2FMYA

Co-dependent transcription factor cooa from carboxydothermus hydrogenoformans (imidazole-bound form)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
ATQMRLTDTNLLEVLNSEEYSGVLKEFREQRYSKKAILYTPNTERNLVFLVKSGRVRVYLAYEDKEFTLAILEAGDIFCTHTRAFIQAMEDTTILYTDIRNFQNIVVEFPAFSLNMVKVLGDLLKNSLTIINGLVFKDARLRLAEFLVQAAMDTGLKVPQGIKLELGLNTEEIALMLGTTRQTVSVLLNDFKKMGILERVNQRTLLLKDLQKLKEFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords carbon monoxide oxidation system transcription regulator Coo
publication title Crystal Structure of CO-sensing Transcription Activator CooA Bound to Exogenous Ligand Imidazole
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Dna binding protein
total genus 67
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fmyA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2fmyA01
5K8SA 2K02A 3PLQA 3CUOA 5FLJA 2BGCA 4IEUA 2LNBA 2GWRA 3BDDA 3R60A 4I01A 4P9GA 3WE2A 4LMYA 4HN1A 2HKOA 1O57A 3HHHA 4WCGA 1NZCA 2P6SA 2QUFA 2PHLA 2A6EF 4P9FA 4YG2F 4LG0A 4EM1A 3FX3A 3JTHA 2GU9A 1IRGA 3C1DA 4M6YA 4XF4A 2RC4A 3DEUA 3IWFA 1H1MA 2G7HA 4QX5A 4JQFA 4NQWA 3R4KA 3J81K 1OPCA 1XSVA 1HW1A 1TLHB 4L5JA 4IEQA 4IXAA 4NB5A 1T2KA 3EO6A 5C6CA 5AVPA 1O3SA 2DFIA 4CHUA 1FBQA 4HZFA 4LLNA 4Y13A 1ZNPA 4OU0A 5KHJA 2HZTA 4WXHA 4A5NA 1O7LA 4LFUA 3EYIA 3WW2A 1IN5A 4IVNA 2XV4S 4LD5A 1T6SA 1O3TA 1S7OA 3E5QA 1S6LA 5LHIA 2FNPA 3E5UA 2GAUA 2BBYA 2IXKA 2WV0A 4R1HA 3GUDA 3JAMK 5FPZA 4L11A 4XLNF 5BS6A 4MX3A 1NYWA 2P8TA 2IPQX 3IRQA 3I54A 5J48A 3GXOA 4U7BA 5T3NA 2V9VA 5L3DA 4LG0B 3U9GA 4BYYA 3K1MA 1W4MA 3M9AA 4RAZA 3BALA 3L9FA 3V4GA 2IA2A 3HOTA 3KMHA 3VB2A 4KL1A 3F72A 4CDGA 1O4TA 4MEXF 3TGNA 1SMTA 4OMZA 1OD5A 3KEQA 5D1IA 2IA0A 1O5LA 1DZTA 1HW2A 2IJLA 1RUOA 3SCFA 4QMAA 1YFYA 3R61A 5H6RA 4AVCA 1P6RA 5I8SA 3IKTA 2PLYA 4HVOA 5I8YA 3CF6E 3P9CA 3PNAA 3SHFA 2Q0AA 5CLSA 3ZMUA 3KGZA 5KHIA 1ON2A 4KUMA 1R22A 2MNGA 1BJAA 2HDCA 3TO9A 3H7JA 3FXRA 4M9SA 1BI1A 4HLYA 3CJXA 4GO1A 4M6XA 5JHUA 4AQ6A 2OPKA 3JTGA 5FO5A 1DDNA 1XGOA 2EFNA 3CJNA 5JCTA 2HQNA 1IPJA 3EUHA 3P7NA 1FLIA 1J3PA 5D5WB 4I09A 4BIFA 2X0LA 4ZYDA 3HSRA 3TOBA 3WG9A 4S04A 2JSCA 1XMKA 3K1PA 1ZRFA 4HSLA 3RPUA 2VONA 2DBBA 1W5SA 3ABUA 3L00A 2MLGA 1LRHA 2O1QA 3MWMA 3VHRA 2Q8KA 1RIOH 3IIAA 3K0LA 4PCQA 4HLXA 3HRUA 3ZMSA 1KGSA 2XLGA 1K6OA 4XRFA 2V6CA 2KXLA 3V8LA 4L9TA 3OTFA 3KP6A 4R52A 4TLFA 1ZG1A 3T5XA 1F9NA 4YIFA 4KICA 4B09A 1R23A 3MZHA 2HYGD 2ZO4A 2OAZA 2ET7A 1I27A 3TKYA 5FLIA 1ZGAA 1H9TA 1SD7A 2EFQA 3QPHA 4JV4A 2XAJA 4LK1F 2A69F 3KE2A 4Y15A 5ICFA 3RKWA 5K5OA 3N97A 5LLQA 4M9ZA 1XSXA 3IC7A 1ZG3A 4IRGA 5ICGA 2XVCA 3JW4A 2UYAA 1Y0UA 1XRUA 1FYMA 1KYZA 2ZFWA 3MFKA 1U5TC 3HHGA 5HDGA 4EROA 3E97A 3WTSC 1GXPA 2PAMA 2RVCA 2JRTA 4IESA 4UVAA 1FP2A 3BJAA 2ZCWA 1ZRCA 3CEWA 3D82A 3F23A 5D8LB 1LNWA 3NVCA 1OFNA 4I98B 3LAJA 1XCBA 1F5TA 2D45A 5JVTA 3FF5A 4ONUA 5ILUA 3FJSA 1TTYA 1D8KA 4UNOA 2L01A 2CGPA 2IXLA 3VEPA 2KIUA 2XASA 2LDUA 3DPLC 2VN2A 3RIRA 2R3SA 2A61A 3ZN0A 1OYYA 2K4BA 1RL3A 3K1NA 5KHKA 4I02A 4ETSA 2Y0MA 3JSOA 3F8MA 2E1NA 2O8QA 4HF2A 1O3RA 5IT9K 2G9WA 3GVAA 3KLOA 3F8NA 2EVXA 2IA1A 2QM3A 3K69A 4YARA 2M1BA 2QYOA 3LA3A 5BMZA 3HTSB 1ZHFA 4WWCA 5LEKA 4UBGA 3OF1A 5E17F 4RGRA 4Q0SA 2LKPA 3S2WA 4RAYA 1Y3TA 2K7LA 4UXNA 4WZCA 4KMFA 1WKMA 1U8RA 2BNOA 5JI6A 4PJYA 2DK5A 4EV0A 4I3PA 4U7DA 4EM0B 4E2SA 5EFUA 1G3WA 4EQQA 4UHTA 1FXZA 2CAVA 2WTEA 1RC6A 1UW8A 5I0RA 2E1CA 2KJBA 2E7WA 4I0BA 2ESHA 5F64A 3WW1A 1C0WA 2X4HA 4KFCA 4KT5C 1WSUA 1KU2A 2PBIA 3LFKA 2K9ZA 4M74A 3H1YA 1B9NA 2GQQA 3TOAA 2HKXA 1ZAOA 2ATFA 1YFXA 5J7MA 3PQKA 4XF0A 5AIPA 1W7PA 3GFLA 4PZJA 3I4PA 4IEVA 3F21A 4PIYA 2WC2A 3QU3A 5CVUA 2RGVA 2XL9A 4P5OA 4YYOA 3U0ZA 1B1BA 4ZYEA 2PMUA 2P7CB 4IRHA 3GX4X 1D8JA 3QP6A 3I0TA 4HQEA 3I5UA 5L3FA 1PDNC 1O7FA 2A5YB 2ISYA 2DI3A 4FX0A 2DO7A 2O6GE 3U1DA 1SMYF 3RZZA 3OD0A 4ESJA 2K86A 2H09A 4UVBA 4XFFA 2EA4A 3TNQA 3H3UA 5ILVA 1D3YA 2I45A 4LTAA 1J59A 4O9EA 4GULA 2EAAA 3WU1B 1J3QA 4CGZA 5I93A 2IC1A 4UBHA 3PQJA 4JK1X 3GWZA 2DT5A 2P6TA 1MKMA 2Y75A 3ROUA 3I64A 2O8XA 2OQGA 1NHAA 4HSJA 3ECOA 3ULQB 1B6AA 1XCVA 3LQRA 2MHFA 4O3MA 4ENNA 1X8MA 2ZKZA 4HBLA 1W7PB 4GCVA 1SD4A 2D2WA 2COMA 4KIFA 1DP7P 1Z7UA 2OQRA 4OIQF 5DV5A 4HF0A 2V1UA 3I58A 4MGRA 3RKYA 2NRAC 5A2QK 3H8UA 1R58A 2H0VA 1PM7A 4MTDA 3WW3A 3H3ZA 3BJ6A 4HV6A 2FRHA 2H27A 1D5VA 3WTVC 1LDKB 3FXQA 2UWMA 1XDUA 5E1XA 2GA2A 3ZP5A 4PDKA 4A6EA 1OI6A 1ONVA 4Q47A 5DCFA 3WTWC 1U6GA 2HS5A 1GQHA 3HRSA 5E1RA 1TBXA 4ZU7A 1KA8A 1QQIA 3DKWA 1KQ8A 1PUEE 3IRRA 4WBBA 3CLPA 2VBXA 1BN5A 4Q0PA 1TQPA 4HV5A 4PIZA 3RKXA 1IZ1A 1DPRA 2K0GA 2GC3A 2BYVE 1H9GA 1RNLA 1NE4A 1ZZ8A 3NSTA 3EYYA 4L0YB 1J3RA 3F3XA 1KU3A 1YLFA 2XGXA 2A68F 3ERED 3ML6A 1JGSA 4MEYF 2EK5A 3LZZA 4YFXF 3P9IA 4KYWA 3CUQC 3QACA 3DXJF 3IKVA 4BHPA 2Z2SB 3EQLF 5FLHA 2A6HF 4MH0E 2O0YA 2J5OA 1RGSA 5ERIA 4RD7A 4HYEA 5D5VB 4JBAA 3EJKA 1BI2A 3G3ZA 4IEZA 1L0OC 3GEZA 4XEZA 4O9GA 4ON0A 4G94A 4L9VA 3FM3A 1FWZA 2IT0A 1ON1A 2AS5F 3TNPB 1WI9A 1Z6TA 1XDSA 1ZZCA 1QBJA 5E1WA 5JR7B 3ACLA 3WTTC 1J58A 4UV9A 5FD6A 4HDVA 4PGHA 1FP1D 1AOYA 4IJAA 1EYBA 5E8IA 3ISPA 1XB4A 2K4JA 1ZG5A 2STTA 1USSA 2OD5A 2KKOA 4DINB 2PEXA 4O5VA 2O61A 2ZJ2A 3NEUA 2F5CA 1TW2A 2W25A 3M8FA 4BH9A 2XHKA 2ELHA 4Q0QA 1XD7A 3FM5A 2XLAA 4IEXA 3R6SA 3RDIA 3BB6A 5CYVA 2DK8A 1CAUA 1YG2A 5LHHA 4RGUA 1Q3EA 2B8MA 4GYIA 2HTJA 2P5KA 2FU4A 2L3DA 4EJWA 3LA7A 1XMAA 2Q0OA 4GGGA 2HYFA 2EA7A 3WW4A 4Q5SF 4FT8A 2RQPA 2QJVA 1ULYA 4PGGA 2OA4A 3DL3A 5DDGA 2HR3A 5IT3A 2FBIA 1FX7A 1MDMA 1IN6A 2C0ZA 2ADUA 1RZ4A 4QLCU 3GO5A 2QDRA 3IDBB 1BBYA 1U12A 5HOOA 5CADA 2EJRA 3IDCB 4U0VA 2D93A 3IHUA 4B8XA 4BXUA 2VC0A 3MQ0A 1OYWA 4IPAA 4BHBA 4G9YA 3I53A 4XFHA 3GFJA 2DLLA 4E2QA 5DEQA 4A0XA 1LDJA 1SFEA 4CO8A 3J81Z 5HI0A 2XL7A 3GFIA 4RGSA 2HFHA 3T8TA 2CW0F 1VJ2A 1CAUB 2GC1A 1CGPA 1U5TA 2PA7A 3D0JA 3C18A 1NXMA 1QXJA 1UB9A 1WLTA 1H0MA 2XIGA 4ORFA 4Q29A 1U2WA 2H6BA 1XE7A 3EQEA 1Z05A 5BUVA 2IXCA 3VODA 2F4PA 5ED4A 3GYHX 1CF7A 3KEOA 4XSXF 3FFQA 5BPXA 3B02A 1K78A 5EEHA 1MDMB 3J80K 2W57A 1EV7A 5AONA 1V4RA 3RI4A 4YIIA 5D5UB 4K8FA 3JSPA 2M30A 4FBFA 1LR5A 3JAMZ 4R79A 1YWKA 2V09A 3S0MA 1YW8A 1STZA 4M9XA 1PP7U 3LQQA 1R1VA 1W7PD 3QOPA 4QWQA 2LF7A 3CO6C 5LGNA 3ES4A 5DD4A 4NHJA 4Q48A 1QWRA 4HF1A 1Z6RA 1QNTA 5D5XB 4ESBA 2A3SA 3FE5A 5L3CA 3OOPA 3HSEA 3KP5A 3FZ3A 2WWYA 1LQ1A 4EWDA 4PIXA 2V79A 1WQ2A 1G3YA 3O3KA 3K9TA 2MA3A 1ZVFA 2FXAA 1U5TB 4Z07A 2R7DA 4LA2A 1BI0A 3NQOA 1X8EA 1QGPA 3ZPLA 4HX7A 4GYGA 1JHHA 1FBSA 4KIGA 1IW7F 1ZZBA 4KU8A 2YX4A 3LA2A 2EFPA 1CF7B 2QQBA 4X6QB 2V1XA 3DP7A 2DAOA 3GFMA 1K78B 4HOBA 4RB3C 1S7AA 3BU7A 5FDBA 1UFMA 4OOIA 5J8CA 3DQVC 2MD5A 5HLHA 1MJBA 5E1ZB 1YFHA 2PQ8A 1WA4A 2IXHA 3K2ZA 1G4DA 4AIJA 2EFWA 3BZ6A 2L02A 3Q9VA 1ZGJA 1J75A 4BNCA 2PMHA 4M71A 1FSHA 4U88A 4FAGA 2XAFA 2ZMEA 4AD9A 2QLZA 3FHIB 2FOKA 4ZH4F 5LHGA 1R36A 2ISZA 4RGXA 1DGWA 3BPZA 1CAXA 2VT2A 1PMIA 4YRDA 3WU0A 4A2UA 3V7CA 5K5RA 2DQLA 4OMYA 3EETA 3GBFA 1ZZ7A 2EV5A 1YYVA 3HUGA 2BNNA 3EDPA 5FLXK 2MH9A 2KRFA 3F8FA 5CVIA 3COAC 1I1SA 4EWEA 4FHTA 5F6FA 4BHCA 2PAEA 4IRIA 2AXLA 1UIJA 4EJTA 5ICCA 4H7LA 2D1VA 2RV8A 2OBPA 2L4AA 4KWLA 4AIHA 4B29A 2XLFA 2FMYA 3CDHA 4OINF 5I8TA 2YX7A 4XFCA 1TNTA 4XSZF 1P92A 1DGRA 3ETQA 3SXWA 4EWAA 4L9NA 2UY9A 4MGIE 3RYPA 5LBQA 3CLOA 4EJVA 1QPMA 3ZN1A 4MV2A 4A5MA 5CVJA 2GC0A 4BQAA 3QAHA 4YFNF 2ZMEB 3HRMA 3CTAA 2XUBA 1YQAA 3HOSA 3N4MA 1CAXB 1ZLJA 2NS0A 1L3LA 1LEBA 3F6OA 3OV8A 3LSTA 2XKOA 4CYDA 3F8CA 3O14A 5D6EA 2CV6A 3SQNA 4XF3A 3GF2A 2D1HA 5DCMA 3IBMA 4LULA 3SMHA 2IW5A 2XAQA 1FNNA 4WK8F 1RTVA 4LJZF 1LDDA 1ZREA 3NJZA 3IL2A 3W6KB 1MJ9A 3L2CA 3JZVA 1EP0A 4KIBA 4M72A 1T39A 3D0SA 4AVBA 2CSOA 3S7IA 4META 3PFIA 1P4XA 2EFOA 5DD8A 2V1DA 3F8BA 4XF1A 5DUIA 3VFZA 5BXXA 3CO2A 2VPVA 3T0YA 1P2FA 2XAGA 1SQ4A 3E3VA 1RUNA 2GIVA 3I7DA 1I1GA 4H0EA 3BJOA 2E9QA 1HXDA 5BY5A 2O3FA 1MGTA 1EH6A 4ZU5A 4ZYHA 5IT9Z 5KK1A 1RI7A 4HVRA 4AVAA 2QBYA 1O5UA 5FD5A 5L3GA 3SCHA 2W24A 2FQPA 1R1UA 1X3UA 4CXFA 3ELNA 3I59A 1KQ0A 1IN8A 3ABTA 1XGNA 4K2EA 3G7DA 3MZYA 3CUQA 4P9UA 1IRFA 4ZU4A 3Q9SA 5TJJA 5DCMB 1R00A 2QCSB 3MPBA 2FEZA 2CWEA 3L09A 2KIMA 5HDKA 5HS9A 5DUKA 1OKRA 2PI0A 5CU1A 2QVOA 2ESNA 1TQIA 3E6MA 3HT2A 2VE8A 5H20A 3ECHA 1VR3A 3IWZA 1J0RA 2VODA 4MTEA 4KWKA 4XF9A 2Q4SA 2DQRA 1LJ9A 6PAXA 3H7YA 3I71A 1TQMA 3WGHA 2PQQA 5FCCA 2MH2A 4CICA 3C7JA 3CO7C 4EMSA 1HBXG 4MNUA 1GHCA 1IF1A 1GQGA 5LRRA 3WTYC 1LKNA 4X6RB 2F5FA 2ETEA 2DPUA 1P4WA 1UHWA 3WTUC 3D5LA 2D5FA 2BV6A 4ESFA 5I0SA 2IVMA 2YSRA 2QBYB 4IEPA 3UKNA 2MC3A 2E7XA 4UVCA 3FMQA 1EPZA 4EM2A 2EV0A 3I59B 3C3VA 4IETA 1SFUA 4WXCA 3CUQB 4AVPA 2P4WA 1ZARA 3HSFA 3REOA 2IP2A 1KU7A 4HDUA 4FAHA 1ZYRF 2BEOA 2C6YA 2OYZA 1P4AA 5L3BA 4BAYA 2D5HA 5HLIA 3AAFA 3TO6A 2HQRA 2VOOA 2CFXA 3SXYA 3KZYA 3EBRA 1HKSA 2ZBKA 2STWA 4Y17A 4J1WA 4CZZA 3R0JA 1FY7A 3Q5FA 2P5VA 1J9IA 1XSDA 1Q1HA 4A0YA 3LAPA 3TQNA 2F2EA 3TDUC 5H6QA 1I6XA 1UD1A 3S7EA 3F22A 2HEOA 3MYXA 4RB1A 2WFPA 2HOEA 2ET1A 1E17A 3H1MA 4KN4X 1OYIA 5A2QZ 3T8RA 1IN7A 3PVBB 4G8XA 3KGLA 4RB0A 4IEYA 5J3UA 1ZZ9A 1YTYA 1YS6A 1J7KA 2CQKA 2FSWA 1IAWA 4I2OA 4LA3A 4G6DA 4R8HA 1CX4A 4XLPF 4F8AA 4IHSA 1ODDA 4MGKE 3DN7A 4WX9A 5JAXA 2MPFA 1YLLA 4E2GA 1YW7A 1BI3A 3FWEA 4N9IA 2YPRA 4TV7A 5FFZA 2H94A 4LB6B 3WE3A 1HKTA 1R7JA 3FXUA 3ST7A 4LLOA 2NNNA 4LGWA 3T1BA 3MDPA 4MZUA 1BOAA 1W5TA 4LUMA 5I0TA 4G7ZF 3BCWA 1PP8F 1G3TA 4L18B 1E2XA 2VOPA 3OCPA 5D4SA 1J5YA 2FQ3A 2N7GA 1X82A 2EA2A 3BPXA 5BOXA 1FSEA 1ZLKA 3FZVA 4WF2A 5JSPA 4ZYGA 5ICEA 3NKTA 5FB2A 3FMSA 2B0LA 4QGNA 4XFAA 3OGJA 2PJPA 4JTNA 3KP2A 4HW0A 2QWWA 1KYWA 5J8FA 3ZMVA 4I7HA 3NRVA 5C8WA 5J6XA 2YU3A 5HLGA 3G73A 1HQCA 3BROA 2JZYA 4IEOA 2CG4A 3SHRA 5D8KB 3LWFA 2JT1A 1EH8A 4LUKA 2Q1ZB 3SFZA 5AIQA 3ELKA 3BOQA 5JFRA 5E18F 2RNJA 4GXOA 2GXGA 1T98A 4IEWA 2XRNA 1FBUA 1MD0A 3ZMDA 3RNSA 2HJIA 5JSOA 1K79A 2FBKA 2F5DA 5HS7A 1QO0D 3VOEA 5LGTA 1BC7C 4Q4ZF 3BP8A 5FGMA 4IERA 1WRJA 3QRFF 4L2NA 1F1ZA 2G7UA 3MEXA 3V8KA 2BE5F 2M8EA 2D40A 4JVAA 5HDNA 1XGSA 2PN6A 4QGMA 2FNAA 5TRDA 2VECA 3ZMTA 3QPTA 3RYKA 3LAGA 2GC2A 4G6QA 1XE8A 1YHFA 4XFBA 1L3JA 4LEJA 1TW3A 4WVZA 3UKVA 4S05A 3NW4A 3U10A 2YR2A 1CAWA 3UKTA 1BC8C 4MGZE 1REPC 1BM9A 2PAKA 2QZ8A 2QQ9A 1Z91A 2GH2A 2FA5A 1FI2A 4ENJA 1NE6A 3ZDSA 2H6CA 1R5GA 1DUXC 1SD6A 3O2PE 5HVQC 1CAVA 1J2XA 4LLGF 2IXIA 5I0UA 2EWNA 1S3JA 1XN7A 4L9JA 3M8EA 2BNMA 2QENA 1UHMA 1JUHA 4JTOA 2UYBA 2HWVA 2OZ6A 1UPIA 2NNYA 3KSCA 3M3IA 5HS8A 1ZRRA 2PFWA 2UXNA 2FE3A 1JHFA 2PFBA 2FBHA 4UV8A 2ZNYA 5KHHA 4EVIA 5JSRA 4P96A 2F5EA 1VP6A 1IXCA 1JXSA 1Y9QA 3RJPA 1HSJA 2DW4A 4OLLA 5FPXA 1G3SA 5K5QA 2FMLA 1X7NA 4HAMA 2QQAA 4U0YA 1I5ZA 1XGMA 1USTA 3KETA 2B5HA 4ENKA 4P55A 2MLKA 3H92A 1GXQA 3P9KA 2Y0OA 3L7WA 1TQ5A 4G7OF 3J7AO 5CVVA 1YS7A 2UY8A 3HRTA 1GVJA 2XKPA 2HTSA 2ZNZA 3GLXA 1LVAA 1CAWB 4OIPF 4ZZDA 4IHTA 3DF8A 2Q30A 2J5PA 2RN7A 1LEAA 2FF4A 3MCZA 1BIBA 3DFGA 2VBYA 4F7ZA 5EEGA 4QM8A 1R5HA 1FYKA 5LRSA 2K27A 1A04A 3FHZA 4ASNA 2Y48A 3QU6A 4MQ9F 1CAVB 4YNIA 3C3WA 2VXZA 1EH7A 1FYLA 3BWGA 2JTVA 2DTRA 2RKHA 4L5IA 5KHGA 3J80Z 3LWCA 5D4RA 4OFGA 4QM9A 1FZPB 5FFXA 3M70A 4UXAA 1YFWA 4D7SA 2UXXA 3ES1A 3E6CC 4OIRF 1HW5A 3V7SA 1T38A 2JPBA 3DV8A 2ETHA 2UZKA 1IXSB 2ACJA 1ZH5A 1MJAA 4LK0F 3RPQA 4RS8A 4EGZA 3EHKA 2PYTA 2OA2A 5K1YA 1BIAA 3RYRA 1G6NA 1FOKA 1O3QA 1SD5A 2B9UA 1QZZA 2L54A 2ZXJA 1YO5C 5BQTA 4AQ2A 4IF4A 3V7RA 1AWCA 1FT9A 2M45A 3KP4A 1Z9CA 4AIKA 2VBWA 3TO7A 3GW2A 3BPVA 3WGGA 4HVQA 2EV6A 2P7VB 4G7HF 2VT3A 3H9AA 2IRFG 3QP5A 2PTMA 5DYMA 2TDXA 1IUYA 3H1WA 1WWXA 3E6DA 1UCXA 5I91A 2QNKA 3HIFA 1YFUA 4EJOA 1Q43A 1V3FA 2LF8A 3KLNA 1SFXA 4DNCA 2Q2EA 1KU9A 5CJ9A 5LEJA 2EB7A 2Z9OA 4Q0VA 2CAUA 4I0AA 1S8NA 3U2RA 4UUVA 2XAHA 4EGYA 3GYDA 4DQ2A 5KBFA 3LOIA 5BV6A 4XFGA 3M7GA 3H50A 2Z33A 3KP3A 4U0WA 2RDPA 2KIFA 4KWJA 5D6FA 4KMUX 3KFWX 1QXRA 3ZQ7A 4J1XA 4Q0UA 2GZWA 4M73A 2M87A 2VC1A 1U3EM 3BY6A 3HT1A 3TDZC 4KA4A 2Z5UA 1QZYA 1HSTA 1V70A 4XBFA 3SZPA 4N9HA 1ZN2A 1IPKA 4XETA 1YW9A 4MGYE 1SAXA 4MHGA 2P5LC 3MAJA 1DPUA 4KNYA 1YUDA 1SEFA 5E16A 2KJCA 1H1IA 5FLXZ 3B73A 4LLLA 3KCCA 3V8JA 1TNSA 2Z69A 1T0FA 4A6DA 1JE8A 2M5WA 3FMRA 1Q5OA 1DZRA 2OZUA 1EY2A 3HTUA 4MUVA 4QGLA 1WGPA 4KN7X 2OU2A 4O6JA 3HQXA 1IXRC 1F4KA 3DPTA 3R0AA 1UCRA 4MQVA 5EZWA 4YFKF 2ZKLA 1UIKA 3HYIA 4NVPA 5E20A 2R7FA 2XROA 1ZZ6A 5L3EA 1VTNC 2P17A 2PG4A 4L0ZB 2L4MA 3SCGA 1OR7A 4A0ZA 3GZ6A 4WXDA 1IN4A 1FC3A 3F6VA 5FQ0A 1LB2A 3GZ5A 3O6BB 2VBZA 4AXOA 4HLTA 4HMZA 5E8GA 3SZTA 1ZX5A 5LGUA 4HA8A 1MZBA 2LSOA 1J1LA 4XFIA 4LB5A 3WGIA 4E70A 1B4AA 3KP7A 3CL1A 4ENMA 4HX4A 1B59A 2MBFA 2O03A 1S29A 1B9MA 2Z99A 2Z3YA 3WODF 2W85A 4HQMA 1FPQA 2W84A 1SFNA 4KDPA 4HN0A 2QVSB 4RB2C 4YSFA 2DU9A 5BPDA 4QXKA 1KQ9A 4Z82A 4D7TA 3USSA 1QY4A 5F1RA 2GXBA 2DCTA 1R1TA 2A07F 5CVRA 2VE9A 4HX8A 4N0BA 1K7AA 3ZMZA 3WTZA 3E6BA 2CO5A 4HBNA 2NYXA 3M1EA 4OIOF 3NL1A 2HGCA 2OZJA 4FX4A 2JPCA 1Z1DA 5FQ0B 2CYYA 1U78A 4KU7A 3WTXC 5KVRA 1OMIA 2NAZA 1YIOA 5ILSA 3KZZA 4ZZLA 2VQAA 4Z2YA 2DPDA 4D0PA 2PHDA 3E5XA 4A12A 1HKQA 3W6JB 2IXJA 2GA1A 4EJUA 4AWXB 5BPIA 3RTRA 5JR3A 1ZRDA 3L2HA 3U11A
chains in the Genus database with same CATH superfamily
3VWBA 2K02A 4F91B 2BGCA 4IEUA 1JKQC 3BQYA 3LIHA 1TT5B 3R60A 4B7KA 3LSHA 2HKOA 3LPGA 2IS2A 4WCGA 4D94A 1ULGA 4AHZA 4P9FA 3L2WA 2ZEXA 5DAPA 4M0HA 3JTHA 4GH4A 2R061 4ISRA 3IWFA 1IJWC 1AJOA 3QYBA 4NQWA 3R4KA 4IQJA 1OPCA 3ZMNA 4HK9A 2DA2A 3GCWA 4IEQA 2Y6JA 1W2NA 2WT0A 3AZWA 1UZWA 2VBPA 2KHMA 5C6CA 1YQ5A 1V5EA 1NCQC 1W8FA 2H8WA 5DDJ1 3BR0A 4LBLA 1YOVB 4BWOA 4OU0A 4WXHA 1UOJA 4A3GJ 1IN5A 4IVNA 1MMAA 2HEVF 4YVWC 3FHNA 1SBDA 3FXJA 1S6LA 2OQ6A 4K7JA 4E8CA 5FRAA 2IXKA 4Y24A 1VBB3 4PJLA 4XLNF 1NYWA 1NY71 2P8TA 5A3UA 1A78A 4QQ2A 3IRQA 3POIA 2GXAA 3I54A 4RHV1 2V9VA 2HXIA 2OCEA 1AYN1 2X1CA 4U87A 3EB7A 3K4AA 2G19A 2E71A 4DBRA 3M9AA 2XB5A 3L9FA 1Q8SA 3VB2A 3F72A 4CDGA 1O4TA 3KB5A 2IS1A 1WFXA 4MSVA 1OD5A 2IA0A 3CF2A 3RMXA 3ZSLA 2NP0A 3DGTA 4FFFA 4QU2A 4IL6C 3GLLA 5GADJ 4D8MA 4HVOA 1X1BA 1K5MC 2ZGKA 3HQUA 3Q0VA 2BQPA 2Q0AA 5CLSA 3OYLA 3TEXA 5J1XA 1UY4A 2I10A 1R22A 1HCRA 3BTJA 4I99C 2W48A 4YPJA 1LE8B 4HLYA 5LW9A 5A1AA 2GNMA 4ZHNA 3URFA 2VNVA 5FO5A 1XGOA 5JCTA 1E3PA 1ZKGA 5TGTA 5D5WB 4I09A 5CFDC 3R05A 4CH7A 1XMKA 4IE5A 3KCYA 4HSLA 3UGGA 4YRVA 4WVWA 3WF4A 3RPUA 3S2HJ 1W5SA 3L00A 2MLGA 5JOXA 4AAPA 3MWMA 4EQVA 3VHRA 1QHGA 5E3NA 3ZQFA 1O8PA 3AMNA 3J7YJ 3BR1A 3AJYA 2BHYA 3HRUA 1LOBA 1HRI3 4XQDA 2KXLA 3T2OA 3V8LA 4R52A 4CDWA 1KS4A 4MHUA 1R23A 4EN7B 2ET7A 1QU3A 3V0BA 5A7QA 1ZGAA 1CIWA 1SD7A 2K9NA 2XSDC 3QPHA 2A69F 4Y15A 4M9ZA 1XSXA 4BMBA 3KCXA 1X9PA 1Y0UA 5FP4A 1WJCA 1U5TC 1WJBA 1A6QA 4MYEA 3AFKA 2JRTA 1BW5A 2NYYA 4XLHA 2ZCWA 4E4DX 2OT7A 2K9MA 3CEWA 3ACFA 2CU5A 2ICWG 1VRH3 1YEWA 2KP6A 1UNBA 1FV3A 4Z2AA 2D45A 2WB1N 1QJU1 4DNYA 1FOXA 3FJSA 1KD7A 5CPRB 1WW5A 4UNOA 5ACA3 5B1AH 2CGPA 3GCMA 1SC7A 2NN8A 1X1DA 2M34A 3AP5A 3UGHA 4Q8KA 2XASA 1YJKA 2PLV1 4D0QA 4J00A 2A61A 1OOPC 4M4PA 5A7WA 4FPEA 3ZN6A 1HN0A 5IVBA 5KHKA 5FMCA 3PL8A 2SBAA 2M0MA 5GZEA 3K4LA 4C91A 2Y0MA 1FOWA 3SQOA 4FPLA 2O8QA 2VI6A 3KLOA 3S3OA 3HOXJ 2EVXA 5FZ0A 5BMZA 1ZHFA 4WWCA 4FTHA 1SLAA 3OF1A 3QCWA 3VB9A 2LKPA 1HXS2 4RAYA 1Y3TA 2K7LA 4UXNA 4CEYB 1GLHA 2W1OA 2EH3A 5F3EA 3K77A 1ASJ3 1LFBA 1EF4A 1FXZA 2L7FP 2CAVA 2WTEA 4QPQA 1S0FA 5I0RA 1DU6A 3M2MA 3CJIC 5F64A 4XLCA 1B8IA 2ZX3A 4BISA 3M3CA 4KT5C 3FBYA 2NVTJ 4M74A 2GQQA 2UV1A 1IO2A 3CZUA 1RPWA 1QJFA 1MS9A 4IEVA 5FXWA 4ASMB 4B1RA 2OCCH 2XL9A 5DAXA 1BVVA 4AYBA 2JDYA 4OAZA 4JGYA 3OYKA 1T08B 4WV8A 1KITA 4DXZA 4CEWA 3J9SA 2ISYA 2DO7A 2O6GE 2DDUA 4V2WA 3U1DA 5E79C 5F04A 3I55I 1XC5A 2W3JA 3ZPOA 1Z21A 2H09A 1MEC1 4RAFA 1IQDC 1A36A 4JDNA 4LTAA 1AR62 3ZXSA 4YGBA 5FP3A 3AK0A 4GULA 1LHWA 3WU1B 5A6XA 2VXRA 4UBHA 2KA3A 1RUJ1 2AQEA 3N7KA 4L99A 5KC6A 3I64A 4DB5A 2O8XA 5LD2C 4HSJA 1B6AA 1XCVA 2AREA 2JB8A 3HR9A 3KWVA 3LSPA 4AGVA 1HQWA 2RJKA 2ZKZA 1W7PB 5D21A 4DRRA 3TMOA 1SD4A 1VQ8I 2COMA 1DP7P 1Z7UA 3S16J 4XMYA 1S0BA 2QDNA 1POGA 3K3NA 3OGVA 2V1UA 3P1IA 4MGRA 5CFCC 1IS3A 3NJXA 3BN6A 3H3ZA 3VSLA 2WNEA 2FRHA 2QFEA 1IZ3A 3POEA 3PO3J 2WIIB 4AEDA 2ZHLA 1H8AC 5GAHJ 1UX6A 1ND2A 3ZP5A 4QPWA 4PDKA 4A6EA 4RL7A 1XMXA 3WTWC 1AZDA 2OUMA 2WABA 5EEAA 3HRSA 1TBXA 2M2EA 2LVSA 1KQ8A 3NJVA 3CLPA 1Q8PA 1ST8A 4LIVA 3LSKA 4E7KA 1ZGWA 3ZQCA 1DPRA 2WZEA 3WXPA 2HWB3 4GA9A 1BK0A 5JI7A 5FZCA 1N75A 4F93B 3LE0A 1NE4A 5DZFA 4PBPA 1OPOA 4HETA 4BQYA 5FYVA 5F39A 2ZMKA 4L0YB 3T2PA 4I30A 2XDVA 2A68F 3ML6A 3LZZA 5FV3A 5BNOC 1ALYA 3P9IA 3MZ8A 3TBIA 4HRIA 4A3FJ 3GHNA 5FLHA 4MH0E 3GJBA 3UV9A 2ZMNA 3T0DA 3NNFA 4Q4X2 1TWCJ 4RD7A 4HYEA 5D5VB 2CL2A 4JBAA 5HCFA 2Y8KA 2M7BA 1IQAA 1L0OC 4XEZA 5C4WA 2BRTA 4Z92B 1ENSA 4DOZA 4LOCA 2KDZA 1N77A 2NMOA 1FWZA 2IT0A 4LBKA 4W50A 5JR7B 2GMEA 1FMD1 3WX5A 3OGRA 4A3EJ 1J58A 2XJRA 4HPKB 2XVKA 1XE0A 4QX8A 1VBE3 2JE8A 4URAA 2PHFA 1FP1D 4DFSA 2ZGUA 5FZOB 3K4JA 1XB4A 2K4JA 3ZIXA 1ZG5A 3VBSA 3I8TA 4X6AJ 2OD5A 4XZPA 3AVRA 2H0BA 4DINB 3JCUC 2O61A 2ZJ2A 2CDOA 2CUJA 1LPQA 5GLTA 2DYSH 4CP9B 5KAIC 1W0NA 4YVWB 1H4HA 2W25A 2LD5A 1X33A 3M8FA 4BH9A 2XHKA 4D1QA 1D4M2 4E7SA 5EP9A 4FQZA 2QQJA 5LA9A 1OLTA 2BP6A 2XLAA 4KNCA 4EEFG 2DWRA 4IEXA 4Y1UA 2XR4A 3BB6A 5FZ4A 2V4AA 2DK8A 1CAUA 5LBEA 1RITA 1I3HA 3MFCA 5FPVA 2E36A 1HRV2 1EUTA 4YELA 4H4KC 4Y4YA 2P5KA 3L2RA 1CVNA 1B35C 2ZFUA 2EA7A 2KFDA 4JGZC 3WW4A 4GIQA 4UFHA 5T52A 4PGGA 3RFRA 3L2QA 3OYGA 1YX3A 3KV4A 2DU0A 1MDMA 1RMU3 4DEQA 1IN6A 1COV3 2W08A 2YFZA 3RZJA 5CBLA 2A6WA 4AVVA 1RUF3 4BXUA 1K5MB 3ZFFB 2H8RA 1OYWA 4ASKA 3CF5F 3ILFA 4BHBA 4YZ5A 4XFHA 3GFJA 2DLLA 4BQNA 4L0PA 2WNUC 4BJ5C 1DQ4A 3CD6I 1SFEA 5HI0A 1MQTA 2XL7A 4F52A 5A7SA 2HFHA 3AP4A 2CW0F 3PHMA 4LHSA 3ZFGA 3ZYIB 2X1EA 3H42B 1LGCA 2PA7A 1NXMA 1R5ID 2ZHNA 3JRAA 5CFDB 1VBA2 4D69A 1WLTA 1H0MA 2XIGA 3LSGA 1U2WA 2H6BA 3EQEA 4RBOA 3BGAA 2ZB9A 3V64A 4BE2A 2PMWB 2FDFA 1CF7A 4XSXF 2VXDA 3WP4A 4QPGA 3J80K 2W57A 3RI4A 1CD3G 4YIIA 1LR5A 3CQZJ 4IHYA 1QZEA 4R79A 4AR2A 3LQQA 3QOPA 1JGGA 2FDGA 1V5GA 2ZXWH 3ES4A 2PHTA 4XNFA 1RXFA 4ESBA 1OQYA 3FE5A 1W6MB 1RUI1 3KP5A 3MGUA 4AK3A 1ONAA 1Q56A 2V79A 4NWVA 4DYQA 2JXAA 1TWHJ 2V6EA 1U5TB 1V9U2 3W5MA 1I39A 2R7DA 1U9OA 1BI0A 1N3OA 1D1AA 4PLMA 3X2QH 4HX7A 1PVEA 1W6OB 1JHHA 4KIGA 1PUFB 1WJ5A 2ZGSA 2EFPA 2BY2A 3AKSA 1EA3A 2V1XA 1K78B 3IV5A 4HOBA 1S7AA 2D3SA 3BU7A 2L7MP 5J8CA 3I2FA 2WQ8A 3DQVC 2XH6A 4CCDA 1WD4A 4NDLA 3OBAA 3FBNB 1JUMA 4EN6B 2NVXJ 2C24A 1JKRC 2DTZA 1IGNA 1QMJA 3VD7A 2E63A 1W1WE 1FSHA 2IXSA 1RUC1 4PDWB 1LULA 2FOKA 3BPZA 2AEYA 1RVF2 4RGXA 3WLUA 1ETKA 1OOPB 4AHYA 1PMIA 4YRDA 1ZELA 2K9LA 3V7CA 2R063 4OMYA 2ELJA 3GBFA 3AL5A 1ZZ7A 1WI3A 2EV5A 4NIAA 4BIOA 4NRQA 4UUTA 3CCLI 4YW7A 2AR6A 3HUGA 4CU6A 2W91A 5M3MJ 1QJX2 4KBBA 4BXSV 2ZACA 3TL4X 5CVIA 3RWNA 2QQOA 1AL23 2L9SA 2DTYA 3Q8BA 5DDJ3 1NCRC 2PAEA 1W06A 3WDTA 3MF6A 1UIJA 1FMVA 4D6SA 2D1VA 2VPLA 4FI9A 2L4AA 4AIHA 3K46A 3S3MA 4AEMA 1K4SA 4K6BA 3CDHA 1WJFA 2L9VA 4UFIA 1OUXA 5I8TA 2YX7A 4XFCA 4Y1XA 4XSZF 3CJIB 1DGRA 1Q8OA 3WG3A 3H5NA 3IZOA 3N9OA 3L1PA 3BTCA 3ZSEA 1QPMA 4YFZA 1CZTA 1UL9A 4RHV3 3CTAA 4E7LA 4AYBN 2X5IA 2VQUA 3N4MA 1CAXB 1ZLJA 1AYN3 1LEBA 3THCA 3F6OA 1K61A 3LSTA 5GPCA 3R4UA 2WZR3 3F8CA 2ZMEC 3FHAA 1D1CA 3O1SA 4JRLA 2D1HA 4LULA 1FNNA 3FHQA 4F55A 2QQPA 3AL0C 2V5YA 1LDDA 2BY3A 5KXBA 4OHVA 2WLQA 2I07B 1MJ9A 3M3YJ 3L2CA 3PJYA 3JZVA 2VAUA 3ZMOA 4AVBA 2CSOA 3GM8A 1WHUA 3WNOA 3AKTA 3PSFA 2EFOA 3A01B 4XF1A 3H5RA 3CC2I 2B7YA 3T0YA 2HBTA 2GN3A 1YQ2A 4YW5A 2D43A 2X29A 1RUD1 3ABKH 3K51A 3I7DA 1I1GA 4H0EA 5LY1A 2K9SA 2W95A 1MGTA 1EH6A 3LB9A 3JRGA 5L3GA 3DU5A 3SCHA 1R1UA 3ELNA 3I59A 3THTA 1XGNA 3G7DA 3NAPC 3CUQA 2QSHX 4P9UA 3RKQA 2DYCA 4QSHA 1IRFA 2E5ZA 4BPZA 5DCMB 2HDDA 4UFKA 3BKZA 4CXXA 5CFCB 5DUKA 4LKFA 4QDQA 2QVOA 2E2IJ 2EILH 4FOWA 5H20A 1VR3A 4RQPC 2CV2A 4RFT0 2VODA 4QKDA 1TMF1 4MTEA 4XBLA 2R7OA 1LJ9A 1WPKA 5K7HA 4FFHA 2WFF3 4BA6A 4UF0B 5A70A 4CXYA 1QRYA 3IMMA 2RM22 2RDSA 4GB31 3N36A 3J7AY 2JD4A 2MABA 4MNUA 2YMZA 1GHCA 1SBEA 2L9LA 1IF1A 4Y22B 4YZ3A 2JG9B 3V42A 2AYHA 3POWA 2ETEA 2DA7A 1N3PA 3IM0A 4XHBA 2DJNA 5I0SA 2YSRA 2QBYB 2A7AA 4UVCA 5T55A 1F5JA 1VAMA 1EPZA 2CNAA 3BTAA 2LTNA 2VE1A 1DIWA 2VZUA 3C3VA 4IETA 3ZDVA 3O12A 3PMSA 3HVDA 2P4WA 3INAA 1UX7A 2IP2A 1JU4A 4AE2A 3A21A 1H1AA 2X6XA 1ZYRF 3BG3A 1SVOA 3KV5A 1P4AA 2D6NA 4II2A 4BAYA 3CCEI 2VTXA 2ZA9A 1QJU3 2DFBA 2YXSA 2Y0IA 1RUH2 2A75A 2HQRA 3A4CA 3DU6A 3SXYA 1VMFA 3EBRA 1KDMA 3HAGA 2STWA 1VQ5I 4YG3A 4Y17A 4J1WA 2HZDA 4CZZA 1UZVA 1Y6IA 2SLIA 2EAKA 1UF2C 4LBJA 3TDUC 5H6QA 1I6XA 3S7EA 3SYTA 2DXIA 3KV6A 3MYXA 3AKQA 1YI2I 2I2SA 2MEV2 1E17A 3NNGA 4QPIA 1N3QA 3PU3A 4Z6YA 3KQ4B 1T6BX 1UU6A 4DZGA 3ZO0B 1ORKA 5FP9A 3AL6A 1Y1WJ 5IFPA 3AVSA 1IAWA 5CISA 4XLPF 5F9TA 1ODDA 4KG0A 4TWTA 3ESWB 4WX9A 2MPFA 4MHRA 4E2GA 1YW7A 2JDUA 1BI3A 3BCBA 5FFZA 2B4KA 2CGOA 5GZDA 5FZKA 2BZDA 2ZBJA 4KQ7A 3ST7A 1BOAA 1OCRH 4WM8A 2X9DA 1PP8F 2VOPA 3OCPA 4UYBA 1B35B 5D4SA 1JZ4A 4NHXA 3AYAA 1ENQA 2FQ3A 2EA2A 3BPXA 5BOXA 5IP6A 1ND3A 2E51A 1GR3A 1F5FA 5JSPA 5ICEA 4BLJA 5HXMA 1HB4A 2A73B 2CYFA 3FMSA 1W9TA 2CW8A 4BQ3A 1N1SA 5EYRA 1SFPA 1F43A 1X3WB 5J8FA 4XTPA 5C8WA 4N90A 5J6XA 2WS91 1JHJA 1H8TC 3G73A 5FPUA 4GWIA 3BROA 3KYLA 2CG4A 3SHRA 1WKYA 2WNUB 1EH8A 3JD71 3OSGA 5LBCA 5JFRA 2JDNA 5IP7J 1PK6A 2Y6GA 4KITB 1T98A 4IEWA 1TC3C 1MD0A 3ZMDA 1MEC3 2Y30A 3OL4A 1S4CA 2VO5A 3S6PA 5JSOA 2DCKA 1K79A 3ILRA 2BWCA 3U78A 4P9YA 3L9JT 4IKFA 1R6RA 2HLEA 1BC7C 1SLCA 5FGMA 1PGL2 1MBEA 1W0PA 1RUJ3 4A3XA 2ZXHA 4D7MA 2ZJQF 2PJRB 2W46A 1OCZH 3JQXA 1VAVA 3VBFB 4DRVA 1F1ZA 3T0AA 3VD5A 1SPPA 4XCBA 1NG0A 1OFCX 3PIOF 5T5PA 3T2QA 2WO7A 1POQA 4UW6A 3MKZA 4G6QA 4AC0A 1XE8A 2DUPA 1NLRA 2XJPA 2ZXQA 2LY9A 1UAAA 3D5OA 3NW4A 2Q5TA 3U10A 4D6RA 3DEEA 2GNBA 1REPC 1BM9A 3T2TA 2QQ9A 2LBFA 1FI2A 1NE6A 4M4RA 4FETA 3VHNA 2F48A 1W36D 1AX2A 5HVQC 1J2XA 4LLGF 2IXIA 1WMXA 3TOJA 2DV9A 4YW1A 4CDQA 2WN2A 1XN7A 1GNZA 2WNVA 1BKZA 2BNMA 2QENA 4JTOA 1CESA 2UYBA 2NNYA 5HS8A 1DGRM 1C4RA 4R9BA 4UFJA 4PFOA 4W4ZA 3SITA 2B42B 4EVIA 5KHHA 5JSRA 3ZXLA 4P96A 1VP6A 2VQCA 1Y9QA 3WNMA 1DYPA 3P6BA 1H8VA 2D3PA 1I5ZA 5GLZA 1WCDJ 2B5HA 3WDUA 4P55A 1XPWA 3KYDB 1YS7A 1CIYA 2D6MA 2UY8A 4HKWA 3HRTA 3QYEA 1GVJA 4CA9A 2HTSA 4ZTJA 3D3AA 2F4IA 1C3HA 1R1A1 3ZVXA 2ARAA 4N8MA 2IZWA 1BIBA 3DFGA 4EZ4A 5EEGA 1DCSA 3RJ2X 2DMTA 3N9LA 5GLVA 4ASNA 4B48A 2ME0A 1NK3P 3BWGA 3S15J 2RKHA 3D1NI 4TYSA 3J80Z 1QA6A 3LWCA 2JUGA 3I2KA 4V1PA 5D4RA 1T6GC 1YHQI 1FMD3 4QM9A 4B1MA 3M70A 4D7SA 2L7ZA 2L2OA 4Q4W1 1ODMA 4HL0A 4OIRF 2J42A 3V7SA 3ATGA 4AAXA 2ETHA 1NCRB 3AXEA 3AZYA 1VQ4I 2QQWA 4XMIA 1MJAA 4LK0F 4JCKA 3EHKA 5K1YA 3RQIA 1G6NA 1FOKA 3OY8B 1SD5A 2DOEA 3DEMA 2VQ0A 4S0HB 2XSJC 2CW7A 5BQTA 4NWWA 5JIAA 1W6PA 4RMNA 1NA1B 5BNQA 5B4NA 4FPKA 4CDXA 3BR3A 3LSRA 5IVFA 2VBWA 3IAPA 2VW0A 2EV6A 2JDAA 5CKNA 1IG7A 1NQDA 3U07A 5A6QA 3AMPA 2ZX2A 2IRFG 5FZBA 2KM2A 4YZ1A 2QNKA 3MO4A 1FIAA 1ZA4A 3WP3A 2VULA 3WHCA 4CPBA 3BIWE 5CJ9A 2EB7A 3O0VA 3W3CA 2CAUA 4UUVA 1S8NA 3U2RA 3LD8A 1D0YA 3AL0B 3DTEA 3I56I 1H2NA 4XFGA 1XNKA 3B6CA 3FBMA 3I2OA 1FOD3 5DAVA 3HNMA 1A35A 1GSLA 4XOTA 2LTPA 1GV9A 1XTAA 1QXRA 3CP2A 1FX5A 4QWNA 2O7OA 2ZGLA 3H36A 1U3EM 4AUXA 3HT1A 1OA4A 4RS5C 2Z5UA 3C7GA 1JN2P 2VJIA 3BI3A 2ZJRF 3PUIA 4XETA 1YW9A 1EJ9A 4MGYE 2CMPA 5K4LA 4LLFA 3W21A 1PO11 1A31A 5E16A 4GWMA 2KJCA 1NXD1 3WDWA 4QKFA 4JQRA 2Z69A 4PI0A 1PVC2 4LBOA 3SISA 3FMRA 4QU1A 3X29B 3HTUA 1SDDB 1NG6A 3VBOC 3NAPB 4ZXEA 1VBC1 1WGPA 1DU3D 4GWJA 1MMDA 2BW3B 1X19A 2ARCA 2ZEWA 5EZWA 1ZBE1 3VZNA 3OPZA 1UIKA 2WLPA 3HYIA 2XROA 3K70D 1FTTA 1ZZ6A 5L3EA 1YI9A 2Z5WA 3MEPA 1GOGA 3I97A 4FTBA 2VCAA 4AFBA 2PG4A 4L0ZB 3SCGA 1TWGJ 2A3YA 3F6VA 1HIXA 5FQ0A 3GZ5A 3D4KA 3O6BB 2H1KA 1GWKA 3LDBA 2E32A 1PIV2 1FV2A 2ZSIB 2OF7A 5CG9A 1ZX5A 2R072 1R081 3J7HA 4X8PA 5LA1A 2VG9A 1O4ZA 4XFIA 3LOCA 3OR2C 1RUI3 3WGIA 4E70A 3CL1A 4Q4V2 5SV8A 1L7QA 2DT6A 4IHXA 2O03A 1B9MA 3DBLB 4AF9A 4NPLA 3BG6A 1FPQA 2W84A 5C4XJ 1SLIA 5EGOB 1S1AA 4UI9L 3NARA 3Q8FA 2QVSB 5FZ8A 4YSFA 2DU9A 2XG3A 4Y3OA 3MPPG 2P3YA 2XWBB 1XBFA 4CUAA 3TW7A 3USSA 4QT6A 2DCTA 2XBO2 2A07F 2VE9A 2HWF1 4AYUA 5EZGA 4DYRA 5KAFC 1DF0A 1TME1 1UAIA 2P2KA 3M1EA 3NL1A 2HGCA 4B8EA 3L2UA 3ZOIA 2JPCA 4QXHA 2WZPP 4Q4Y3 1Z1DA 3JBG2 5CAZA 4RDUA 2CYYA 4JX4A 2JICA 2PHWA 3H35A 1E3OC 5F32A 1HDKA 2LM3A 5ILSA 3KZZA 4PSXA 1MBHA 1RUC3 3ILNA 3ABMH 3ZQLA 2DPDA 1R9TJ 3E5XA 4L9BA 2IXJA 3H0DA 5J37A 3THPA 3LDKA 3U11A 1AYM3 5K8SA 5FLJA 4Y1VA 4BDYA 2EALA 2AC1A 3RSJA 3BDDA 2LYCA 3IDAA 2XGDA 1SEUA 1X36A 3ZM8A 4I01A 4P9GA 3WE2A 4LMYA 1DGWX 4HN1A 3DTIA 1W2OA 2JG8B 2ZJCA 3WF0A 1NZCA 1C8M1 2A6EF 1GV2A 3OS0A 1GV5A 3LFUA 1US2A 1N1TA 2VZSA 1UWWA 2ZGOA 5JLVA 3FX3A 1BEV1 2IEKA 1AR72 2GU9A 3C1DA 2G7HA 2G1MA 4CCNA 1C57A 3J81K 5JLXA 4BK5A 1XSVA 1TLHB 4I6ZA 4IXAA 4NB5A 2QKLB 2WY7Q 3EO6A 1CJPA 1OLME 2CGNA 3AYEA 4IV3B 3M4OJ 1YXWA 1BBT2 4CHUA 2KLOA 4EJRA 1MVQA 5KHJA 2HZTA 3K3OA 4NPRA 4KBZA 3WW2A 2YB7A 5EJ1B 2EXHA 5GAEJ 1S7OA 1KEXA 3E5QA 2FNPA 3QH6A 2ZOEB 1ZTRA 5EG0B 1LE8A 2BBYA 2LRPA 3VYTB 3GUDA 4ZJZA 1S0IA 3IPVB 5AC91 1LCLA 4FQ4A 4M6VA 1IDZA 4E9KA 4U7BA 3A23A 5ABJB 1RUG1 4LG0B 1K3IA 4XBNA 2EIJH 5GLUA 5IYDJ 4IL7A 4C2TA 4N4OB 3V4GA 4XQFA 4KL1A 4MEXF 4CRQA 3TGNA 4NIHA 4GH4C 1S7EA 3KEQA 1O5LA 3WQ1A 1LKXA 1DZTA 2JJ7A 1RUOA 3SCFA 1YFYA 1VBD2 5H6RA 1H4GA 5CKQA 1P6RA 1U5YA 5I8SA 1E5IA 3IKTA 5I8YA 1ZBA2 5EJ3A 2Q8DA 2BGPA 4Q8LA 3P9CA 3PNAA 3N7JA 3ZMUA 2J1VA 3HEFA 4RYDA 4LR4A 2FD5A 1WCSA 2OTLI 2Y6HA 3WDYA 1BJAA 3H7JA 5L7OC 4LBQB 3MW3A 4GO1A 5LATA 4AQ6A 2OPKA 3JTGA 2V73A 1DDNA 2EFNA 5F2WA 3CJNA 4CPBD 4UOJA 4XM3A 5FY0A 3VKOA 3VN4A 1TMF3 2HEWF 4BIFA 3I3DA 1W0OA 4DBQA 3WG9A 3K1PA 2VONA 4GB33 1X50A 2DBBA 3ZPYA 2O1QA 2LREA 2QZ3A 3VL8A 1F36A 2Q8KA 4XLEA 3IIAA 1FOYA 4PCQA 1J1TA 3FFZA 5AFBA 4M3CF 3AP6A 4HLXA 3ZMSA 4MVTA 5FO8B 1KGSA 2XLGA 3K4MA 3LF7A 3PL0A 4D7YA 4XRFA 2V6CA 1CZSA 4A3MJ 1CZVA 4L9TA 3KP6A 4JQTA 4PLOA 2VQHA 2WAEA 4XKVA 4KICA 4P14A 3DKQA 2Z16A 2HYGD 2OAZA 3TKYA 3MN2A 2EFQA 1POV1 3FXMA 4JV4A 2D7FA 4WVMA 2VU9A 2FDJA 4LK1F 3KE2A 5ICFA 5K5OA 1R091 5LLQA 3IC7A 1ZG3A 4IRGA 3W20A 1KJRA 3JW4A 1XRUA 5ANQA 5JI9A 1UY3A 2ZFWA 4IDZA 3HHGA 3SJMA 2F4MB 3E97A 4FASD 1GQPA 3WTSC 5IYBJ 1GXPA 1MS3A 2PAMA 2DUOA 1RYYA 2LALA 1WW4A 1FP2A 1ZRCA 2R7VA 5JZGC 3TB0A 5C7GA 3D82A 2Y64A 4P08A 2X53S 3G6JB 5KC5A 2ZGPA 1A3KA 5FMOS 4CEYA 2K85A 4Z1VA 5FUIA 4AVTA 4SLIA 5JVTA 2EBIA 4ONUA 5FKBA 1XYOA 2B45X 5ILUA 1UU4A 1D8KA 3DPRC 5E88A 1JUPA 3LFMA 2WZ8A 5IAXA 3TEZA 3OOUA 3NO8A 2VN2A 2R92J 1WW7A 4CDWC 3IAM2 2R3SA 4JX6A 3IAS2 1OYYA 5DM7F 3T08A 3VBUB 3OYWB 2VMHA 4I02A 2QKDA 5DPNA 1QHHD 5G05L 2E1NA 5FO7B 4HF2A 1Z7S2 2G9WA 2G9FA 3VHOA 3F8NA 2IA1A 1L7RA 5JXGA 2QYOA 3LA3A 2JVGA 4UBGA 4Q0SA 2EXJA 4CZSA 1WKMA 3N7LA 2IBDA 2BNOA 1HOMA 4EV0A 4I3PA 4E2SA 2P4EA 4KGQA 4EQQA 1UW8A 1VQPI 1J83A 2E1CA 2VY0A 2KJBA 2E7WA 3NAUA 4I0BA 2ESHA 3MUZ1 2OTJI 2KIQA 5FYUA 2C9KA 4KFCA 3H0GJ 1KU2A 2PBIA 4QQLA 4RS5B 2K9ZA 3H1YA 3TOAA 1ZAOA 2UURA 4MFDA 2B46X 1UY1A 1U0JA 5J7MA 3LQCA 4XF0A 3RI8A 3JD73 1W7PA 3WDVA 1JYIA 3WDXA 1XNAA 1VRBA 3F21A 2LRDA 3WR0A 4GKXA 3QU3A 1HC8A 1LOEA 5CVUA 2RGVA 3AG3H 1SCRA 5F6LB 1HB1A 3U0ZA 1R4NB 3IH2A 2PMUA 1SCSA 1D8JA 3VDXA 2J1TA 3QP6A 3I5UA 5FFOC 3FKJA 2GOXB 5L3FA 1NX9A 4FX0A 5L73A 4K8RB 3ZYPA 3TRSB 5JPMB 1SMYF 3BR2A 3OYHA 3POYA 5F0CA 1K42A 3SH3A 4LO8A 3H3UA 5FKKA 2E2HJ 2VPRA 1AVBA 4O9EA 2A05A 2EAAA 4KT6A 3B94A 3RVHA 3G1MA 4NC6A 4JK1X 2P6TA 3C8XA 4XUOA 5LA0A 4EATA 4Q1RA 2X10A 2OQGA 3ULQB 1LESA 2ID6A 3CCMI 2XPWA 1X8MA 4YW2A 1LGBA 2JA2A 2R4GA 2D2WA 3F9KA 1OKQA 4KIFA 4XDPA 2OQRA 1H2MA 4NOTA 5T50A 5I0DA 3I58A 1LHOA 3FMGA 3RKYA 5A2QK 3H0OA 2EIBA 1R58A 1LU1A 5FXZA 2QQVA 2IS6A 4CU9A 2QSGX 2HWD2 3BJ6A 3WCSA 4C9YA 1EV12 1DQ2A 2KT0A 3ITQA 4XJ9A 3FXQA 2UWMA 4JGYC 5E1XA 1XNCA 1A8DA 3LGRA 5DCFA 3JQWA 1X1AA 2HS5A 1GQHA 5E1RA 4QKNA 2BOJA 2IGOA 1PUEE 1QPIA 2E1OA 1Y0NA 2VBXA 1HRI1 1H30A 4HPKA 4RGAA 1TQPA 1FEXA 3RKXA 2JDKA 4HPQA 2F4OB 1IZ1A 4MXVA 1R1A3 4CP1A 5IATA 2OJED 4JYKA 2BYVE 4X0GA 2IGMA 5FZOA 1BVP1 4XK4A 3SH4A 2DJIA 1ZZ8A 5DUXA 1X4OA 4EYUA 1NY72 4K21A 1BW6A 4XC9A 2DN0A 3CCRI 3VD3A 2RR12 4BE3A 4CP9A 5C3RA 3G1LA 4YVWA 4BE1A 5CQEA 4CE8A 4MEYF 2EK5A 2YDEA 1YRZA 4W6XA 3RZLA 4BHPA 1MZ6A 3M4FA 4PI2A 4C2UA 1BR1A 2J5OA 5ERIA 4Q4W3 3ENRA 3HBLA 3IN9A 3KYCB 1VRH1 2W47A 4OUEA 3BC8A 4AEDC 2P34A 1WI9A 1ZZCA 5IUQA 4JP0A 1QBJA 3OOXA 3ZXAC 3ACLA 2YU1A 2JWPA 5C5UA 4OHWA 4PGHA 1RHI1 3K4DA 1OURA 1NAEA 1NTCA 3ISPA 4A7KA 2STTA 3AJZA 1FJLA 2PEXA 1UYZA 1BMV1 2XQXA 3BVCA 4HXCA 1K5MA 1GZWB 3ZFFA 1JYCA 1GKBA 3ZR6A 2A5WA 2VKDA 4Q0QA 2KQRA 1XD7A 3T30A 4GAZA 1ZK8A 3FM5A 4FXKB 1JYTA 2VD7A 1GFF2 3WZ1A 4XR6A 1ULFA 4CCKA 5LB6A 1H6YA 4BEHA 5EYYA 1YG2A 5FWJA 2FD8A 5CFDA 4GYIA 1G86A 2L3DA 1YO8A 3LA7A 1XMAA 4GGGA 2HYFA 2VMIA 4MIMA 4PFPA 4QKBA 4GDFA 4IOAF 4BQ2A 2OA4A 3IT8A 5JVGF 3DL3A 3J8F1 2FBIA 4Q4X1 4AW7A 3OEBA 3PVEA 1Q1VA 1KZHA 2C0ZA 4QX7A 1RZ4A 4QLCU 1YYNA 1PO13 3VBHC 3Q0UA 2R043 1BBYA 2DMUA 2L7KA 4B8XA 2VJXA 3GBGA 4W65A 1OCTC 3SLIA 3OWTA 4P02B 1TEIA 4G9YA 4M3BA 4ZONA 4E2QA 5L7OB 5DEQA 4A0XA 1ZBE3 2QQMA 3J81Z 1W6MA 4EN0A 3SDGA 4WM8B 2GC1A 1SFOJ 1U5TA 4XXAA 4A44A 3D0JA 1AU7A 5CG8A 2CQQA 3CCJI 4E7JA 1UB9A 4BACA 1U5ZA 2J1RA 5A80A 2A6TA 3L2YA 2VOTA 2XQRA 1QJU2 4Q29A 3GTKJ 4XHXA 3A2KA 1B09A 4XJAA 1W6OA 1D4M1 3POSA 3VODA 4XPVA 1PUFA 4U2AA 2LROA 3GYHX 1R083 4XUPA 3KEOA 3FFQA 5BPXA 4B1LA 1TWAJ 5EV7A 2JRMA 1K78A 1GNHA 2VZ1A 1EV7A 5AONA 4MG2A 5F37A 2PLV2 3FLRA 3HNYM 4K8FA 3JSPA 4FBFA 5CQGA 3WU2C 2WQZC 2V09A 3AB0A 5F5QA 3S0MA 3QD6A 2R32A 5KHDA 1YW8A 1STZA 2DVAA 4K9SA 1W7PD 2LF7A 4B3AA 4PQQA 4QX0A 3HM5A 3MLKA 3K4KA 1QWRA 3LSDA 3CJRB 3S93A 4PDWA 1Z6RA 2JIJA 1OOPA 5L3CA 3HSEA 4XCAA 1DZQA 5JUVA 2FZ1A 3ZYGA 4PIXA 1G3YA 3O3KA 2EICA 3K9TA 4NROA 3CC7I 1VF9A 3HXLA 4CZCA 1ZVFA 1TME3 2FXAA 4Z07A 2Y2ZA 1WCMJ 3ZFGC 4HSRA 3NQOA 3J7NA 2AACA 1X8EA 4EN8B 2HYKA 3NNJA 5CIRA 5FZDA 1MACA 5J1UA 5JZGB 1FBSA 1HLVA 2GM4A 2QQBA 2DAOA 3GFMA 2OC6A 3C7FA 5FDBA 3ZFEB 4K20A 2W94A 4OOIA 3S32A 3CP8A 2K5CA 4Y52J 4NN0A 1WA4A 5HBAA 4QPGC 5CNAA 1GZCA 2AZ5A 2E7TA 3CJIA 3RQ0A 3DPRB 4W6WA 4HSTA 1G4DA 3OYBA 2BY1A 1JZ5A 4AG4A 4ZS2A 1J75A 3UK9A 5DM6F 1C8M3 4FAGA 5F5AA 5EQUA 2QLZA 4ZH4F 5CKMA 1R36A 2VOXA 1MW7A 1CAXA 1AR82 1BEV3 2XJSA 3GGLA 2R1BA 4FPFA 1A5JA 1YYVA 3SFIA 3ALQA 2BBVA 3ZXDA 2BV4A 4ZPIA 4HG6B 3JB4C 4LO6B 4DXSA 1JJ8C 3EDPA 2WWJA 3AZVA 2LFBA 3ZSJA 2LY2A 4NJ4A 2VQLA 4BQOA 3B00A 1V55H 1OQEA 2BW8A 5A32B 4HKLA 4IRIA 2AXLA 1QOSA 3ZYRA 2HWC2 4EJTA 2ZTNA 3CZJA 4EZHA 1RUE2 2RV8A 3A01A 4COYA 4B29A 4Q5OA 1IS6A 2DVBA 1VBE1 3UL2A 2YC0A 3K4CA 4OINF 2NMNA 3WNLA 1NLSA 1WBLA 3ETQA 3GALA 5LBQA 2R7EB 4EJVA 4BJTA 5AC93 3HL2A 4MV2A 5H9SA 4KH9A 2J7MA 5FXVA 2D6LX 4YFNF 4QB2A 1YQAA 1QH6A 1SFYA 1WWYA 2Z1DA 5FRMA 1PO23 1RUG3 1VALA 1JMUB 1IV8A 1L3LA 3Q0WA 1H2LA 3O14A 4C3JJ 2VNOA 5DZEA 2HVQA 2HVSA 3BTZA 4HANA 1NKGA 5DCMA 2HPMA 1T8IA 2IFWA 2XAQA 4FOVA 1ETWA 5CFCA 5JPNB 4LIUA 3ZXGA 5GALA 1ZREA 2X85A 4DYCA 1W8OA 4DZJA 3N9NA 1OVPA 3D0SA 4JOMA 2WN3A 5M5YJ 4UF0A 3JU9A 1YJWI 5FMOL 3VFZA 1RMU1 4K40A 5BXXA 3VZOA 2VZQA 3O8HA 1COV1 1SQ4A 3BZKA 4KMQA 3E3VA 3ZN4A 3KT7A 1GBGA 2WAFA 2XC7A 4Y22A 2W1QA 2JG9A 4FTEA 1YJ9I 2RVAA 2Y6LA 1DHKB 4U36A 1RI7A 4P5HA 4HVRA 4DOUA 2QBYA 1ENHA 5FD5A 2VKVA 2W24A 1EAH2 4CXFA 2FOWA 3MZYA 2X5IC 2ZZJA 2O0OA 3VDDC 3AG1H 2W7NA 1M1EB 3Q9SA 2GSYA 3NV2A 2QCSB 2K9QA 3MPBA 2DOFA 2CWEA 3E7LA 2CJJA 5HV0A 4QPOA 5FZMA 1SACA 3E6MA 3TEDA 1D0XA 3IWZA 1W36C 1N1YA 5BYNA 4KWKA 4PJ0C 2DQRA 5EDNA 1VQMI 3P5JA 2VZTA 2VCMA 1TQMA 4IX7A 2ZX4A 5FCCA 4CICA 3C7JA 4EMSA 2XF6A 3TEWA 3K4ZA 4QB6A 5LRRA 3WTYC 3FIWA 4JX5A 1CQ9A 1R093 4X6RB 1OLQA 3M1CA 1AXKA 2IVMA 4H3WA 3CMAI 5GPAA 3O0XA 3TP3A 2VVDA 1ETQA 1SFUA 3ZYJB 1HJGA 4WXCA 5F3GA 1LENA 4RFRB 1ZARA 3REOA 2JA8J 2BDRA 3N9MA 4FAHA 2BEOA 2C6YA 5C9AB 4QHBA 1QHDA 1YCIA 5L3BA 1LEDA 1F15A 3PIJA 5HLIA 3AAFA 3WUDA 2R5YB 4OHYA 3FL7A 3KZYA 1MSEC 4GMP1 4HT1T 3W2VA 4IEJA 3RZMA 1HKSA 2ZBKA 5FIXA 5D8AC 1B35A 3N7MA 5A33B 4MFEA 2OUJA 3LDRA 1C5HA 4V2FA 5C44J 4A0YA 1Z67A 3TQNA 3MIFA 3ZYHA 4KGGA 3PMEA 4G3YC 4MOAA 2FCVA 2VM9A 2WFPA 2C6SA 4XVHA 2WSUA 1OYIA 5A2QZ 2XVLA 3OGSA 3BTXA 1IN7A 4DW6A 1TL8A 3KGLA 3W9AA 3A22A 3DF0A 5J3UA 2BU9A 1SFKA 1SMVA 3C2HA 3SEZA 4A3KJ 1J7KA 2AGSA 3PO2J 4P9JA 4I2OA 4HOOA 3H8RA 5HV4A 2VIXA 1CX4A 1W9FA 5K7FA 4F8AA 1ZR4A 4MGKE 2V5DA 4HFSA 4XXPA 2WNUA 2NVUB 2NS7A 1Q8QA 1BJQA 1N25A 4N9IA 4TV7A 4MLOA 1JS9A 3WE3A 1R7JA 1AL21 4MZUA 4AGRA 1EPWA 3BCWA 2RV9A 2RNGA 5FJ8J 1G3TA 1E2XA 1LHNA 2NZ9A 1HV1A 2ORXA 4JKMA 2PJRA 3VBFA 1FSEA 1ZLKA 4WF2A 4ZYGA 2IGNA 2NOGA 3NKTA 4N4NB 1DLLA 3VBHB 2PJPA 4JTNA 4YM0A 4PJJA 5HNHA 1RUI2 4DUXA 1KONA 4I7HA 4BMEA 3WG1A 2YU3A 2XB0X 4QPIC 5HLGA 5JOYA 2BVVA 2MD0A 3HBKA 2JZYA 5ANNA 2WZR1 1S55A 2LMDA 1W6QB 5D8KB 3LWFA 2WQ4A 3JXSA 3MIBA 4DUVA 2HEYF 1SVMA 5CEHA 3SFZA 5C8CC 2W0XA 1W03A 3AFGA 2HJIA 1G7YA 4II3A 2ZXIA 3AYDA 4UB8C 2CY6A 1W9SA 2FBKA 2F5DA 2VVFA 1CONA 2TRTA 5LGTA 4Y5Z0 4FISA 4M3GA 4L92A 2ARXA 2DA6A 1LJ7A 2R6QA 1HV0A 2DMNA 4AWDA 2BTVC 4O7XA 1HXS3 3MEXA 2M8EA 2D40A 1G9AA 1JZ7A 4JVAA 3ZRGA 2FNAA 5TRDA 1LHUA 1ND3C 3ZMTA 1RUC2 2CRGA 2DFFA 1O4XA 3RYKA 3LAGA 1UOBA 3O1RA 2VNRA 1S9HA 4XFBA 1H6XA 1TW3A 5J36A 5JXIA 2Y69H 3UKTA 1VQ9I 5LASA 2VCCA 2PAKA 2QZ8A 1Z91A 2GH2A 2YROA 5IVEA 5K7PA 3ZDSA 2B7EA 2H6CA 1R5GA 1DUXC 3O2PE 1UMZA 5I0UA 4Z2WA 5FKMA 3KEYA 2ADEA 3A0HC 4BKXA 4OI2A 2M8GX 1WUVA 1P8JA 2CWMA 4NO4A 1JUHA 2HWVA 4E8DA 1ZRRA 4C3IJ 2PFWA 2UXNA 2FE3A 1PK6C 2KR2A 3SKVA 2WFF1 3FLPA 3KPHA 2F5EA 1AKHB 2QQLA 1NCRA 3RJPA 2DW4A 2AO9A 4XYXA 1VMHA 4XQWA 4C0BA 2A6YA 2QA4I 1JUIA 1UMHA 3OY8A 3IDEA 3FXLA 3KETA 1USTA 3SKJE 5FBJA 3P9KA 2Y0OA 1AR63 4G7OF 1PNGA 3MKLA 1NA1A 4CYCB 4XDQA 4DMIA 2O14A 4ZC3A 5DUWA 2Y9ZA 1PGL1 3RG0A 4PUSA 4IE4A 3J7MA 4OIPF 1OPMA 4QIWN 2Q30A 1LEAA 2FF4A 2WY8Q 3MCZA 2VZ3A 4DXTA 1AX1A 4F7ZA 2E33A 1K12A 4NHYA 5HXVA 1DQ0A 3D8CA 3RSNA 1IS5A 5J98B 5LRSA 2K27A 2IFRA 2P5BA 3K75B 3CLQA 4YNIA 1FYLA 1IS4A 2W1UA 3ERMA 1W8WA 2DTRA 5DS9A 4ZYAA 4L5IA 1REDA 2G0EA 1YIPA 2LR8A 2P81A 2R7RA 4JAAA 3GJAA 1WMFA 4UXAA 1YFWA 1DGWY 2RJ2A 5JWPA 2DFCA 2WNVC 3KZIC 1RHI3 3ES1A 4Q2FA 1TG7A 2F17A 2DDAA 5JLWA 4C2MJ 3E6CC 3P5BA 1HW5A 2JJ6A 3BR5A 1CPMA 5FKCA 4DS0A 1RUD2 5L9BA 1BIAA 3RYRA 5A3WA 2GMMA 4WVMB 1KGYA 2Y38A 2L54A 4JZRA 4ISQA 4AQ2A 3W59A 4IF4A 3V7RA 2DURA 4B4RA 1FT9A 3NWSA 4WM7C 4E27A 4BQ4A 3PJQA 2K3FA 3LEGA 1U5IA 3BPVA 2P7VB 2VT3A 3K2AA 3H9AA 4B4CA 5FZ9A 4YW6A 3QP5A 1V0AA 2PTMA 4L5EA 3MUY1 1WLWA 1IUYA 4L8QA 3WHUA 3OIPA 3E6DA 1ENXA 4XIDA 2IVIB 4QDSA 3SC7X 2RS52 3HIFA 1JKPC 3NAPA 2C26A 2LF8A 3KLNA 2DYRH 2ID3A 2BW3A 1SFXA 3AKPA 5M5WJ 2W1WA 4A45A 2QE3A 3J8F3 2XAHA 5KXDA 4IHWA 4Q4X3 3OD4A 4XMAA 4A93J 3LOIA 2Z33A 1MVEA 4XURA 4QQPA 4F3JA 1WBFA 3ZQ7A 2D98A 1XYPA 2GZWA 1XQNA 3NV4A 4FCAA 2VC1A 3WHTA 3TDZC 2LUWA 4KA4A 2DA1A 1VE0A 1QZYA 1HSTA 3EUAA 1V70A 3VBRB 3SZPA 4B4PA 1ZN2A 1IPKA 2VJ5A 3C2GA 3WNNA 1SAXA 2EZHA 4KNYA 3ZQGA 1SDWA 1H1IA 4YGCA 5FMBA 3BTIA 5IHRA 4LLLA 4CDXC 3OYDA 3KCCA 1W9YA 3ZKUA 1T0FA 4A6DA 4RR3C 4FXGB 4FPJA 1JOPA 2NS8A 2J22A 1H2KA 5FP7A 3H1CA 4Y5TA 5EGOA 5IK8A 1IXRC 3VDDB 1D4M3 2Q2EB 1UU5A 4MQVA 4CDUC 4YG6A 3H9QA 1GNYA 1PVXA 1LAJA 1MH4A 5A6ZA 2R7FA 4IV1B 1MS5A 4V19K 1GUIA 2XOMA 2JA6J 1HRV3 2P17A 1MS8A 3H9JA 2L4MA 2VUCA 4YZ2A 2QTWB 4WXDA 1FC3A 1TZOA 3CU7A 3T4HB 3TW6A 4ZDPA 1AX0A 3ZX7A 4AXOA 5FY4A 5L36A 3ETPA 5LGUA 3DWLE 1J1LA 4CCOA 3JRBA 3IB3A 5E3OA 3AFHA 2E1MB 2ZX0A 4ENMA 2ZJPF 2MBFA 2HOAA 3WODF 4BUPA 2D5VA 1Y8RB 1QQP2 1GP5A 4CSWA 2YUSA 2JG8A 4KDPA 5FYYA 4FSJA 2R7XA 1XOYA 1QY4A 1LU2A 2WWUA 3OBTA 2EF6A 4HX8A 1K7AA 2OPTA 1TNFA 1UELB 2M4GA 3AZZA 1P7JA 3E6BA 2RJLA 4AI9A 4HBNA 1W8TA 5J1YA 2NYXA 4XBQA 3GF6A 1VBA3 2FCUA 3GTMJ 1YIFA 2GN7A 5IAVA 5D8AB 5EF6A 4IV3A 3ZOBA 3T3YA 3DUIA 1YIOA 2X6WA 4ZZLA 3U14A 2VQAA 1OCCH 4E7ZA 1AF9A 4D0PA 1KFUL 1T2XA 2WS92 4A12A 2Y0SN 3MIEA 2GA1A 3K4BA 4EJUA 4M3DA 2VNGA 3BODA 3RTRA 5JR3A 1ZRDA 3KS7A 5EG0A 3NQHA 3PLQA 3HEIA 3RPUD 1OKOA 2LNBA 2X09A 4LKDA 4B47A 1LOFC 3IPVA 1D2QA 3OL3A 1O57A 2GOMA 1S2EA 3ZSMA 3L2VA 2CQNA 2PHLA 2E19A 5ABJA 4LG0A 4EM1A 4E7IA 5ERLA 3HD8B 1IRGA 1V6LA 4XF4A 3OS1A 4Q4V1 2RC4A 4QX5A 1H1MA 1VZ0A 2QQNA 1IC8A 3QYFA 1V9U3 4L5JA 1NCQB 3CCYA 1BOBA 5L9RA 1GOFA 1NH3A 3LSEA 3S17J 3I2JA 4PK4A 4XOPA 3WUCA 3DYMA 4HEA2 3A4UA 5AVPA 1O3SA 2DFIA 1FBQA 4LLNA 2XBO1 3V0AB 1F4AA 1O7LA 3EYIA 1UXZA 3GCXA 4W6YA 1T6SA 4W1UA 4LHLA 1O3TA 2HH9A 5HPOA 5EIYB 2YU9J 5LHIA 2VUAA 2GAUA 4JHZA 4LBQA 2WV0A 4R1HA 2HWE2 1VQ7I 5BS6A 3H8XA 3R4SA 3QPLA 1F9KA 1OQ1A 2B9VA 3I3BA 2FUG2 1RVF3 1YNAA 1BR2A 1W8NA 4PJMA 2GIZA 4GZ9A 1QNYA 5FZGA 5C8CB 4BYYA 2W39A 3BALA 2IA2A 3HOUJ 2DCZA 1APLC 4E7HA 3MFAA 2W1SA 4BS9A 5DAWA 5FLVA 1PMHX 1FOD1 5F0HA 2OQ7A 1HLCA 2RS31 1MNEA 4RA0A 2YPDA 2LG4A 1AR71 2PLYA 2P6HA 3CF6E 2QF7A 4B3NA 4IO9F 4NC7A 4QD2A 3QQAA 3C2UA 4UW4A 3SHFA 3TN91 5L19A 3IAQA 1UKRA 3KGZA 5KHIA 1VQNI 1ON2A 5DG2A 5GJ6A 4Q1PA 2HQAA 2VJ4A 1UOGA 3W2WA 2ZX1A 3TO9A 3MBWA 4FVVA 3VV1A 3FXRA 1A6CA 3CJXA 4RM3A 4BEHB 3M3OA 3KZ4C 5JHUA 1ULCA 1TT0A 2EPFA 1NUKA 1OHFA 1NG7A 4LPLA 2P3JA 3NJYA 2HQNA 3EUHA 1GANA 4BQ5A 1OQDA 2UUZA 5D2AA 1J3PA 1CX1A 2CWSA 2AXTC 3DBRB 3TOBA 1ZRFA 1JZ8A 3I4NJ 2M9HA 2OX0A 4FO9A 3GMEA 1LRHA 4PSWA 4QX1A 1H9PA 4ATEA 1R71A 1RIOH 2KZGA 3LOBA 2E35A 2XHNA 3UESA 5DQ0A 3BG7A 1W04A 1K6OA 2OV7A 2AQFA 3VYSB 2TBVA 3OTFA 4TLFA 1ZG1A 3T5XA 1IG3A 3Q3SA 4YIFA 4AL9A 3MZHA 3H3LA 3OYEA 1UZZA 3S1QJ 1V6KA 3QLQA 3HBZA 4QHOA 4P9IA 3RMYA 2XAJA 3N97A 1BCXA 5F1JA 1YQ8A 5FYZA 3VBUA 3OYWA 2YS9A 2UYAA 1AA7A 3BOPA 1FYMA 1KYZA 1XSQA 3MFKA 4IGQA 2DMQA 5IOZA 4EROA 4GMP3 3S30A 1B72B 2BUKA 4COUA 2NQYA 2RVCA 4A4AA 4FPCA 2HYJA 3CHXA 2BXYA 1OVSA 2DVGA 3PVNA 3ZXFA 3BJAA 1FPN2 2BXZA 2RQQA 5L9VA 3NVCA 5J1RA 3JREA 3O8GA 1OFNA 2VXJA 3LAJA 4P9XA 2XJTA 3HPHA 1JZ2A 4Q4Y1 3FF5A 4RSUA 4AHXA 3I4IA 1TTYA 5F2SA 1KRIA 4BE0A 2A71A 3AYCA 2RM23 5HCAA 1O8SA 4UW3A 2ZHMA 3LKJA 4RS5A 4B43A 4WVVA 2KIUA 2LDUA 3RZHA 1W0TA 3RIRA 4WM7B 4TSVA 1AYM1 3OB8A 3ZN0A 1K6YA 2DFEA 2K4BA 1VBC2 1UOFA 1RL3A 5BNNC 3K1NA 3EXUA 2VMFA 2V9PA 2YGLA 3HOVJ 4ETSA 2QSFX 3F8MA 3ON7A 4KG8A 3M1HA 4M3CE 1O3RA 5IT9K 4NRPA 3GVAA 3U4XA 3ZYFA 2QGUA 3HTSB 5FYTA 4K1ZA 1RIRA 3S2WA 3UETA 4E4HA 5JIUA 4TXWA 4KMFA 1XNTA 4D5CA 4PJYA 1MS4A 3OSFA 1VFCA 3AXDA 2LKSA 4EM0B 1LEMA 2DU1A 1DLCA 1RUH3 4OZXA 3HPGA 1Z0XA 1G9CA 3OGGA 3WW1A 1GWMA 1C0WA 5LZ6A 1R4MB 4LK7A 3U4SA 3OYJA 1AR92 3LFKA 3GTQJ 3RWKX 1B9NA 2FX0A 2HKXA 4OULA 4QDRA 1YFXA 1VQKI 5JOZA 1Z3XA 5FKNA 3PQKA 1MMGA 3GFLA 4PZJA 3I4PA 3HWJA 2MEV3 1ETVA 2A6XA 5HCHA 2WC2A 1WCKA 4OMCA 1Q8VA 2WA0A 4RR3B 2ZKNA 2CSGA 3TBDA 1AL0G 1ZYBA 3B9CA 3PVOA 2HWF2 4BK4A 1B1BA 3AG4H 4IRHA 1UYXA 1BZWA 4FFGA 5GZFA 1S0JA 4NAOA 4CDUB 1O7FA 4NHLA 5FZEA 2A5YB 3HC7A 2JENA 2VKEA 3S1RJ 2ERFA 4ESJA 2BHZA 2K86A 1PMJX 4XFFA 1F31A 5ILVA 2I45A 3JRCA 1Y39A 1J59A 1OLMA 1J3QA 1SAUA 1DBNA 4CGZA 3KT1A 5I93A 2IC1A 3PQJA 3OEAA 3GWZA 1SG3A 1MKMA 4OWRB 3ROUA 3U21A 3THDA 3S8PA 4LBQD 3CMEI 3ECOA 3S14J 4BOWA 3S5AA 3LQRA 1O6UA 4O3MA 1K5JA 3PNYA 1U0AA 1E57A 2JIGA 2XPVA 4N7IA 4JC1A 5J09A 1RR8C 5C33A 4OIQF 1CPNA 3GNEA 5DV5A 4HF0A 4ZXKA 2OS2A 3IUOA 2R7SA 1PM7A 4MTDA 3WW3A 5T5OA 4FCYA 1UY2A 3QODA 2Y6FA 2QEXI 2H27A 1D5VA 1LDKB 1XDUA 3PUFA 3D5RC 5A7NA 1ODNA 1OI6A 1ONVA 3BTYA 4YIRX 3RZGA 1O59A 3POGA 1VQLI 4ZU7A 3LEMA 1FIPA 1ZR2A 1QQIA 1Z77A 2N8GA 2K2SA 3UT0A 3IRRA 4BBRJ 1BN5A 4HV5A 5IOYA 4PIZA 1FATA 3RQ4A 1XC6A 2K0GA 2O8KA 4LO7A 1I3AA 1W05A 3F2ZA 1H9GA 1RNLA 2VJJA 5BNOB 1URXA 3EYYA 4GJZA 2EIKH 2WAOA 2Z4FA 2JDMA 2WAQN 1GZWA 1YLFA 5E3MA 3G71I 1WH5A 4DXRA 1RUG2 3DXJF 3IKVA 1UYYA 3DECA 4XONA 1K45A 3LNQA 5E89A 3S1NJ 2ZAHA 3EJKA 2K40A 2WV1A 4RLQA 2VKHA 1WLDA 3MKWB 3QBQA 3KF5A 4G94A 3PURA 4TTGA 3FM3A 3OYAA 1S0GA 1HDPA 1W3XA 1ON1A 3TNPB 1Z6TA 2WJSA 1QJY2 2COBA 2JSPA 5E1WA 4NNJA 3CQOA 1IRZA 5AVAA 4AU7A 1LVKA 1WJEA 4UV9A 2BWAA 3O1VA 5FD6A 2HWD1 4HDVA 1MSFC 1AOYA 4IJAA 5FY9A 1EV11 3GTJJ 5E8IA 1A34A 2JA5J 1PHMA 1RC9A 1USSA 1WVRA 1H0BA 2KKOA 2NM1A 5FY8A 3V56A 1GZ9A 1CJDA 4ZKTB 5DXDA 1T95A 4DJAA 1YI7A 4BCUA 3Q9OA 5L7OA 2H1LA 2G4IA 4LK6A 3PIGA 2D6OX 2WBKA 1C8NA 3RDIA 5IVYA 5CYVA 2DVFA 4Y20B 2RS12 4NHMA 1JT0A 1BQPA 4JGZB 2WO2A 2B8MA 2D3RA 2HTJA 2HNHA 2RR11 2QQIA 4GRIA 5SV5A 2Q0OA 2RMU1 1N78A 4A3DJ 1MS0A 4INDA 3VSKA 4BXXJ 5IT3A 1W28A 2D44A 1FX7A 1AHSA 2JMWA 1GZTA 2ADUA 3LEIA 4A3JJ 1OF3A 1OA3A 1U12A 5FBZA 5K0UC 5CADA 2D93A 1F2NA 3IHUA 4HNUA 1R092 2VC0A 3NRUA 3NNMA 3R0RA 3MQ0A 1UMIA 4IPAA 4IGOA 3B6AA 5B66C 2BZTA 3ZFFC 2FZ2A 4XW3A 2JECA 4RGSA 1ACCA 3T8TA 1LHVA 4QXBA 1VJ2A 1JZ6A 2WT2A 2E31A 3C18A 3DKXA 1QXJA 3CC4I 2J1SA 1U9NA 3OY9A 1XE7A 1Z05A 1HQLA 3F0CA 2Z42A 5JZGA 5BUVA 2IXCA 2F4PA 2VZRA 5A3TA 3OIQA 4M3EA 4N53C 3TYJA 3ZFEA 2ES3A 1V4RA 2X6YA 5KR7A 5D5UB 2E26A 1HQNA 2WYFA 1C5IA 3DPRA 4M9XA 1PP7U 2ORZA 1R1VA 4QWQA 3JRFA 4I3GA 1PGW1 2PELA 4HF1A 5E6HA 5F27A 2VQTA 4Q26A 3H5AA 3CMMA 3FZ3A 2WWYA 4LORA 1LQ1A 4EWDA 4AVSA 3WP5A 2MA3A 1PVC3 2XPUA 5IK5A 1QIQA 4M3CB 1JXNA 4LA2A 1UJ8A 3WG2A 1OUSA 4AEKA 4J01A 1LOGA 1MPXA 4GYGA 5A32A 1IW7F 4KU8A 3LA2A 1G8WA 2QCOA 2R30A 4XUQA 4BQXA 3OYMA 4X6QB 1FMWA 2VZVA 2PMZA 1UFMA 4GQ7A 5HLHA 1MJBA 5E1ZB 4YVSC 2YBSA 3M7AA 5A3MA 1FAYA 4OCTA 5FO9B 3CMGA 3K48A 2IXHA 3BT9A 3N3HA 3AMQA 1VBB2 2EFWA 1PIV3 4MGQA 2L02A 3Q9VA 2A3XA 3BYWA 1ZGJA 4XJZA 2QQ8A 3ORJA 2R073 2PMHA 2XAFA 3LSJA 4AD9A 2ID4A 2WYSA 1CN1A 1W8UA 4XICA 4AEJA 5BNNB 4Q4V3 2DQLA 4PDWC 3EETA 4GFBA 1SLBA 4H2AA 5FZ3A 4N43C 3VKLA 3D6EA 5FLXK 1I9RA 4J6GA 3F8FA 5LWBA 2I5UA 1I1SA 4EWEA 3OG2A 2UWBA 3P3NA 4FHTA 1D0GA 5F6FA 3OYNA 4A3ZA 3IKWA 4JRAA 1WH7A 3DXUA