RPWA 4NIAA 4JC1A 4CDWA 5J47A 1RUC1 2HWC1 4AEDC 1UOBA 2ZX4A 1X1CA 1DCSA 4PBOA 3I2OA 2KDOA 3DWLE 5F3GA 3PTRB 1JYTA 1W2OA 4RMNA 1SFPA 1XNBA 4BU2A 5HNHA 1YHFA 3B9CA 4ZJZA 1OI6A 5HLIA 2JG9C 3KP6A 1IJWC 4OHXA 3T8RA 4TYSA 2K4JA 4I99C 3TN91 3LSGA 3QH6A 3LEKA 4KDPA 2EICA 4DFSA 2YYOA 1LESA 5BNPB 2K9SA 2BW8A 3HN3A 3VHRA 4IE6A 1H9PA 2KRFA 4CCOA 4CCEA 4YM0A 4ABZA 1WKMA 4QX7A 3QWLA 2Y9YA 1ULYA 4BQYA 4WM7A 5C3RA 3FBMA 5F9TA 2D6PA 1S0EA 1USSA 5C9AC 3DCQA 2P5LC 3O1MA 1QH7A 3JQXA 3WZ1A 2UXXA 1Q8SA 3VYRB 4XLCA 5FQ0B 4AYBA 3AZVA 5FP7A 4Q4W3 2JA8J 3R4KA 3LSJA 2NZ9A 1SAUA 5JXGA 3BP8A 2OTLI 4L9JA 2Q8EA 3LOIA 1RR8C 2D45A 5JXJA 1WI9A 4MXWA 3TDZC 3I71A 3DCFA 1NG7A 2W48A 4Y1UA 1Q8OA 4KWJA 4LO7A 1U0AA 1Q8PA 2ETHA 3GYDA 4XJWA 2RDQA 1LB2A 3J7YJ 3BR6A 1KYZA 3ZQQA 2KXLA 1I3QJ 5FAXA 2DUPA 5F5AA 3WX5A 3CO7C 2HWF1 4FFIA 1UCRA 4Y22B 4R9AA 3LSDA 4ENMA 4UUSA 3K4MA 4BXUA 4A3LJ 2OCCH 4LKEA 3VZLA 5J7MA 3CJQB 2R7VA 3POYA 2ZMEB 3CLOA 3ILRA 4LUMA 1W8ZA 4N9HA 1YFUA 4RA0A 3ZVXA 1I3AA 3SZGA 3TQNA 1RUC3 1VRH2 2HWC3 1QJU1 1SBFA 4RAZA 4CZSA 2YSRA 2JIGA 4ITVA 1OLQA 3VYUB 1MNMC 3IIIA 2RQPA 2GXAA 1UY0A 3BIWE 3VN4A 2W1UA 3ROUA 4XLAA 5C7GA 2HYJA 3OWTA 1VBB2 3CEWA 1PMIA 1LAJA 5ILVA 2ZAHA 4CDXA 4A3MJ 3NARA 4XVHA 3I3DA 2RR12 4S2HA 2J1EA 2I10A 3S14J 2C6SA 2ME6A 2CW8A 4OHWA 1QH6A 3UNPA 2BZDA 2YBPA 5LHIA 5JIUA 2XAQA 1V70A 4BJ0A 4EN6B 2K27A 1QWRA 3G6EI 3NW4A 3R60A 2JZYA 4L9VA 2NOGA 3MFKA 4C0HA 1HLCA 1W6OA 4NVPA 3DXTA 3RGBA 1QJX1 3T30A 5EYYA 3USSA 3F22A 4FI9A 2Y0MA 2VNOA 4ZC3A 1ZARA 1F8VA 1COV3 1JE8A 4YSFA 5BNOA 2LKPA 4IEUA 3GJBA 3BOPA 2GIVA 3POGA 1BC7C 5LA2A 1E17A 1MR5A 2JSCA 5J8FA 4OMCA 2OV7A 1ENXA 4NUBA 2ZBKA 2OCEA 3E0JB 3RYPA 3VODA 3Q0WA 1DP3A 3ETQA 4DOZA 2W4SA 2OVUA 1NA1B 3O1SA 1C8M2 1T8IA 2YS9A 3ZFGC 3KEYA 2J1TA 3VKLA 1WJAA 4RGGA 4A41A 2DVFA 1QEXA 5EJCA 1ZYBA 1UU4A 3ZQHA 4XACA 4LD5A 4F8AA 3AZWA 2JDNA 3DEWA 4A3DJ 1G9AA 1HJGA 2B45X 2XVCA 3KGZA 3MQ0A 5E17F 3D0SA 1ZBE3 2G7HA 2W08A 4UW3A 3A4CA 5FPXA 1QJZA 1W8NA 2Y64A 1VMJA 1FV3A 1SG3A 1SVOA 3HT1A 3H8XA 4II2A 1RYYA 2W2IA 3ZX7A 2CYFA 1SAXA 1LFUP 3MPBA 2CGOA 3NWSA 5D5VB 1N77A 2DLLA 5FKCA 1ZZ6A 4ES9A 2DCYA 1U5TB 1HQCA 3SZPA 3WCRA 4L18B 4HOBA 2VJJA 2R061 4QPYA 1MZEA 5FZ9A 1DP0A 4XYXA 1ORKA 3K48A 1ULEA 1IN6A 3Q9VA 4DGWB 1IS6A 4ZDPA 3DN7A 4GWNA 1FTZA 1SEUA 2IT0A 3RCOA 2X1CA 3ZMDA 4O5VA 3DKWA 1YRNA 1MMDA 2RS33 4XJUA 2QCSB 2FUG2 2B9SA 2SBAA 1LUJB 4XORA 1XSXA 1A31A 4B4RA 4MHRA 4OIPF 5EEAA 4E2GA 4L9TA 4ZU5A 4IEJA 5K8SA 5E20A 1EV13 4NJ4A 5CKMA 1XYPA 3GEZA 1VMHA 4PZJA 4CUGA 1GT0C 2M0MA 1ZAOA 2IXKA 1YS7A 5FPLA 1S0CA 4NIHA 5E1ZB 3IL2A 2ZHKA 4Q4X2 5ERIA 3DBHB 4YEJA 4PHZA 1HIXA 2ZJ2A 3CIHA 4RB2C 1LHOA 4H3WA 5A3TA 2W1SA 4CYCA 5DZGA 3PUHA 3ELNA 3EYIA 3E6MA 2BOJA 3NSTA 4FPFA 4W65A 3IH2A 2TDXA 2O61A 2DA1A 1NA1C 3PIPF 2STWA 5HDKA 1JH5A 4L5JA 4GGGA 3G1LA 2WFF1 3I3MA 5AC91 2ZGOA 5K9YA 5FZ6A 1N25A 3RKYA 2JEMA 2ZGUA 3C7HA 5F3IA 1JT0A 2ZMKA 4DBQA 3POEA 1OA2A 3HJRA 3ZXFA 4GQ7A 4K7JA 4HN1A 3KFWX 2VZTA 1XSQA 2YU3A 2QKMB 1SDDB 2HYKA 2ZPXA 1HV0A 2EIEA 1UG2A 3HPGA 1WQ2A 4FHTA 4S2GA 1UN1A 1CD3G 4A69C 4CDUA 1AYM1 3CQZJ 2LR8A 1VBE3 1S0DA 1Q1VA 5FD6A 1ETQA 2GMPA 5FYVA 5GAHJ 2R071 3I53A 4O3MA 5A7NA 5FKKA 1NLRA 2BE5F 4BL0B 4LLLA 2R0FA 3BJAA 1K78A 2BEOA 3RYRA 1OR7C 3KF5A 2VD7A 1BL0A 3WW3A 5FPBA 4ZPIA 4RGRA 2QYOA 1KXGA 1D5YA 3U11A 1NCQA 1BJZA 5EGOA 4BZ4A 3VB2A 5CYYA 3OIQA 5KHIA 1TT5B 2A1XA 5B4XA 4KWUA 4QIWN 4IOCF 2ADUA 3KHBA 1MDMB 2GM4A 3VBUC 3SDGA 1RMU3 3EBRA 2WR9A 3RZZA 3N9NA 2OZUA 1U5YA 2G9GA 1GR3A 4RB0A 3BPVA 3AMNA 3DL3A 4QT6A 1RUG1 2WADA 2WT2A 1O4TA 1MJBA 2V7FA 2Q1ZB 4J25A 4BQ2A 3K51A 2PG4A 1LU2A 3BIEA 1DGWX 4N0BA 1N3PA 2B5HA 4XOPA 1PDNC 2RS53 2JE9A 1GHCA 1YEWA 2CQKA 2I8DA 1C1FA 3L7WA 1JZ3A 1MJAA 4HF1A 2HJIA 5HCHA 4AGRA 4KG0A 1ZRRA 2EIMH 2GNBA 3NNGA 3I2KA 1FJLA 1C4RA 5B3SH 5FZHA 4U0WA 3PQKA 5JI6A 2L7FP 2XJSA 3K7AJ 2CWEA 1TNFA 2VMEA 4IEVA 1W9SA 4BNCA 3T3YA 2N8GA 1O5UA 1ETWA 2V26A 3K46A 2Y6GA 4A6SA 5JSRA 2QVOA 1D1BA 4W1UA 1AYM3 1JTZX 2WQ8A 1VAKA 4E7SA 3L2WA 1NXMA 3HYIA 4HKOA 3JUUA 3IH4A 1RUE2 2J1UA 1IKPA 2DO7A 2MC4A 2PHXA 5ICCA 1F4AA 1UU6A 1W6NB 4JQFA 1NG6A 3U78A 2BQPA 3FC0A 3RJPA 1FWZA 3TO9A 1GXQA 1TMF2 3NNLA 3ASNH 2LY1A 2PYTA 3FHIB 5LRRA 2PHTA 2JWPA 2BVMA 2DCKA 4QDRA 3OOPA 5AC93 1ZTRA 3KV4A 1JYVA 2WWUA 2IVIB 1UG0A 2P6CA 5DQ0A 1XGSA 3E6BA 1O57A 1XU2A 3VBOC 1K6YA 3OYFA 4XETA 1HKDA 1N3OA 1FY7A 3BZCA 1XMKA 5JI9A 1SFKA 4QLCU 1R49A 1D4M3 5L3BA 1WWXA 1X1DA 1REDA 5EIYB 4W6YA 5DUXA 4HKLA 5T5PA 2FBIA 3T0DA 3QLQA 2P4EA 4L5IA 3KZ4C 5FOBB 4B7EA 5KBFA 3WHTA 2DYRH 2IUWA 1R4NB 4B47A 4H2AA 4D7YA 4P1WA 3ZSMA 3OF1A 2DPUA 5L3DA 5FKNA 3HMYA 1OCTC 1IS4A 3T2PA 5ILUA 2CTVA 4KJZA 2M7BA 1YFYA 1IS3A 4NO4A 1OJLA 3HTUA 3VHNA 4BLJA 4CZZA 1BW5A 3NV1A 3GO5A 4KH9A 4ATFA 1AUYA 2QUOA 3I3QA 1OUXA 1ND3C 3HQUA 3ORJA 5JOZA 4NN0A 4XLEA 1R9TJ 5FXXA 3LPGA 1GOHA 5FP3A 2IVMA 4G9YA 1H4GA 3EUKL 4P9UA 3MKYB 2MLGA 2M30A 5F3EA 3ZFEC 3RG0A 4BE1A 2DFEA 4COVA 4QTRA 3T4VA 1V0AA 1A6CA 4XILA 2L3DA 3SKJE 3TB0A 4Q4W1 2VOKA 3ENRA 2LYCA 2VJ4A 3VHOA 3DXUA 1LODA 3KP4A 2LBFB 1WCMJ 1QJY3 3RYKA 4ENJA 3NQHA 2FDGA 2WN3A 4V2FA 1ZVFA 2EALA 4Z1VA 2EZKA 2VZ3A 2IGNA 4Q0QA 2ME0A 3JB4C 1GQHA 1NUKA 1CF7A 2HYXA 3CCEI 2BGCA 1WMDA 4CE8A 1LHNA 4CDQA 1NK2P 1WH5A 3D5OA 3PM1A 1EF4A 5JXIA 1CAVB 4QX2A 4M9XA 2RMU3 5GAGJ 1T98A 1WJEA 1ODMA 4RBOA 3OIOA 2K9ZA 1R083 2E7TA 4DMIA 1NZCA 1BOAA 2VMGA 3IZOA 2AR6A 2VBBA 2M1BA 1MIJA 3S16J 1SMTA 2XB6C 2Z33A 5FZFA 3HQRA 4LG3A 4YFKF 2A5YB 2MLKA 2IWGB 4F83A 4A2UA 1PGL2 1Y9GA 1FAYA 2NN8A 4AW7A 3AYDA 1R1TA 1H6XA 5FZKA 2I45A 3OMYA 2ISZA 2GC1A 5D8KB 3ZXSA 2UYBA 5FMOL 2PELA 2R49A 5LBEA 2XPJA 1Y9QA 3HT2A 4C1WA 3OYLA 3DBRB 3TOAA 1ZZ9A 4XRFA 4CU7A 5AC92 4I30A 3BUCA 4LULA 5A2QZ 3LDKA 4MEYF 4MTDA 1NE4A 1ZBA3 4FP3A 4BHCA 2VLAA 3CHXA 2XG3A 2XJVA 2BVBA 3AKSA 2VVDA 3ZYPA 1G3WA 3WNKA 4B7KA 5DDJ3 1S2KA 5J1XA 4FCYA 2P6HA 3Q8BA 3O1RA 1MS0A 2EFWA 1QGPA 2JENA 1BJAA 2GA1A 5CEHA 3PFIA 1R092 4PGGA 3LEMA 1SC7A 2OS2A 4UV9A 4QPOA 1Z9CA 3QU6A 2EA2A 1ENSA 2VU9A 1L7RA 4UB8C 1KJLA 2OT7A 2VQAA 2PJPA 1AJOA 1CAUA 2QBYB 2UUZA 4QU2A 2CS3A 2BVVA 2UWAA 4M3CB 2FD5A 4COWA 5CVVA 2VVEA 1X1BA 4IW3A 3RZLA 1AL21 4Q29A 4IV3C 3M4OJ 5C3OA 2HQNA 3ZFFC