2FMYA

Co-dependent transcription factor cooa from carboxydothermus hydrogenoformans (imidazole-bound form)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
ATQMRLTDTNLLEVLNSEEYSGVLKEFREQRYSKKAILYTPNTERNLVFLVKSGRVRVYLAYEDKEFTLAILEAGDIFCTHTRAFIQAMEDTTILYTDIRNFQNIVVEFPAFSLNMVKVLGDLLKNSLTIINGLVFKDARLRLAEFLVQAAMDTGLKVPQGIKLELGLNTEEIALMLGTTRQTVSVLLNDFKKMGILERVNQRTLLLKDLQKLKEFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords carbon monoxide oxidation system transcription regulator Coo
publication title Crystal Structure of CO-sensing Transcription Activator CooA Bound to Exogenous Ligand Imidazole
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Dna binding protein
total genus 67
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fmyA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2fmyA01
4YYOA 3EHKA 1OI6A 3ECOA 4O9EA 4E2GA 5CADA 3QP5A 5HI0A 1WLTA 3PLQA 2XVCA 4JTOA 1Z1DA 3WGHA 4UVAA 2C0ZA 4E70A 1YLFA 2ISYA 2P6TA 1ZZ6A 1G6NA 3OOPA 3MCZA 3I59B 4CYDA 2A68F 4WZCA 2YX4A 1ULYA 2ESNA 4XF4A 1R1TA 1BI1A 3WGIA 3GX4X 2PAEA 2UWMA 1ZX5A 1LB2A 5E8IA 3RPQA 1IXCA 1LDJA 3MEXA 5HLIA 1FSHA 1RNLA 4ZZLA 5K5OA 2O1QA 2R7FA 1OKRA 5ICFA 2MHFA 2O61A 3FMQA 4Y17A 2X4HA 4QWQA 2K0GA 1OYIA 2QZ8A 3KP6A 4UVBA 3BDDA 5K5QA 3R6SA 2QLZA 1J3RA 2XL9A 4AD9A 1O3RA 3VEPA 3E5QA 2PAMA 2FQPA 1LDDA 3RDIA 3KLOA 3IL2A 5TRDA 5LBQA 4XEZA 1YS7A 4IHTA 1EPZA 3CF6E 4L5IA 2H27A 3R61A 4LEJA 2CW0F 1P4XA 1SD6A 1PP7U 1RI7A 3CO7C 1WWXA 4M6XA 3REOA 5FGMA 1FT9A 1J5YA 2NRAC 1KA8A 1JHHA 1DZTA 2VBXA 1HQCA 3GFJA 3K2ZA 3DF8A 4AVAA 2WWYA 2IA2A 3I53A 1UCXA 4KT5C 1J7KA 5ED4A 5L3GA 4J1WA 1OPCA 4UV9A 4LUKA 4WF2A 3M9AA 1J0RA 1U12A 2QQAA 1MJBA 4XF9A 2MA3A 1U6GA 1MDMA 5CVJA 4RAYA 4OIRF 4MGZE 4LK0F 3M8FA 3JTHA 1W5SA 5LGTA 4R1HA 1HKTA 4I2OA 2IW5A 2FNPA 4M73A 4BAYA 1O3QA 1FPQA 2OYZA 5HDNA 1L3LA 1B9NA 4ASNA 4RB0A 2PFWA 3GEZA 2F5FA 2XLAA 4S05A 2PA7A 5HS8A 1QXRA 3HUGA 3AAFA 4G94A 4WXCA 3K1PA 2YX7A 1NE6A 1HXDA 1CF7A 4IEVA 4YRDA 1P2FA 4IEUA 1U78A 2UY9A 1U5TB 5AVPA 1FBQA 2FEZA 1B6AA 5FFXA 5TJJA 4ZU4A 1SD4A 4RD7A 3FJSA 3GZ6A 5CU1A 3ES4A 1ZG3A 1SD5A 2IXJA 2BNMA 1SMYF 3WTTC 4JBAA 3WTVC 5C6CA 3LWCA 2GQQA 2CV6A 2IA1A 1PP8F 3DEUA 1KU3A 3EO6A 4UV8A 4KN4X 5BPDA 4AWXB 3ZPLA 1QO0D 1EH7A 2RKHA 5JAXA 3EETA 1ZHFA 2MH9A 4RAZA 3NQOA 1QBJA 1K78B 1FXZA 1TNSA 3ZMTA 1CX4A 5FCCA 1G3YA 4Q4ZF 4RGXA 4I02A 1J9IA 1HKSA 2AS5F 4KYWA 1RTVA 1S7OA 2VQAA 3B73A 1UW8A 5KHHA 2Y0MA 2UZKA 4A5NA 3SCFA 4OLLA 2HEOA 4L0ZB 5DUKA 5I8TA 4M74A 1CAVA 4L9NA 2D1VA 4EVIA 3ZP5A 1SFEA 3HHHA 2G7HA 5BPIA 3EQLF 1R1UA 2PQQA 4XFCA 5FLHA 1TTYA 2Z99A 2EA2A 1ZRDA 4WX9A 1TQMA 2HKXA 3GWZA 4IHSA 1P4WA 4A6EA 3HIFA 2GU9A 2ZCWA 1C0WA 3EJKA 3NW4A 1KGSA 4EM0B 4RGUA 2ZNZA 1TQIA 3BCWA 3KP7A 5D5UB 1E2XA 3M8EA 2V1UA 4EQQA 1UIJA 1TW2A 3COAC 1ZZ7A 2HQRA 1BC8C 1KQ0A 3KGZA 4KU7A 1CAXA 1ZREA 1Q5OA 3BP8A 2QNKA 3J81Z 2Z2SB 3KE2A 3ERED 3Q9SA 4AVBA 3SCGA 3KP3A 1P6RA 2ZJ2A 3RZZA 2TDXA 4XFAA 5DEQA 2MPFA 1XGSA 4BXUA 4DQ2A 3S2WA 1EP0A 4AQ6A 3DQVC 2MLKA 3I7DA 4D7SA 3NJZA 3OGJA 1EY2A 3EDPA 5J3UA 3VHRA 2A5YB 2HYGD 1R22A 1XGOA 4NHJA 3TNPB 3GW2A 2PMUA 5E1RA 4JV4A 4LLOA 2EB7A 4GO1A 2DQLA 1GQGA 3ST7A 1FYKA 2XIGA 3WTUC 1K7AA 3CUQA 1YFXA 3J81K 4FX0A 3R4KA 1FLIA 5FO5A 1Q1HA 2CGPA 3FFQA 2OZ6A 2OZUA 4HSJA 3RPUA 5FQ0B 2H6BA 1IRGA 1ZYRF 2QVOA 3U9GA 2NNNA 1B4AA 2ZKZA 1G4DA 3C3VA 3U10A 1SMTA 3TO6A 2PJPA 1S29A 4FAHA 2LKPA 2M87A 4MTDA 2A6HF 4IETA 3F8CA 4XF0A 1ZGJA 1R1VA 4HX7A 3RTRA 3B02A 4XF1A 2JTVA 2F5EA 2L3DA 4LK1F 4IRIA 2FXAA 5A2QZ 3FHZA 1K6OA 1H1MA 2WTEA 4H7LA 5BPXA 3KSCA 3S0MA 2OQGA 1FY7A 5KHIA 4ENKA 4EGZA 5LEKA 3H50A 5I8SA 3BY6A 1J58A 2R3SA 3RYRA 3IRQA 3MZHA 5JR7B 1OR7A 3QPHA 3P7NA 3P9IA 3JSOA 2RVCA 5ILVA 4G9YA 4Q5SF 1GQHA 3ACLA 1GXPA 4L2NA 1S7AA 2Y48A 2CYYA 1T38A 1X3UA 4YIFA 4HVQA 2F5DA 4IEQA 3SFZA 2IXIA 4MHGA 4MNUA 2VT3A 1Y3TA 4N9HA 1ZRRA 2XL7A 3ABUA 2B5HA 2EAAA 1MJAA 2PLYA 2QUFA 3LAJA 1MDMB 3L2HA 2RV8A 5EEHA 5E17F 2OAZA 3BJOA 3KP4A 5A2QK 1MJ9A 1O5LA 3WE2A 4AVCA 2RQPA 2E7WA 1BBYA 2L4MA 4QGNA 2XAHA 4IPAA 4IEOA 2L01A 5E20A 2OQRA 3G3ZA 3LAPA 4PDKA 4BQAA 5T3NA 5LGUA 5E1WA 3OF1A 3KFWX 2XROA 4WXDA 1ON2A 4Z2YA 3IKVA 5J8FA 1WSUA 5ILSA 1QGPA 2VE8A 5BUVA 4JTNA 5BS6A 3IRRA 2B9UA 5JSOA 4HV6A 1G3SA 1CF7B 2NS0A 4AVPA 3P9CA 1ZNPA 3HTUA 1UPIA 5D8KB 3FM3A 2DAOA 4HYEA 2HTJA 5FLIA 3S7EA 3KETA 2F5CA 3E5XA 3QP6A 1KYZA 1S6LA 2VODA 4HBNA 2HZTA 1CAWA 3PNAA 3E6BA 1XCBA 4QXKA 1WI9A 3IWZA 2COMA 4UVCA 4BIFA 1V70A 2WC2A 4EJOA 1IN7A 1ZZBA 3HRUA 1LR5A 3CJNA 2HDCA 4IESA 1BN5A 1NHAA 3DPLC 3CEWA 4UBGA 4KWLA 1QZYA 2GWRA 3GF2A 5JHUA 4XFGA 3KZZA 2E7XA 3PQJA 2YR2A 2DK8A 2DPUA 1XSXA 2MBFA 3WU1B 3F8MA 2DBBA 2PQ8A 3HTSB 2IC1A 5LRSA 1JHFA 4O5VA 2HOEA 3TQNA 4RB3C 2CG4A 2FBKA 4O9GA 4NVPA 3CO2A 4Q0QA 5LLQA 2P7VB 1V4RA 4AXOA 1XSVA 4XBFA 2XKOA 2I45A 2GA2A 4D0PA 1XD7A 4DNCA 2FSWA 2YU3A 1LQ1A 4UXAA 2W85A 2ISZA 3W6JB 3FMRA 1CAVB 1MGTA 1LEAA 4MGIE 4A2UA 3LQRA 3FE5A 4B09A 4QGMA 2H94A 2J5PA 4A0XA 3ML6A 4MTEA 2YSRA 3NSTA 2P8TA 5I91A 2HJIA 3PFIA 4AIKA 1NXMA 2ET1A 1IN4A 3MZYA 2D5HA 2KRFA 2IXLA 2GC3A 3RNSA 1VP6A 1J75A 4I98B 3W6KB 3ELNA 5JI6A 3IC7A 1R23A 4OINF 4BHBA 1B9MA 2KIMA 2NNYA 1SFNA 1Q43A 4HAMA 2VC1A 3FZVA 3KP5A 1FBSA 2OPKA 3FHIB 2E9QA 3FX3A 2E1NA 1CAXB 4IEPA 1ZG1A 3SZPA 2FU4A 2DU9A 3FF5A 4A12A 2GXGA 3J80Z 1TLHB 4BYYA 2BGCA 5KHKA 5HVQC 4LLGF 1DGRA 3L9FA 3O6BB 1F1ZA 4ESBA 2B8MA 3M3IA 2W25A 3T8TA 5JR3A 5CYVA 3KP2A 5H20A 4LB6B 3VODA 3WTWC 1MD0A 3HYIA 1QQIA 5BQTA 2Z5UA 4OIOF 1SD7A 3DXJF 2K86A 2FA5A 1BC7C 2K7LA 4KL1A 1YG2A 4I09A 4OMZA 1FBUA 4U0VA 1REPC 5ILUA 3MAJA 3TOBA 1RZ4A 1LRHA 3DPTA 1TQ5A 1Z6TA 1LNWA 4ETSA 4IEYA 1EH8A 1ZRCA 5CVRA 3M70A 2KIFA 2H6CA 1PUEE 3EBRA 2H0VA 1JGSA 5HS7A 4WCGA 1O3TA 4HLXA 5ICCA 2P5LC 4L9JA 2Y75A 1ZZ8A 1ZLKA 2DO7A 4LB5A 1D8KA 1T98A 5AIPA 1R5GA 1SFXA 4U88A 4AIJA 2O0YA 1D8JA 4ZYHA 2ETHA 1W5TA 4DINB 1LKNA 1XGMA 3J80K 1YLLA 4LA2A 4PCQA 1H9GA 2HTSA 4P5OA 2ESHA 1YS6A 2IP2A 4OMYA 4F7ZA 1R36A 3E6DA 5JSRA 4YSFA 1NYWA 4FX4A 2IT0A 4MX3A 3GYHX 4FT8A 2G7UA 1LVAA 1J2XA 3H7JA 1XDSA 2O03A 1USSA 4X6RB 1RC6A 2PHLA 4L9TA 3TGNA 3L00A 4LGWA 1O7LA 2DW4A 2M30A 3IHUA 1ZG5A 5KBFA 1SAXA 4KICA 5K8SA 4D7TA 3N97A 4LUMA 2ZMEA 1UHWA 3RI4A 3D0JA 4QLCU 3V7SA 1UFMA 4G6QA 1XRUA 5J48A 2VBYA 3MQ0A 3HRTA 2JRTA 3RIRA 1BIAA 1O5UA 1ZVFA 1IXSB 2VBZA 2JZYA 2XKPA 2RC4A 3CLOA 5F6FA 1YFYA 3ZDSA 2WV0A 4Z82A 1I1GA 2R7DA 3FXRA 4P55A 1QPMA 5E8GA 4WBBA 1ZRFA 2Z9OA 3U0ZA 4LJZF 3IDBB 2QJVA 4AQ2A 3USSA 1YW8A 3LZZA 1YW7A 4AIHA 2OD5A 2OZJA 2OU2A 4XLPF 1J3QA 4MGKE 4EJVA 4YNIA 5D4SA 3HSEA 2QM3A 4WWCA 4E2QA 5H6QA 2GA1A 2OBPA 4JK1X 3QU3A 3ES1A 2IJLA 1QY4A 4ONUA 4MEYF 4IEZA 5CLSA 3GFLA 1X82A 3DV8A 3QU6A 2Q4SA 4BH9A 2GC2A 1ZGAA 1YTYA 3E6MA 1WRJA 2PHDA 1L0OC 4XFFA 2HWVA 5C8WA 4J1XA 2FF4A 1BI2A 1W7PA 1IPKA 3ECHA 3R0JA 1K79A 1RGSA 5LRRA 4KA4A 2KJBA 3EUHA 3NRVA 3SXWA 5D6EA 4Y15A 3CUQC 3WTXC 5I93A 4KWKA 1IPJA 2IVMA 1KU7A 2D5FA 3TNQA 2M1BA 5BOXA 4M72A 2QDRA 3LA2A 3I54A 3LOIA 1XSDA 1S8NA 5I8YA 4UUVA 3R60A 2PAKA 3WG9A 2EFWA 3Q5FA 4KUMA 5AONA 3WTSC 4CHUA 1FP2A 2YPRA 5LGNA 4EJUA 1U8RA 1FNNA 1OYWA 3H3UA 3E5UA 2BBYA 2GZWA 3SXYA 1BI0A 2PMHA 2DLLA 2DQRA 3I64A 1VTNC 1H1IA 1HKQA 3HSFA 4YARA 2JSCA 3HRSA 4Z07A 3GZ5A 3WW3A 4HQEA 3BU7A 4I7HA 3K1NA 4KIFA 4QM9A 4IEXA 1ON1A 2VECA 1T0FA 3KMHA 1JUHA 4F8AA 5FDBA 3HHGA 2P5VA 4EJWA 3PQKA 3F21A 1T2KA 2QBYA 4HMZA 2G9WA 5E1XA 1BIBA 2IRFG 1P4AA 3BROA 5K5RA 4LLLA 4KIBA 4OOIA 3GFMA 3WW2A 2GXBA 2P6SA 1FOKA 5IT9Z 2FMLA 5D6FA 5E16A 2PN6A 5D5WB 2P5KA 1YUDA 5F1RA 4A6DA 2EWNA 3T0YA 3KGLA 2XLFA 4YFKF 2V79A 2O3FA 4IERA 3EYYA 1T6SA 2Y0OA 3ETQA 1EV7A 3C18A 5KHGA 4NB5A 1KYWA 3L09A 1YO5C 4L11A 4ZH4F 3ZMUA 2XAQA 1Z9CA 4H0EA 2STTA 1UB9A 3MFKA 1I6XA 3P9KA 3BALA 3D5LA 4Q0UA 3MYXA 4JQFA 2ZXJA 1DPRA 2GC0A 2ELHA 4PGHA 2F2EA 4BHCA 3J7AO 4Q48A 2BEOA 4XF3A 5IT9K 2XAFA 2UXNA 4Q47A 4EROA 1FC3A 2VXZA 3C3WA 1U5TA 1G3TA 3ELKA 1EH6A 2OA2A 4HBLA 4NQWA 4O3MA 3QOPA 1YFUA 4OU0A 3FWEA 1FI2A 1U2WA 2EFOA 4LLNA 3DN7A 1JXSA 5LEJA 1OD5A 4L18B 3DL3A 4R8HA 4MUVA 2K27A 2CQKA 4LA3A 1KQ9A 4CICA 2M45A 4XETA 3RKXA 2ZFWA 4PJYA 3D0SA 3VOEA 4N0BA 5JSPA 4A5MA 2XAJA 5DD8A 3RKYA 4I01A 4BNCA 3ZMDA 1RL3A 3IWFA 3M1EA 2K4JA 4UHTA 3MPBA 1X8EA 3LSTA 4QM8A 2N7GA 3VFZA 3O14A 2V9VA 5FD5A 3WU0A 1AOYA 3SHRA 3K1MA 2X0LA 1HW2A 2Z3YA 3WW1A 2WFPA 3SCHA 1UD1A 1PM7A 4HSLA 3G73A 3I5UA 3BOQA 3OCPA 2A6EF 1HW1A 4G8XA 5EEGA 3CO6C 4KNYA 2VBWA 5L3BA 2IPQX 4FBFA 4YG2F 2LF8A 4HDVA 2PI0A 5F64A 1ZZCA 3T8RA 3UKTA 3I58A 1J59A 1QWRA 4RGRA 1WQ2A 4RS8A 4IF4A 3DKWA 3OV8A 3Q9VA 3HSRA 4K8FA 2W84A 3QAHA 4M9SA 4XFHA 1Q3EA 2GH2A 3ISPA 3HT1A 5BMZA 2VT2A 2ZMEB 4UNOA 3IKTA 5D4RA 1HSTA 1YW9A 1G3WA 2FNAA 5CVUA 3GO5A 4L9VA 2PEXA 2FBHA 5ERIA 3F72A 4GXOA 4HVRA 3H8UA 2Q0AA 3KCCA 3F6OA 5I0RA 4HF0A 1BOAA 3EQEA 3GLXA 5J6XA 4X6QB 3CLPA 5DV5A 3BPZA 1QNTA 5I0SA 4L5JA 2FRHA 4M9XA 3S7IA 4K2EA 1YFHA 3H3ZA 1TQPA 5BXXA 2LDUA 2A07F 1P92A 1D3YA 2VE9A 3T1BA 1OFNA 5HOOA 1KQ8A 5L3CA 1R00A 1E17A 1I27A 3ZMVA 5HDKA 4TV7A 5FFZA 2DCTA 1LJ9A 2QQ9A 4YFXF 3SZTA 4LG0A 2Q2EA 2FMYA 4WVZA 4HDUA 1SFUA 3JAMZ 3QACA 2XRNA 6PAXA 4CZZA 1W7PB 2VN2A 4GYIA 4EGYA 3QRFF 1STZA 2XUBA 1WA4A 1I1SA 2QVSB 2EV5A 5HDGA 2RDPA 1RUOA 1WKMA 4HLTA 2ZNYA 4I3PA 3GVAA 2BNOA 3BZ6A 4ZYDA 2O8QA 2ETEA 5J7MA 4PIZA 2QQBA 4ZYEA 1R5HA 5JVTA 2EV0A 1XMAA 2VPVA 2JT1A 5FQ0A 5L3FA 2PBIA 2QWWA 2V6CA 2F4PA 2XAGA 4EV0A 3L2CA 3BWGA 2XHKA 4G7OF 4XRFA 2EFNA 3EYIA 2ZBKA 1MZBA 2ATFA 4QMAA 4WXHA 1Y9QA 1ZLJA 3CUOA 4HVOA 4CO8A 4ESFA 3G7DA 1HW5A 3JAMK 3SHFA 3V7RA 3FXQA 2HGCA 4TLFA 4HLYA 1A04A 2HQNA 2K9ZA 1PMIA 5FPZA 3O2PE 5D5VB 3HQXA 3CL1A 2CFXA 2L54A 1JE8A 4XSXF 4PIYA 3K69A 1YHFA 1XE7A 3SMHA 5DCFA 3NKTA 2MD5A 3BJ6A 3ZN1A 2W24A 4G7ZF 4KIGA 2DK5A 1IF1A 4LULA 3V7CA 3F8FA 3OD0A 2EA7A 4U7DA 1UIKA 2QBYB 2HFHA 3E97A 2EFPA 2FBIA 4Y13A 1QXJA 2VC0A 1DGWA 2UYBA 2FE3A 5D5XB 1IAWA 3CUQB 2RNJA 5DCMA 4M71A 1LDKB 1TNTA 4IEWA 4U0YA 3UKNA 5HLHA 3V4GA 4ENMA 2BV6A 1YWKA 2UXXA 2D45A 3TKYA 1MKMA 1DUXC 4YFNF 4RGSA 1CAUA 3ABTA 1NZCA 4ORFA 2EV6A 4CGZA 5KHJA 5CJ9A 3WTZA 4ENNA 2MH2A 4RB1A 1DPUA 4BHPA 4ZYGA 2Z33A 1IN5A 1DDNA 2IA0A 3F3XA 5I0TA 2HYFA 3TO9A 4A0ZA 1U3EM 2V1DA 2XLGA 2JPCA 2LNBA 3GUDA 5J8CA 2FQ3A 3L7WA 2EA4A 3GXOA 4S04A 2V09A 2MLGA 2DT5A 1O3SA 2FOKA 4LMYA 5L3DA 3C7JA 4HA8A 4Q0PA 2QENA 4MV2A 4EWEA 1V3FA 1HBXG 4LTAA 5KVRA 2ADUA 4GULA 2Q30A 1R7JA 4KDPA 3GBFA 4KN7X 4HZFA 3ULQB 3MWMA 4CDGA 5ICEA 2ET7A 4XFBA 2BYVE 1H0MA 3F8NA 1R58A 1TW3A 5HLGA 2ZKLA 3JW4A 4IRHA 3CDHA 2IXCA 2D93A 5FPXA 4META 2RN7A 5E1ZB 2CAVA 3GFIA 4ZU5A 3CTAA 2EJRA 3FXUA 4PZJA 5D8LB 5CVIA 3WTYC 1XB4A 1FYLA 5JCTA 2L02A 5FB2A 2CWEA 3KLNA 2JPBA 1FSEA 3I0TA 1Z05A 3CJXA 4QGLA 4RB2C 1YYVA 2DPDA 2Q8KA 3SQNA 3RYPA 3WW4A 1BI3A 3FMSA 5HS9A 5FLJA 3HOTA 3F6VA 1GVJA 3DFGA 3I59A 5CVVA 4PGGA 4R79A 3MDPA 2ZO4A 2A3SA 2D2WA 3OTFA 2D40A 3PVBB 4M9ZA 3ZN0A 1CAWB 2XGXA 4KWJA 3IDCB 1J3PA 4XFIA 2P4WA 1T39A 4ESJA 4GYGA 1TBXA 2O8XA 4MQ9F 4ENJA 2DTRA 3LA7A 1IXRC 3NEUA 4I0AA 1RUNA 4HN1A 3O3KA 2D1HA 5EFUA 5JFRA 3LQQA 1ZARA 4MH0E 2ACJA 1EYBA 3JSPA 3RJPA 3KEOA 2L4AA 1DZRA 2PYTA 2BE5F 4L0YB 2A61A 3RKWA 4XSZF 1F5TA 4FAGA 4OIQF 1U5TC 1FWZA 2MNGA 4GGGA 3WGGA 4B8XA 5DYMA 2KIUA 1FP1D 2GAUA 5LHGA 5H6RA 1W7PD 2UYAA 2E1CA 1YIOA 3ZMZA 4P9FA 1H9TA 4LG0B 1ZH5A 1Z6RA 1SEFA 5KK1A 1Z91A 1CGPA 4OIPF 3KEQA 2Z69A 3HT2A 4UBHA 4ZZDA 2CSOA 2P7CB 1O7FA 3K9TA 4KMUX 2Q0OA 2HKOA 3IBMA 1KU9A 1VJ2A 3V8LA 4EM2A 4P96A 2J5OA 1FYMA 3H1YA 1IUYA 4XLNF 4WK8F 4ON0A 4Q0SA 2GC1A 4HQMA 5L3EA 4MQVA 3BB6A 3E3VA 3H7YA 3IIAA 2PG4A 2K4BA 2KJCA 1UHMA 2M8EA 3VB2A 1SQ4A 3H92A 2W57A 2XV4S 3QPTA 3FZ3A 3TOAA 1OYYA 2NYXA 3RYKA 1S3JA 1IW7F 1B1BA 4EM1A 3F8BA 5FLXZ 1X8MA 3V8JA 3ZQ7A 3NVCA 3U11A 2KKOA 3GYDA 4N9IA 2DFIA 2EK5A 5ICGA 3F23A 3I4PA 3FM5A 5I0UA 3TO7A 5D1IA 1F9NA 4A0YA 5LHIA 2K02A 1ZAOA 1LEBA 4MGRA 2B0LA 4U0WA 4HW0A 3ZMSA 3K0LA 2VONA 4HX8A 4MZUA 1BJAA 1XN7A 1Y0UA 3U2RA 2IXKA 3UKVA 2HS5A 4HV5A 2VOOA 1D5VA 4HOBA 3M7GA 2GIVA 2A69F 4KFCA 1IRFA 4O6JA 1XE8A 2LF7A 4IVNA 1FX7A 4OFGA 4KMFA 3C1DA 4U7BA 2EVXA 4R52A 2Q1ZB 4PIXA 2STWA 4IXAA 5FLXK 1L3JA 3KZYA 1IN8A 3ROUA 1F4KA 1I5ZA 1ZZ9A 1QZZA 5DCMB 2P17A 4LFUA 4FHTA 4CXFA 1Z7UA 1ZN2A 1K78A 2CAUA 4P9UA 1W4MA 4B29A 3TDUC 3TDZC 1YFWA 2QCSB 1RIOH 4EJTA 5IT3A 4HX4A 1CAUB 2CO5A 1NE4A 3H1MA 1BM9A 4MGYE 3BPXA 3I71A 3NL1A 4G7HF 4QX5A 3D82A 3R0AA 4GCVA 3N4MA 3HRMA 1IN6A 1ONVA 1XCVA 2AXLA 1PDNC 4UXNA 1DP7P 3LAGA 1XDUA 4JVAA 3LA3A 4KU8A 4HF1A 4EWDA 1B59A 1VR3A 5DUIA 2VOPA 1ODDA 4IRGA 4P9GA 3H9AA 2V1XA 3V8KA 2O6GE 4IJAA 1GHCA 5BV6A 4I0BA 3JTGA 5E18F 5DDGA 2MC3A 3E6CC 3WODF 1WGPA 4M6YA 3JZVA 2HR3A 3H1WA 2OA4A 2NAZA 1X7NA 1O57A 1IZ1A 1USTA 4MEXF 5FD6A 2RGVA 3LFKA 1HSJA 2PFBA 4Q0VA 3HOSA 4EMSA 4YIIA 4ZU7A 3DP7A 5EZWA 1UCRA 4LD5A 2PTMA 4Q29A 3T5XA 4E2SA 4HN0A 1OMIA 1KU2A 3BPVA 2QYOA 1FZPB 4HF2A 5BY5A 1O4TA 3F22A 1XGNA 5AIQA 2IXHA 2XASA 2C6YA 2UY8A 2BNNA 3U1DA 4EWAA 5LHHA 2LSOA 3BJAA 1XMKA 5K1YA 1YQAA 2M5WA 2H09A 1GXQA 3WE3A 5DD4A 1J1LA 2DI3A 4G6DA 3LWFA 2EFQA 2KXLA 1AWCA
chains in the Genus database with same CATH superfamily
3EHKA 3VZMA 2YPDA 3BZKA 1GLNA 1SDDB 1D1CA 3OR1C 2WSUA 4N53C 4BK5A 2AUYA 5FK8A 4UVAA 4EZHA 4E70A 1YLFA 2ISYA 1G6NA 3OOPA 3ZRGA 4HKLA 3SEEA 1RVF1 5KHDA 3MN2A 4XF4A 2PAEA 3VBHC 4MVTA 4E6KG 2VASA 5A6YA 2R0HA 1LDJA 5FY8A 3F2ZA 5HLIA 2LBFB 1ENXA 1BBT2 5K5OA 3NQHA 1BW5A 1YO8A 4UF0B 5IP9J 1Q56A 2QZ8A 3KP6A 4L8QA 3NJXA 4OAYA 5A7SA 2ORZA 4AQTA 5FUPA 1J3RA 2XL9A 1AHSA 5KCMA 1DGWX 3O0WA 1LOBA 4PDWC 5IT6A 4YG3A 5FYCA 4I0WB 1BR2A 4LQRA 1TP4A 4GMP1 5EP9A 4YGCA 2H27A 2BP6A 3S6PA 1AVBA 4CTEA 4IHYA 4M6XA 5FGMA 1FT9A 5F6LB 3VZLA 1PVEA 5T5JA 3IIIA 2X8KA 2QEXI 4R4XA 5FRNA 2ENRA 2E19A 3GFJA 3K2ZA 5KNLA 1UAIA 4AVAA 4OZXA 3FKJA 1WMFA 4RBOA 3MLJA 1SFPA 1UU4A 2L0KA 3M3CA 4LUKA 4WF2A 1J0RA 1U12A 5FZ7A 4CDWB 5IYYA 3RZJA 4AE2A 1DGWY 3ONQA 2Q1FA 4DFSA 1F43A 5CVJA 3P3NA 4MGZE 3I3MA 1X36A 5BNNB 4GIQA 1KJLA 5LGTA 2ERFA 1Y1WJ 3D4KA 1RMU2 1O3QA 3A0BC 4D94A 1BVVA 2VULA 1SBDA 3ZFGB 2OYZA 4FXGB 1ODNA 4YGEA 3I3LA 1JU3A 1MS4A 1NH3A 2WYFA 2F5FA 4S05A 1OKOA 3I2IA 2VZQA 5A6XA 4IO9F 1QXRA 3HUGA 3AAFA 1MVEA 3OS1A 2NQYA 3ECQA 5FJHA 4WXCA 3K1PA 1GZWB 3M4FA 1JYTA 4A3MJ 4B1LA 1HXDA 3OB8A 4IHVA 1TMF1 5AVPA 1COV3 1BL0A 1FBQA 2V5YA 3JRHA 1D4M2 3THDA 5FY9A 1B6AA 4R4ZA 3ZN4A 3JD72 4ZU4A 1NOVA 4RD7A 3FJSA 3GZ6A 2EIDA 4J01A 2VUDA 4FFHA 1EV11 1R082 2BNMA 4DUWA 1SMYF 4ASKA 4PSWA 3WTTC 2QQMA 2EIEA 5C6CA 2AQFA 2X53S 4GD4A 3JBG3 4GXLA 5A1AA 1HX6A 1ETXA 1PP8F 3DEUA 4KN4X 3EB7A 4AWXB 1JHJA 3ZMOA 4B7KA 4BUPA 3OYDA 4UW3A 4AK3A 3LSGA 1JZ6A 3BR5A 5J37A 2MH9A 3HEIA 2Y0IA 4RAZA 4XAAA 1IPSA 1K78B 1FXZA 1U9NA 4NC6A 3KQ4B 5CZKA 1TNSA 5A32A 1XXNA 5LK5A 3D1NI 1HKSA 1NXD1 3AXDA 3ME2A 1YJNI 1H9PA 2YROA 3JU9A 4XJAA 4XMAA 1NAEA 2VQAA 3B73A 1X1CA 3VYTB 3HKZN 4L0ZB 1GP5A 1H8TC 3VPRA 4A3ZA 5DUKA 4JRLA 3EUAA 1CAVA 4CCDA 2JIGA 4DRRA 3BG7A 4M3CF 3I2OA 5DXDA 3ZP5A 3OBAA 2G7HA 1VQNI 5B3SH 1TTYA 3O0VA 5FLHA 2EA2A 4NUBA 3GNEA 4BACA 2BXZA 3R0RA 4Y5SA 2D6KA 4WVMB 2JX9A 5EF6A 5EGOA 1Q8QA 5DZEA 5JHFA 2ZCWA 1QPIA 4CU6A 2YU9J 4R9AA 1VBA2 4H4KC 1YX5A 4E7ZA 4AYBN 2V1UA 1ZZ7A 5A7WA 2HQRA 2A71A 2IS6A 2R0QC 2R071 5C5TA 1BC8C 1HV1A 4JP0A 3SH5A 2FZ1A 2WT2A 5EXOA 5JIUA 2VC9A 3T30A 2RAEA 1PNFA 1JHNA 4LHLA 2Z2SB 2EAKA 3A0HC 5A3TA 3ERED 4A3FJ 4JGZC 3KP3A 1I9RA 4RS5C 2IEKA 2ZAAA 1EP0A 4AQ6A 5C3RA 3I7DA 4FPGA 3NJZA 3N9LA 3FXJA 4DOUA 2Q2EB 4KGGA 4QPIA 3OGJA 2W2IA 4RGKA 5C3QA 4B3XA 2HWF2 4RAGA 3TNPB 5E1RA 5KXBA 1WJDA 3MVPA 1HF0A 2NVTJ 2DQLA 3POEA 3ST7A 3NRUA 2XONA 1AXYA 3CCJI 2ARCA 4NHXA 1FYKA 1BK1A 4FX0A 4GA9A 1FLIA 3FFQA 4S2HA 2E53A 2OZUA 3RPUA 1MMDA 2HZDA 3USUB 5FZ1A 1R1ZA 1IRGA 5JR2A 2D43A 4AHWA 1MBFA 2NNNA 3ZKUA 5DMYA 2ZKZA 3C3VA 3U10A 2PJPA 1QVUA 2LKPA 2JA7J 1W8OA 4P9XA 5T55A 4XICA 4OVEA 2Y60A 4M3BA 3H9JA 1K6OA 2DXIA 3NWKA 4H7LA 4LXLA 2OQGA 4CCCA 3FFZA 3UT0A 2DDAA 3J7ZI 3FUOA 1XYOA 1WGXA 3BY6A 3T3YA 4LIVA 3NO8A 4GJZA 1OR7A 3QPHA 3P7NA 1EKEA 2HQ5A 2BBAA 4LNVA 5C9AC 4Q5SF 2LOOA 2Y9ZA 2XPUA 4L2NA 3B9CA 2CYYA 1OLQA 2MEV3 1X3UA 2JA8J 3BCAA 3TEZA 4PFOA 4YIFA 1JODA 4XMYA 3LFUA 5DAXA 2EAAA 2WZ8A 5CIRA 1MJAA 2F6BA 2PLYA 1MDMB 3L2HA 3KYCB 1LCLA 2HOTA 2JVHA 1AR82 4EN7B 3JRDA 3BJOA 4HETA 1HB1A 5A2QK 3CC7I 4A41A 2E32A 3WE2A 2RQPA 3DPRA 3LOBA 3GCWA 1W2AX 2XSJC 1XBFA 3ZQHA 2L01A 4XUQA 2VTFA 2OQRA 3G3ZA 3LAPA 3L2VA 1YHQI 1O6UA 4PDKA 4BQAA 2BVMA 4QHOA 5LGUA 3OF1A 2XROA 4WXDA 1ON2A 4TYSA 1MVQA 5GZGA 3IKVA 3TYJA 2E35A 4AU7A 1QHHD 4KITB 4ZHNA 1NQJA 4Q4Y3 5BUVA 3HJEA 4CEWC 4IHWA 5JSOA 4XQWA 4NPRA 4P5YA 1G3SA 3D3AA 2KR2A 2NS0A 2DVDA 2P4EA 1ZNPA 3HTUA 1UPIA 3C7GA 1VBD1 4Y1XA 4HYEA 2NOGA 2CW8A 1PO13 2RHPA 5FLIA 2QKDA 5CKQA 4RQPA 3ZQGA 2BZTA 1MEC2 1JZ8A 3KETA 4OI2A 2F5CA 1KYZA 2E33A 3ZR8X 1CAWA 3LD8A 1WZXA 3PNAA 3E6BA 3M1CA 1XCBA 4QXKA 5K7HA 3IWZA 4XBNA 5FPVA 2VW2A 1NG7A 4Q5OA 4MO3M 2FHRA 1ZZBA 3CJNA 4XKBA 4IESA 3CEWA 3IV5A 4YW5A 4XFGA 1QA6A 2R93J 2P3KA 2ZB9A 4H2AA 3GGLA 2DPUA 1XSXA 5HNFA 2DBBA 3J7LA 5FMCA 3SDBA 4MGSA 1COV1 1DU6A 3S3MA 2FBKA 4FI9A 4NVPA 4Q0QA 1A34A 2P7VB 4B47A 1XSVA 1GUUA 4XBFA 2XKOA 1UMHA 2OW4A 4W4ZA 2W85A 2DF7A 3PUAA 3HL2A 3VKMA 2A3WA 3VBUC 5FO9B 2ZX3A 4MGIE 3IAQA 3LQRA 2OKXA 4A0XA 4D5FA 3JBG1 1G86A 2YSRA 2BW8A 2HJIA 3PFIA 3I56I 2ET1A 1IN4A 2D5HA 1JUIA 2KRFA 2IXLA 1TWCJ 1Z7S1 3KV5A 2VCMA 3W6KB 2RS32 4BQQA 2BFUL 2ORXA 4BHBA 3BTLA 4BWOA 1Z3XA 2TRTA 4A3XA 1GDTA 3FZVA 4LO8A 5KC5A 3FHIB 4D69A 3FUQA 3AC0A 2QQOA 3QBQA 1FEXA 2E1NA 1CAXB 3SZPA 1LGBA 2FU4A 2VMCA 1DBNA 3FF5A 4A12A 2WA0A 3TW7A 2OX0A 1RUE1 5KXDA 2EH3A 2HXIA 2Y6JA 1RUJ3 5KHKA 5HVQC 1RHI3 2D6MA 4EEFG 1IUFA 5M5YJ 2B8MA 1IDZA 1A6IA 4B7EA 5JR3A 4FQZA 5H20A 2EICA 2ZMEC 3WTWC 2W1SA 3HYIA 3LGRA 1NUKA 3FBNB 4OIOF 3VZNA 2V73A 1OF4A 2K86A 3RZLA 3T08A 1BC7C 4I09A 5D8AC 1FBUA 5ILUA 1LHVA 2ZJQF 2HYKA 1LRHA 2ZJCA 2L9SA 2Z4FA 4EJRA 1W2OA 3AP9A 2H0VA 2VJXA 1O3TA 1ULEA 1ZZ8A 2DO7A 1U5YA 1JTYA 3HBZA 2XC7A 2P2KA 5AIPA 1L7RA 2HOAA 2JXAA 1SFXA 2RV9A 4ZYHA 2ETHA 1W5TA 3N9NA 3LSRA 5F5QA 1ZTRA 1RKTA 4KQ7A 2VCAA 1H9GA 1NA1A 3TL4X 4F7ZA 2DBIA 4Q26A 2EIKH 4YSFA 1P7IA 3KV6A 1NYWA 5LFAA 1PX4A 2VMGA 1DGRM 4C91A 4WV8A 1GLHA 2O03A 2PHLA 2QQNA 1V9U1 1XYNA 3TGNA 1W1WE 2DW4A 5BNOB 4RR3C 1VLNA 4IE7A 4FPOB 1ZG5A 4BQYA 1SAXA 2LKSA 3U21A 1SPPA 5F3IA 2R7UA 5K8SA 3KCXA 3N97A 4LUMA 3MLLA 1JKRC 2XBO3 2BOLA 4CDXA 5LK7B 3RI4A 1AKHB 2YS9A 4QLCU 5J4YA 4FP2A 3RIRA 2JRTA 1ZBE2 2VBZA 1XNCA 2RC4A 4BEHB 2DVBA 1YFYA 5ACA2 2CQQA 1I1GA 2ZACA 4QKDA 1M4WA 3BVCA 2MW8A 1OCRH 1F4HA 3QLQA 4LJZF 1DIWA 2QSFX 1S9HA 3W9AA 1YW7A 1S2KA 3MF6A 3J9SA 4YNIA 5F32A 3WNOA 3HSEA 4LKSA 2X6YA 3GTMJ 1NLRA 1R5ID 2QM3A 4WWCA 2TBVA 5H9PA 5H6QA 2NVUB 2XRLA 2OBPA 2BBVA 3ES1A 2W68A 1QY4A 5KWRA 2OC6A 1A6CA 2CSGA 2VJIA 1H9WA 4MEYF 2E1MB 3VSLA 4CU7A 3B3QE 3ZXJA 1N1SA 3T1LA 3ZXDA 4LK7A 1XU2A 2JUGA 3BQYA 2L7FP 4XFFA 1L0OC 3IN9A 5C8WA 4WM8A 1BOBA 4QKFA 3T0AA 3ECHA 4RHV2 2XJTA 1ASJ3 4XCBA 3WG2A 3EUHA 1FOWA 3CUQC 3WTXC 5I93A 1IPJA 1QOTA 2XB6C 3H8RA 2D5FA 2JDPA 2KZGA 2QDRA 1H4GA 2Q8DA 2EIGA 1E5RA 1U5ZA 2RMU1 3EYPA 1XSDA 3BZCA 5I8YA 4UUVA 3BLYA 1EAH2 3R4DB 3K70D 4ZYAA 2JB4A 3AMMA 1QQP2 2D7FA 4R9BA 4RLQA 1GFF2 2VQGA 3FMGA 1U8RA 4CP0A 4IV3A 1FNNA 4N8MA 4AYBA 1XX5A 4BXSV 2IS1A 3SXYA 4D1QA 2PMHA 1QNYA 1HN0A 1ULPA 1HKQA 4NIHA 3GZ5A 3V0BA 3K1NA 1PO11 3BTCA 1EUUA 4QM9A 4EE2A 4CDUA 3KVAA 4OUEA 5FXVA 4EJWA 1NCQA 5GAEJ 4HMZA 3BROA 1B35A 1IHMA 2BGPA 2GXBA 1FOKA 5IT9Z 1DYOA 2CJJA 4OQ8A 3PO3J 3POIA 2P5KA 3C8XA 2WDBA 4UFMA 4A6DA 3O5SA 3K10A 1ND3B 2EIJH 3KGLA 2D3SA 4CUGA 1UOGA 2XLFA 2V79A 3M7AA 2RQQA 3B7MA 3BT9A 3C18A 4BPZA 1TWGJ 2DURA 2WT1A 2K9LA 3SISA 5EQUA 3LSDA 3G6JB 2YB7A 3ZFEB 4XW3A 3BALA 3N7MA 3DEEA 2HWD3 1ND2C 2ZXJA 3KYDB 3PNTA 3NJVA 2VCBA 2F2EA 3IAM2 3J7AO 1JOJA 2PHXA 5CBLA 2BEOA 4XF3A 4C90A 1GOFA 2VXZA 1QF3A 5L73A 3UJQA 1W8WA 2ZSIB 5K7PA 1G8XA 1OA3A 4QPGC 1UPSA 2YU2A 4L99A 3TEYA 5EDNA 1E3OC 4LT5A 2KD7A 3J7HA 3T09A 3MIHA 4DEQA 5HCHA 3C2GA 1FI2A 2R30A 1U2WA 2EFOA 1QMJA 3CMMA 1OD5A 4M3CE 4E7IA 2VL4A 4Q4W3 4DYRA 3ZQQA 1AR63 1P9QC 4CA0A 5HBAA 1JGGA 2ZSHB 3RKXA 4KBBA 1XNAA 3HBLA 4N0BA 5JSPA 4A5MA 5DTDA 2XAJA 1H30A 1OLME 4KBZA 2VO5A 3N7JA 4BNCA 1RL3A 2K4JA 2W48A 2WADA 2DCJA 3OBTA 5J4VA 3LSTA 1AR72 1UYZA 2WV1A 1AOYA 4GWMA 2EZHA 1RUJ1 1RHI1 5FYMA 1POV3 2IFWA 3WV6A 3WW1A 2WFPA 5IFPA 3VDDB 3J7MA 5E3MA 3VHPA 3OCPA 2A6EF 1K6YA 5FJKA 5F64A 1ZZCA 4O7XA 1QWRA 1KJRA 2DCYA 1ORKA 3KT7A 2W39A 3OV8A 4CEYA 4K8FA 3QAHA 3L2WA 4M9SA 3FXMA 3O1UA 1G59A 3ISPA 4BXXJ 2RDRA 1WJEA 2WZR2 4CRQA 2C26A 4GQ7A 4JHTA 5KAFC 5D4RA 3IKTA 5K9YA 1YW9A 2W0XA 3KV4A 5FP3A 2DDUA 4L9VA 3NAPC 3VBRC 1C8M3 5FXWA 3HOZJ 4C2MJ 3WG1A 4AVTA 4QX8A 2WQ8A 1XQNA 2LY9A 4C3HJ 5CFCC 1BOAA 4YM3A 3K4ZA 1HJFA 4HG2A 1OA2A 3BPZA 4LBMA 5FMBA 1VQ6I 1ETKA 4K2EA 5DM7F 1TQPA 5BXXA 2KDOA 1POQA 3PL8A 3ZN6B 1D3YA 2RE9A 1KQ8A 1XC6A 2H0BA 2XBO1 1WBFA 4DIQA 2V5DA 5FYBA 3SZTA 4B44A 2WNVC 2FMYA 4FE7A 4HDUA 1SFUA 3QACA 2C9AA 2D44A 5L7OC 1QU0A 1W7PB 4BA6A 4GYIA 1F5FA 1POV0 4UUSA 4LBOA 2RNGA 2QVSB 5IK4A 2R7XA 5HDGA 1I39A 2HEVF 3LNQA 1Y39A 4LE3A 1PK6A 5J7MA 4XOTA 2QQBA 1R5HA 1RRJA 5F0FA 1XMAA 2JT1A 1UY2A 5C8CA 5FQ0A 2PBIA 2XAGA 5FXZA 1LHUA 3H5NA 2XF7A 2R6QA 4LBNA 3G1LA 2JG9A 1V6LA 1LE8A 4A3BJ 4WXHA 4C9YA 2O8OA 4JQTA 4IEJA 2ZTNA 1HW5A 2CGOA 4COUA 1ASJ1 1WW7A 4TLFA 5A3WA 3Q0UA 5FYSA 1PMIA 5FPZA 2ID3A 3HQXA 1LTEA 1W06A 4XJWA 4PIYA 5B1BH 1FOD2 2K85A 1G2HA 2MD5A 1JOPA 1Y7BA 2W24A 2VD7A 4INDA 4KIGA 5IVJA 4XM3A 4JX5A 2DVAA 3U07A 3S16J 2AXTC 1W6PA 3QH7A 4WVWA 2EA7A 3DLLF 1U5XA 1JUMA 2EFPA 4ZY9A 1NY71 2LY2A 4AYUA 4KJZA 1YJ9I 3J7AY 3VN4A 2FCUA 4V2VA 1LOFA 2WABA 3MKZA 2QQUA 3CHXA 1KQRA 1IAWA 5DAQA 1JKQC 1LDKB 1TNTA 2CFOA 3RZKA 3WQ7A 3VYSB 1GNHA 2IUWA 3TKYA 1JXNA 3ASOH 5G04L 3BR1A 1DUXC 2FJ1A 3P1IA 4RGSA 3OYFA 3HM5A 3BQZA 4XABA 2ZGNA 3QH6A 3ABTA 5B66C 1NZCA 3ACHA 5KHJA 2VE1A 2ZHMA 2J1RA 4Y20A 3WTZA 2DFEA 3H1CA 3J7YJ 1DDNA 1QJU3 5I0TA 1BVP1 4OUMA 4A0ZA 1OOPA 3PL0A 3ZN5A 3DCQA 5M5WJ 4ZZ5A 2JWTA 3OD4A 3OBZA 3FISA 1H2NA 1CJPA 5JUVA 3L7WA 2EA4A 3I4IA 2KQRA 2JKBA 1I3AA 2V09A 4B4RA 2MLGA 2DT5A 4BQ5A 3C7JA 1H2MA 4NQWB 2M0MA 2QENA 2UV1A 3KHCA 1OHFA 1V3FA 3BIEA 1ZBA2 3E7LA 3CC2I 1HXS3 1CX1A 4LTAA 4A3GJ 1SFYA 2YUSA 5A6ZA 3B6CA 2VL8A 4XNFA 2Q30A 3MICA 3WDVA 1IQAA 5AC93 3ULQB 1OCTC 2R4GA 5A3UA 2ET7A 4XFBA 3VKNA 3MIEA 1R58A 2ZGRA 4GALA 2M4KA 1T0FC 4Z2AA 2XWBB 4OI4A 3TN92 3NNGA 3ZXKA 1XB9A 1PO23 2XGEA 2CQ7A 3T2TA 4COVA 1XB4A 5FB2A 2VOTA 1RVF2 4Q4W1 1D1BA 5C4XJ 1AR61 4BOWA 2VMIA 5FZ6A 3SQNA 3RYPA 4CDWC 4MGTA 3FMSA 3HC7A 4BLIA 2K40A 1GVJA 1FIPA 1HIXA 4JKMA 5L9VA 5T50A 3N36A 4LBQB 1VQMI 4R79A 3MDPA 5A33A 4IE5A 2ZO4A 1OBNA 2XG3A 4A4AA 2RM21 4XVHA 2D40A 4W97A 5DG2A 3SLIA 1TNRA 1CAWB 4V1PA 4KWJA 4KISA 1J3PA 3ZFGC 1POV1 1WW6A 4AGGA 3G6EI 4GYGA 1AL0G 3DYMA 4FPJA 3LA7A 1IXRC 3NEUA 3A23A 5TSWA 1OQEA 1GP4A 2D1HA 5EFUA 1ZARA 3B9IA 4YVWB 3JSPA 4Q27A 2DA2A 3RJPA 3CIHA 2H8WA 5F2SA 4XSZF 4L92A 2GN3A 2WNUA 1TE1B 2WS91 3S2HJ 1QEXA 5FREA 3JUUA 4CP1A 1GBGA 2KIUA 2GAUA 1MSFC 1VBC3 2WAQN 1ZR4A 1W7PD 2UYAA 2E1CA 3ZXAC 1H9TA 2L7MP 5ABJB 4LG0B 1ZH5A 1AXKA 5LBFA 1FAYA 1Y56A 2EXHA 4I3GA 4GWNA 1REEA 1C8M1 1S4CA 2P7CB 2DA1A 3OYBA 3RI9A 2Q0OA 1N3OA 2HKOA 2KMUA 4W6YA 4XIDA 4NNJA 2B42B 1KU9A 4P96A 2J5OA 5FY0A 4Z8BA 1G8WA 3CBNA 4WK8F 5FZ8A 4CCMA 4OMCA 4OCTA 4YM0A 2PG4A 2X9DA 1HOMA 4W8JA 4BDYA 1OF3A 3VB2A 1KS4A 4YLZA 1QJFA 3FZ3A 4YVSC 5IK5A 4FCYA 2E71A 2WA3A 4Y4RA 3ZSKA 3RGBA 3WG3A 3V8JA 4CVUA 2OQ6A 2DFCA 1STMA 3BTIA 1FPN3 5T5PA 3U11A 4XL9A 3GYDA 4IZZA 2ZBJA 2EK5A 4JOMA 3BU0A 2EXKA 2V6EA 4AVVA 5EV7A 5I0UA 2E51A 1Q8VA 5D1IA 1RB8G 2QZ3A 4M3DA 2K02A 2E36A 1LEBA 4ATFA 4MGRA 1EV12 3UNPA 5B4XA 2DUPA 4HW0A 1G9FA 4RDUA 4QIWN 3ZMSA 4A6OA 3ZQCA 2BV4A 1BJAA 3DTKA 2BY1A 4XYXA 3A01B 1R1A3 4HV5A 2VOOA 3ZXLA 3QCWA 1KRIA 4JCKA 1IRFA 4O6JA 1OQ1A 1GU3A 3WF2A 2XQXA 2Q1ZB 1UO9A 4IXLA 4KT6A 1H6XA 4NPMA 4N53B 1QJZA 1QZZA 1QGLA 1JJ6C 1ZN2A 3N7KA 4CDQB 3M3OA 2A73B 3FKIJ 1ZRIA 4B8EA 3CJIC 1REDA 4QSHA 1RIOH 5SV5A 5IT3A 4HX4A 4N43B 2CY6A 2YFUA 3H1MA 3BPXA 1HDDC 3RVHA 3WU2C 1XTAA 1VQ8I 2BDRA 4GCVA 4NR1A 4BBRJ 3HRMA 5IVYA 1X2NA 3MUY1 1IS6A 3LAGA 2KRCA 1RMU1 1SACA 4EWDA 3ILNA 4HXCA 3A0KA 2VOPA 5ERLA 1ODDA 3ZYGA 3ZPYA 1QXPA 4X1EA 3PJQA 1N1TA 2R072 4N4OB 1ENHA 5E18F 5DDGA 4JGYA 3OGGA 4Q1PA 2BW3B 1WGPA 2HWB3 1WLCA 4DNYA 3VKOA 2PHWA 4QXHA 1PNGA 1UHSA 4QXBA 5F0HA 2RGVA 2DUQA 3HOSA 1U0AA 4XDQA 5FKMA 4EMSA 2ZMKA 4ZDOA 3A2KA 2PTMA 4E2SA 4NHYA 4HN0A 3ZYJB 4OHXA 4GZ9A 1OMIA 1KU2A 2OS2A 1PVC3 1X19A 2VZ3A 1HJGA 5A70A 5AIQA 2C6YA 4CUCA 1Y1VJ 4EWAA 3W5NA 3AG3H 3I3QA 5FBJA 4HRIA 2OV7A 1GXQA 3WE3A 5DD4A 3KZIC 5FPBA 3O8GA 2ZHNA 2XR4A 4LBQD 1HXS1 4O9EA 3QP5A 5HI0A 3ZO0B 2XVCA 3WGHA 1Z78A 3PU8A 4FVVA 4CYCA 1ZZ6A 4Q4V3 4R9CA 4Y22A 4CYDA 5AC91 4BJTA 1HB3A 1TC3C 2DA3A 3AZZA 2ZKNA 3ZMNA 4HSRA 4ANJA 1A35A 3GJAA 3KIOA 1IXCA 3VL8A 4KWUA 5C33A 4M3GA 3CD6I 1RNLA 4ZZLA 3OWTA 2MGQA 2ZX2A 2O61A 3FMQA 5FMOL 2DA4A 5IP6A 3ORJA 5K5QA 4G9SB 2YXSA 4W6XA 2QLZA 4BGDA 4MXVA 2DOEA 2PAMA 1S0JA 2J1VA 1LDDA 1FNYA 1Q8OA 3RDIA 2UU8A 3KLOA 3IL2A 5TRDA 5LBQA 2KRHA 5JI7A 1EPZA 3WHTA 3CF6E 4LEJA 1TWHJ 4FTSA 1PP7U 4Z6YA 1W6QB 3S1MJ 1JYNA 1J5YA 2NRAC 1GQPA 1JHHA 2A05A 2VBXA 2JMWA 3M1HA 5F1JA 1VQ5I 4K20A 3VBFA 2WWYA 3I53A 1MMAA 4KT5C 5TISC 3FXKA 1SFKA 2VOWA 4BMBA 2IS2A 3URFA 1OPCA 4UV9A 4J25A 1Y4WA 4BKXA 2QQAA 1AX1A 4IE4A 2M34A 4XF9A 1U6GA 1RKWA 4JKKA 2Z5WA 5HCAA 3M8FA 2A6VA 2RJLA 4Y5TA 5L9BA 3KF5A 4URAA 2HWF1 3VBHA 1HKTA 2IGMA 1OCOH 1RUH1 1DU0A 1FPQA 1K5MB 4BJ0A 2PFWA 2A6YA 2AO9A 5M3MJ 2X6WA 1UMZA 2ZGLA 2VOVA 5FKOA 2WNEA 4E7SA 3O1RA 1C4RA 1NE6A 4PDWA 1ACIA 1VAMA 1RINA 4XILA 1QJX3 4IEUA 1EPWA 2X6OA 4P9IA 4EYUA 1GV2A 1WZ2A 5L36A 4RS5B 3GHNA 2ZGUA 1XU1A 4UY8I 1T33A 1URXA 1NLQA 3OYWA 4Y1VA 2RDQA 4QPWA 3OUJA 3ZIXA 2VZRA 2Q5TA 3PUHA 1MBGA 2DMTA 4FPLA 3ZX7A 1COV2 2IA1A 4UFLA 2WLQA 3DLAA 1GZTA 2WZEA 2ZOEB 1QO0D 4Y1UA 5JAXA 3EETA 1ZHFA 3VBOC 1OPOA 2DJNA 4XMIA 1QBJA 4D6RA 2ARAA 2TCTA 5CNAA 1W8UA 2XGCA 3CLQA 5CG9A 1CX4A 4MFEA 3GZUC 4Q4ZF 4RGXA 1J9IA 1MS9A 4OI1A 2WZPP 1QOSA 4XZUG 4XQFA 2DJIA 3JBG2 1UW8A 3J8F3 1YI7A 2Y0MA 2QE3A 4ITVA 4YM2A 1RR7A 2HEOA 1AR81 4E8DA 4L9NA 3OYIA 2D1VA 3O1PA 1Z7S2 2W91A 1SFEA 1W0NA 3HHHA 2X1EA 5BPIA 1R1UA 1N3PA 2BVBA 2DA5A 1ZRDA 1TQMA 4MG2A 1JS9A 2HKXA 3GWZA 2NVYJ 4IHSA 1MPXA 3K48A 1W8NA 3ZYRA 2Y31A 2JA6J 3NW4A 2J1SA 4RGUA 4XUPA 2ZNZA 4FQGA 4NJ4A 3RZDJ 5DG1A 1T8IA 2GN7A 1VE0A 2D6NA 1KQ0A 1AYM3 4Y3OA 3K4LA 3KGZA 4FTEA 4KU7A 2HXOA 3BP8A 3PVNA 3J81Z 5LBCA 1BW6A 3WX5A 3KE2A 2ZEZA 5BNOC 4AVBA 4E9KA 1X1AA 2ZJ2A 3AMPA 5HODA 2TDXA 5DEQA 2XJVA 3ZKYA 3WP5A 4COWA 1L7LA 4DQ2A 3OBRA 3S2WA 2PMWB 4QQ2A 1UELB 2XH6A 5J09A 5K7ZA 3EDPA 1H8TA 2XUEA 4AI0A 2HWB1 3VHRA 2IGKA 4C3JJ 1W6MB 2ZEXA 1R22A 2JG8B 3GW2A 2PMUA 4LLOA 4GO1A 2AC1A 4XZPA 1W9WA 1OKQA 5FAXA 3N9PA 2ECBA 1GQGA 5FP9A 2WAQA 1GKBA 5FTTC 4P00B 3CDZB 1X58A 1CR7A 1XJAA 2MC4A 1F15A 5JZGC 3R4KA 1WCSA 1Q1HA 2E34A 4HSJA 5FQ0B 1ZYRF 3WP3A 2JA2A 1O59A 3J7NA 2R063 4AI8A 1V9U2 3PNVA 1G4DA 2XHNA 2E1MC 1PUFB 1S29A 4FAHA 2M87A 2GNTA 4DGWB 3F8CA 3D5RC 5C44J 3ACFA 2M4GA 3CU7A 3EPZA 2F5EA 2L3DA 2B39A 4LK1F 3K2AA 4BJ6C 4CXXA 4JGZA 1WJBA 1Y8RB 1H1MA 1CD3G 2OCEA 5IW0A 2WTEA 4O65A 5EIYB 2Y33A 5FZOB 4JHZA 2V4VA 5TGTA 1OUXA 3PDQA 1QKQA 3DEWA 4BDVB 3T1MA 4XAEA 1J58A 1H1AA 3BIWE 5F04A 5FZIA 3IRQA 5JR7B 5IP7J 1FATA 3P9IA 3JSOA 3SITA 5ILVA 2NXNB 4G9YA 1GQHA 3ACLA 2MYSA 3OYCA 5M3FJ 4H14A 1B72B 2X5IB 1MBJA 2W00A 2F5DA 4IEQA 3CZJA 2IXIA 5EEAA 4MHGA 3WCSA 4MNUA 1N1YA 4F93B 1Y3TA 1W3XA 2DUOA 2AQEA 3I8TA 3WCRA 3LAJA 3PUIA 2X48A 5IWFA 4YPJA 2P34A 2RV8A 5EEHA 2JUCA 2OAZA 3U37A 3CP8A 2E7WA 1BBYA 5IOYA 2MEV2 2XAHA 4IPAA 4WM7B 2BERA 5GZEA 1LOAA 4G4FA 4C0HA 1DQ5A 1QH6A 4DXRA 1YOVB 4Z2YA 1WSUA 3UGFA 5ILSA 4K9SA 4AEDA 1VF9A 2B9UA 5FKCA 1CF7B 1R093 2PX9A 4AVPA 1BLZA 5D8KB 1ND3C 4FFFA 3BTXA 4H7MA 3E5XA 2E2JJ 1VAKA 5C9AA 1W9SA 4BIFA 3AJZA 4Q4Y2 3CC4I 1BYHA 2VAUA 2QBXA 4UFKA 3ZFEC 1X4OA 5D8AB 1NHAA 3DPLC 4UBGA 3GF2A 3KZZA 1PO12 3KS7A 2DK8A 3ZVXA 1G9CA 2OUHA 3V56A 3WU1B 1I5PA 1QJX1 2EZIA 5LRSA 4QX1A 2V72A 1DG6A 4JRAA 3I2KA 4LE4A 2FDGA 3TQNA 4RB3C 4BXFA 3PM1A 4ARXA 2GA2A 2X1CA 4XLCA 4D0PA 1XD7A 2YU3A 4UXAA 1BBT3 2ISZA 3W6JB 4XQDA 1BHGA 3K46A 3L2RA 1LEAA 4CEWA 2VNVA 2VBBA 3LF7A 1NCRB 4C3IJ 4B09A 1MS8A 4OHVA 1WCKA 2QF7A 4AIKA 2DMPA 2GLOA 4DXSA 3CMAI 2IZWA 2QSGX 5ANQA 4C0BA 3MZYA 1T08B 4YZ4A 4LO7A 1VP6A 3AMQA 4COYA 3VBSB 3GZTB 3IAPA 3ELNA 5JI6A 4JX6A 1HC8A 4GB33 5F08A 4RHV1 2VGDA 4MADA 3UJOA 1W28A 3VDDC 1Q43A 1W3VA 3NNFA 3ZXGA 3LSKA 4UFJA 2M9HA 2D98A 3KP5A 3WY6A 3W59A 3J8F1 2OPKA 2W9XA 2D5VA 1TG7A 3SJMA 2E9QA 5EWSA 1IDYA 2DVFA 3FX3A 1X33A 1ZG1A 2DU9A 4A44A 4PUSA 2WA4A 2UURA 4BYYA 3O7OA 3RZOJ 5LD2C 1I1EA 3L9FA 2WJSA 3UESA 3LEMA 1F1ZA 1LAJA 2E2HJ 2W25A 3W3CA 4GH4B 1MD0A 1QQIA 1KGYA 3BKZA 1SD7A 3DXJF 4JKLA 4AI2A 4AWDA 5EPAA 5FKKA 3VBUA 3MKYB 1REPC 3H3VK 5A6QA 2XVGA 1LNWA 2R0FA 4IEYA 3I4NJ 1RUJ2 3B94A 4M0HA 1RHI2 2KIFA 1PUEE 1AYM1 1RUF3 4S2GA 3GTKJ 4WCGA 5FZ4A 4HLXA 1IC8A 4BJ5C 2Y75A 1A31A 2WO2A 3IDAA 4LB5A 1C57A 4OHYA 2MABA 1R5GA 2O0YA 2KZVA 1LKNA 3J80K 5EZGA 1D4M3 1YLLA 4UUTA 5E3OA 4YFWA 3MFCA 2IP2A 1PZ9A 1R36A 3JD73 3E6DA 1V6IA 3Q0WA 4D3WA 4IL7A 2VVFA 1RESA 4FX4A 2HWC3 4XDOA 4FT8A 1EUTA 4I76A 1NLSA 3HNYM 3H7JA 2JJ6A 4Y33A 4FTHA 1USSA 4A7ZA 2Q8EA 4LGWA 3BR3A 2IGOA 1G9AA 1HRI3 3AX4A 1LFPA 1BK0A 4FOYA 2V9PA 2I74A 4CSWA 3DXUA 4D7TA 3CCYA 2ZMEA 5FO8B 5J40A 1DQ2A 1S1AA 4AOCA 3D0JA 1D0YA 4BU2A 3MQ0A 2GM4A 3S5AA 4J19A 3HRTA 1O5UA 1ZVFA 4M4RA 1IXSB 2JZYA 5F6FA 3M3YJ 2DBNA 4Z82A 3HOWJ 3CF5F 2R16A 1JKOC 4P55A 4XR6A 1QPMA 1CQTA 2Z9OA 3V64A 3U0ZA 1YYNA 4AQ2A 1VAVA 2WUHA 2XBO2 4XIOA 3LZZA 4AIHA 2OD5A 2OZJA 5CPRB 2JVGA 3JRGA 2YBPA 4EJVA 2YC4A 1AR93 5D4SA 2H8RA 4PSXA 3K4CA 2EIMH 3EUKL 5CISA 1XC5A 2C5DA 5A3OA 1GT0C 2KLOA 3QU3A 1OLTA 4ONUA 4JYKA 2R7WA 1Q8SA 3SEPA 1VBA3 4D6SA 4PJNA 3IMMA 4IEZA 5CLSA 3GFLA 3ZQLA 3QU6A 2AR6A 2NZ9A 3VYUB 4GAZA 1ZGAA 3AMNA 1YTYA 3LEIA 2F4LA 3E6MA 2VBPA 2G0EA 3R4UA 1JI6A 2PJRB 3I2HA 4RR3A 1K79A 1RGSA 4XOGA 1NX9A 3EMRA 4KWKA 5EJCA 4L0PA 1WMEA 2NPIA 4A3IJ 4AVSA 4CP9A 4JZRA 5BOXA 4M72A 2ELKA 3LA2A 3IMNA 1OLRA 3LOIA 1MACA 1S8NA 3R60A 2PAKA 1FMVA 2XJPA 3H5AA 2ZXQA 2P3YA 3Q5FA 1ASJ2 1XSRA 3X2QH 4KUMA 1A5JA 2HQAA 4EJUA 1OYWA 2K9MA 3E5UA 3AZYA 2DLLA 1UAAA 3M3QA 3PJYA 3KZ4C 2VXDA 3HSFA 1UWWA 5IPAA 4Z07A 1ZK8A 3JCIA 3BU7A 1OR7C 2VECA 4IUGA 2TEPA 2JDYA 1BEV1 1JUHA 3KMHA 5FDBA 2WO7A 2P5VA 3PQKA 2G9ZA 3PNYA 1KITA 3F21A 2QBYA 4RLFA 1TME3 4OYUA 4NWVA 5E1XA 1BIBA 3NAUA 2IRFG 4LLLA 3CCVI 2CH0A 5EG0B 2LW8A 5CG8A 2FMLA 1YC61 4QB6A 5D5WB 4FP3A 3LEGA 3LSPA 1YUDA 5DUXA 3PIPF 4B3NA 1S0EA 3KX2A 4IGQA 3T0YA 2ZABA 3TW6A 3M07A 2O3FA 3CJTB 2F5VA 2QQLA 3ZYIB 1T6SA 3ETQA 3WVJA 1EV7A 1T2XA 2A1XA 4GWIA 1YO5C 3VKLA 1MS1A 2E63A 3CZUA 3ZMUA 4H0EA 1DF0A 3MFKA 1ETYA 2ZGTA 4FISA 4DW6A 3VBRB 1GWKA 1H4HA 3VV1A 2BY2A 5F3GA 2HYJA 4BS9A 2IGNA 3SQOA 1RUG1 4YZ2A 2CV2A 5JIAA 2VR4A 3Q8BA 4EROA 1FC3A 1U5TA 3ELKA 2JDAA 4K1YA 2OA2A 3FIWA 1RUC3 1J1TA 3GXUA 5J1RA 1W6OB 5BNQA 2Y0SN 2HWD2 1V5EA 5FYUA 3DN7A 1DQ1A 2O5RA 3GMEA 3TEDA 5LEJA 1IRZA 1RR8C 4L18B 4GB31 1K12A 2KM2A 3VZJA 3BTAA 1VALA 2K27A 4CICA 4C8DA 1VBE3 4PJYA 4UWDA 1MMGA 1FOD1 2VNGA 4YVWC 3RKYA 5FMOS 3S3NA 1YXWA 1HCRA 3M1EA 2SBAA 1JOBA 1BMV1 3MPBA 1X8EA 1HRV3 4QM8A 2P0WA 3PSFA 2C1FA 1YIFA 3O14A 3H5RA 3QYEA 1V6NA 1UG0A 4Q4W2 5F37A 1AR62 3W2VA 1B8IA 1MEC3 1I50J 1PM7A 3FDYA 4HSLA 1W39A 3VHNA 4Q8KA 5C4JJ 3JQWA 1D0HA 5FYYA 1ETVA 4CCLA 5L3BA 4HDVA 1ND2A 1OFCX 2RR13 4KMQA 3TP3A 1OVSA 2RM22 5JXGA 3IPVA 1J59A 1DYPA 2EXIA 4X8NA 4RS8A 3LKJA 4IF4A 1O4ZA 3DKWA 1RUF1 2HEWF 2RS51 2P6CA 4XFHA 3A4CA 4QPGA 4YW3A 3WHUA 5FR3A 2VT2A 1MQTA 1ULOA 2CU7A 2WQ4A 5JI9A 2JE8A 3AYCA 2FNAA 4FOQA 3WT3A 4J6GA 2TNFA 1LODA 1YIPA 5ERIA 1AYN3 3F72A 4HVRA 3RZHA 2C4XA 3JCUC 1SBEA 3ZFFA 2WY7Q 1ENQA 1LULA 1M06G 4PHZA 2HVSA 3OY8A 4X6QB 3N05A 4LITA 2FRHA 1HRI1 1C28A 3S7IA 1YFHA 2K9NA 4BE0A 1P92A 1WMXA 3LIGA 1AL21 5L3CA 3B6AA 1AZDA 1CZTA 1G9BA 1C5IA 1I27A 1C8M2 1YRNB 5HDKA 5DUWA 5B1AH 1CIYA 4YFXF 4AI9A 4PQ9A 3S5QA 4NO4A 1UZWA 2XRNA 2RDSA 1Z77A 4BZ4A 2DVGA 1STZA 3NV4A 1S0DA 3SH3A 1I1SA 3JXSA 5JOWA 1WKMA 3TN91 4BQXA 2W4SA 2BNOA 3OYGA 3BZ6A 4ZYDA 3I9V2 4CDQC 2PN5A 1AR91 4PIZA 1NA1C 5FBZA 5JVTA 2EV0A 3GTJJ 2ZJPF 2LRPA 2VPVA 3RRDA 4N43C 2F4PA 4BQWA 4DZJA 3NWSA 4EV0A 2LM3A 3IKWA 2JA5J 1Z3YA 1BKZA 2GSYA 3EYIA 5EJZB 2ZBKA 5EYRA 5JVVA 1MZBA 4QMAA 2P6HA 5CFCA 1D2SA 4XHXA 1ZLJA 3CUOA 1VQ4I 4CO8A 4ESFA 2VW0A 3G7DA 2LROA 3JAMK 1XMXA 3SHFA 3V7RA 3DBLB 3FXQA 3GTQJ 1OCPA 4HLYA 5AFBA 5IYDJ 2HQNA 3U1KA 1ZQ3P 3ESWB 2CFXA 1JE8A 1YHFA 5DCFA 4ISQA 3ZN1A 4G7ZF 1APNA 4ES8A 4MXWA 2DK5A 1IF1A 4LULA 3UR3C 3JRIA 3V7CA 2WNVA 4U7DA 1UIKA 1K42A 4PFPA 4YW1A 5L7OA 1QXJA 2M7AA 2VB6A 1DCSA 1DGWA 3HB9A 2UYBA 2CUZA 5D5XB 1S7EA 3OUIA 1QJEA 4RA2A 2NMNA 2RNJA 2LUWA 4M71A 1W6NB 1XE0A 4AG4A 2YY1A 2BWAA 1X1PA 2ZXHA 1JZ7A 4ENMA 3RQIA 2D45A 4HL0A 1FOYA 4XBQA 4HPKA 4YRVA 4ORFA 2EV6A 3QOEA 2DYRH 5JLXA 4D8MA 4ENNA 5ACA3 4D9JA 2IA0A 2HYFA 5JOYA 3TO9A 5K0UA 3EUHC 3FK6A 4Z1VA 2JPCA 2LNBA 3MI8A 3IH2A 5J8CA 2VXRA 1PIV3 5HNHA 4EQVA 2BOIA 2F17A 4S04A 3ILRA 4Y52J 2FOKA 5L3DA 4Q0PA 2ZS6B 3WHCA 1QJU2 3HJRA 1MR5A 3W21A 1HBXG 4OHWA 4AUXA 2W1QA 2JE7A 1WPKA 5KVRA 4Y26A 2HVRA 3LFIA 3AVSA 1U5IA 2PLV3 4GULA 4KDPA 4LIUA 1CPMA 1NK3P 2QQPA 3KV9A 4HZFA 5J96B 2RS13 1E57A 1TZOA 2VKHA 5F0CA 5ICEA 1PZ7A 5I0DA 2BYVE 3C7HA 3OS2A 1UN1A 1K4TA 2CV1A 2VMDA 3V0AA 3QD6A 2ZKLA 1ULGA 4AF9A 1HXS2 2W46A 4XOPA 2XWJB 2WSVA 3O0XA 3ENRA 1RUC1 4EN6B 5FPXA 3LDRA 3FXUA 4YVSB 1IG7A 3BODA 1FYLA 2ZXIA 2P3IA 3SDGA 5AC92 1FSEA 1SLAA 3I0TA 2MSYA 3E1SA 3Q9OA 3T2OA 4QGLA 4GFBA 1H8VA 2WWUA 4RB2C 1AJOA 2YBSA 3S2DJ 2DPDA 2LG4A 2FDKA 3WW4A 1BI3A 3DBHB 1VBE1 5FLJA 4QQOA 5E89A 3PFYA 2NYYA 2FDJA 2MFZA 3U14A 4MSVA 2R043 4PGGA 2D2WA 3GHMA 3PUQA 5CFDB 1KS5A 1MIJA 1OXCA 5G05L 4OHZA 4A7KA 2LBFA 3PO2J 1FTZA 1K5MC 2RVAA 2A5ZA 1TBXA 2CU5A 5FPUA 2O8XA 5T52A 4UF0A 4MQ9F 1UY1A 4ENJA 2DTRA 4I0AA 4HN1A 2YU1A 4C30A 4MH0E 2EXJA 1EYBA 2GMEA 3CMGA 2L4AA 2BE5F 2A61A 3OYAA 3OSGA 3RKWA 4XKCA 4FETA 1F5TA 5LA2A 4OIQF 2L7ZA 1FWZA 1MZFA 4NWWA 2WFF1 5J1UA 2B7YA 2GP5A 4FCAA 2GIZA 4ZC3A 2YHJA 3D5SC 4GGGA 4ES9A 5LY2A 1FP1D 2G4IA 2FDIA 3CJIB 5LHGA 3TBIA 1WCDJ 4QDRA 1W2NA 1YIOA 1V00A 4Q4X1 1SVMA 1HB4A 2C9KA 4IQJA 5FY7A 4KG8A 1MH3A 1HDPA 3CDLA 1CGPA 4OIPF 3KEQA 1AYN1 3MHZA 3S15J 4CDWA 4AW7A 4PBPA 1RUH2 2CSOA 1VQ9I 3K9TA 5GLZA 2HWE3 3QODA 5F2WA 3V8LA 5BNNA 3NWTA 1FYMA 1IUYA 2D6PA 3VDAA 4DO0A 4ON0A 2GC1A 1B09A 4BQ1A 5L3EA 1FMD3 4MQVA 3BB6A 3ZFGA 3A4UA 3DXTA 3H92A 2XV4S 3TOAA 1OYYA 1M1EB 5SV8A 4H55A 3ABKH 4PI2A 1G7YA 3SEZA 4PI0A 4ZTJA 3OYEA 1GZWA 3ZQIA 3THTA 4TTGA 1D1AA 3CDIA 2OPWA 5A1LA 3F23A 4BCUA 3TO7A 4ASMB 1YX3A 1JYCA 1ZAOA 1LFBA 3WP4A 2B0LA 4E4HA 2DU1A 3JB4C 1NTCA 4YW4A 2Y30A 2R5YB 2VONA 4MZUA 3GTLJ 3U2RA 3UKVA 2HS5A 2KDZA 1D5VA 1BXHA 4AI1A 2A69F 2JQ7A 1XE8A 2LF7A 3TEWA 5EHDA 2AEYA 2JN6A 1NK2P 1VPHA 4KMFA 4U7BA 5FLXK 2J1EA 3KZYA 1IV8A 2M8GX 2V26A 3ROUA 2Y0SA 5DCMB 4UW4A 5A1FA 4FHTA 1Z7UA 3OYJA 1K78A 1AA7A 2CAUA 1W4MA 2YC2A 1R1A2 1VRBA 1YFWA 2QCSB 1S55A 4FPEA 1V6JA 1K3IA 4EJTA 1V6MA 1CAUB 1PGSA 2WYSA 1NE4A 3NL1A 1W0PA 4G7HF 3Q8EA 3N4MA 2JG8C 2A3XA 2VKVA 2F6CA 1SANA 4NPLA 1XDUA 3FLTA 3PVEA 4X6AJ 1UY3A 3LA3A 2L9LA 3MGUA 1B59A 5DUIA 3K4JA 4UW5A 4IRGA 2E2IJ 4WVMA 1WLWA 3H9AA 2NMOA 3V8KA 2QQVA 2O6GE 2LC2A 3KT1A 2WAEA 4IJAA 1QJY3 2PXJA 2UWBA 3E6CC 1IKQA 1RC9A 1VB2A 2LH9A 3LSJA 1VBB3 2Y6GA 1SVLA 1X7NA 4MEXF 1R4MB 3LFKA 2OJED 4L5EA 2PELA 4ZU7A 3RSNA 5EZWA 4QHBA 4EATA 4Q29A 3DU6A 1OUSA 3BPVA 2QYOA 4HF2A 5BY5A 3VDXA 1O4TA 2HWB2 4F55A 3OL3A 1PIV1 1X1BA 2B63J 1VQ7I 5DAWA 3BJAA 4LG3A 1XMKA 5K1YA 2WQZC 2M5WA 2H09A 3VDBA 1F35A 4G6DA 1NKGA 3HQRA 1DP3A 2ZZJA 2EFQA 5JPMB 4QTRA 1O4YA 4YYOA 4AEMA 4R9DA 1PVC2 1UKRA 1S0CA 4YG6A 4E2GA 3GZNB 2X5IC 5CADA 1SHWB 1WLTA 3PLQA 1Z1DA 3OEAA 3JQXA 1A8MA 5DS9A 2PLV1 2RDNA 1OISA 2ILMA 3K4NA 5EJ1B 2P6TA 2ID4A 1O4XA 3MCZA 3I59B 2RS11 4WZCA 3B93A 1GSLA 3ZXFA 5GAHJ 3NV3A 1R1TA 3USUA 2WAAA 2UWMA 4YGBA 4XUOA 5E8IA 3RPQA 3OYHA 3LDBA 3KB5A 4WM7C 1FSHA 1W8TA 2VQTA 2O1QA 2CUEA 2MHFA 2CW7A 4QWQA 1OYIA 2HEYF 4UVBA 2FDFA 3BDDA 4Q4V2 4AD9A 3VEPA 3JRBA 4YGDA 5H9RA 1DLCA 3K3OA 4QX2A 5DQ0A 5C4WB 2FQPA 1GANA 3RJRA 4XEZA 3HPHA 4RGGA 2K5CA 1H0BA 1YQCA 3VBOB 2CW0F 3K7AJ 1SD6A 1PGL1 3CO7C 1BJZA 3REOA 2R041 1KA8A 4OMDA 4PK4A 3RG0A 1Y9MA 1HQCA 2VKDA 3JR9A 3ASIA 4GWJA 3DF8A 1FNZA 1W04A 3AG2H 2QQKA 1VFCA 2B45X 1J7KA 5ED4A 5L3GA 2VPRA 2IFRA 4NIDA 5IK7A 2WL1A 2EF6A 3HEFA 1W9YA 2VMHA 4XJ9A 3POFA 1MDMA 1T6BX 1ULDA 2Y6HA 1R64A 4P9WA 4OIRF 4LK0F 4JX0A 4FFGA 3PUBA 3JTHA 5FIXA 3HQUA 1F4AA 4PCRA 2BRTA 4I2OA 4BAYA 1YJKA 5BNPB 3TP0A 5HCFA 5HDNA 3PTYA 1L3LA 1B9NA 4ASNA 4RB0A 1LOGA 2XLAA 3O1OA 3ZYFA 1LOEA 5HS8A 4E8CA 3H3LA 2D6OX 2YX7A 1K83J 2K46A 1NCRC 4PF5A 2ZJRF 2FQ4A 1P2FA 1U78A 4AQSA 2UY9A 2A6XA 4WZFA 5C3PA 2Y9YA 1U5TB 4XRSA 2HWE1 4W6WA 5ISLA 5FFXA 2IVIB 3U78A 4J00A 2BGOA 2VNRA 3AP4A 1DFQA 3VBSC 3CP2A 5DDJ3 2KHMA 4E7KA 3ES4A 4K7JA 2IXJA 1YITI 4B3AA 4BM8A 5FJ8J 3K77A 4JBAA 1QJX2 2JSPA 2GQQA 3F95A 1RVF3 3EO6A 4UV8A 2AREA 3HN1A 1F5JA 1CN1A 3NQOA 4QQHA 2E7QA 1LEDA 5JZGB 1RUI3 1P8JA 2FMDA 4I02A 4IV1B 4GH4C 1EF4A 4KYWA 3WNXA 5FWJA 2COBA 2UZKA 4A5NA 4OLLA 2AYHA 3MEPA 2BVVA 4M74A 3INAA 1VZ0A 4GMP3 1VQLI 2G19A 4EVIA 4YZ3A 1UMQA 1X4PA 3EQLF 4BE2A 2PQQA 2MEV1 4XFCA 2Z99A 2M2EA 3QWLA 2QQWA 4UT5A 1U0JA 1P4WA 2QZ2A 2YGLA 2GU9A 5GLTA 3J8F2 3DBRB 1GYKA 3W58A 2Z1DA 3CCRI 3H0DA 1KGSA 4EM0B 4JAAA 5F5AA 4F3QA 1WWYA 2EALA 3MV01 3MLKA 2X51A 3M8EA 3GTPJ 4JDNA 1YE9A 1LFUP 1UIJA 4Y5Z0 3T2PA 1OQYA 4XUTA 2ZEWA 2VMFA 1Z21A 3R05A 2X09A 1CAXA 2ZXWH 3IP4B 1ZREA 1V5FA 1Q5OA 4XN0A 3O1MA 2WLPA 1W99A 1JUPA 1RUD3 3C7OA 3Q9SA 4NMIA 4CZCA 3AKRA 2VQCA 4Q4Y1 4BQ2A 1XGSA 2R1BA 4AGVA 1T6GC 3IM0A 3DQVC 1YQ6A 3LSIA 2MLKA 3AKQA 1QJY1 4D7SA 3QYBA 2VXJA 3K4AA 1AYM2 3TAYA 2EILH 2B7EA 2HYXA 3KVBA 1EY2A 3GBGA 1OFSA 4LKEA 5DN2A 3WNMA 1T56A 4YM1A 1VBB1 4NHJA 3BTYA 4P9YA 5E3LA 1UZZA 1TMF3 2ZHKA 2QKLB 3OSFA 2R7OA 2QA4I 4NC8A 4DY5A 4ZONA 3L2QA 2DYSH 3WTUC 1JT0A 5FO5A 3DTIA 1E5HA 3SC7X 2OZ6A 3H42B 1EV13 1HQWA 5A80A 2H6BA 2WBKA 4B43A 1JUSA 1TEIA 3VD7A 1B4AA 3AB0A 4FE4A 1C5HA 1WH5A 3WF3A 3D6EA 1NZIA 2VI6A 4URTA 1JKPC 4XF0A 3DKYA 4HX7A 3B02A 2OQ7A 4XF1A 3MZ8A 4IRIA 2FXAA 5A2QZ 5BNOA 2RG4A 5BPXA 1DDLA 3WDYA 2X10A 3KSCA 5ANNA 3S0MA 4M00A 1OVPA 1X9PA 3N35A 1VQOI 4F92B 4ENKA 4EGZA 3B69A 2FOWA 5LEKA 1AKHA 3WQ1A 2XUMA 3MZHA 4L97A 5FLVA 2JDKA 4CP2A 4BEHA 3HG9A 1AJKA 1S7AA 2Y48A 2VJ4A 5B5EC 4X8PA 4FSJA 4ASLA 2YFZA 4M3EA 3CMEI 2Q8OA 2VT3A 2IS4A 2XL7A 4HANA 2HI3A 3ABUA 2VOKA 4COZA 2CWMA 5AFEA 2DCKA 1WJCA 4NIAA 3UGHA 3VDCA 3S57A 1MJ9A 5CKMA 1DQ0A 3J4UH 3RFRA 2M3AA 5FZ3A 1SCRA 2L4MA 3OGVA 4QGNA 4PLNA 4IEOA 3MFAA 4JDOA 1DP0A 5T3NA 5E8AA 2GMMA 1G9DA 4UAPA 3AFHA 2G1MA 4A3LJ 4HFSA 5J8FA 4ZZ8A 2OCCH 2Y8KA 2WT0A 5LBBA 3HUGB 1QGPA 2VE8A 2G9FA 1OJLA 4JTNA 3IRRA 4K1ZA 4XJ8A 1S72I 4CCKA 2DAOA 2E1OA 2XB5A 3S7EA 2AGSA 2VPLA 2VODA 1WFXA 2CMPA 2DMQA 2JEMA 4BDZA 2Y2ZA 2COMA 5D21A 1V70A 2WC2A 1IN7A 3HOUJ 5JXJA 2HDCA 1WW4A 5LA1A 5DABA 5J1XA 3UGGA 2HBUA 4KWLA 4ZPIA 2UUZA 4ZJZA 4ISRA 2E7XA 3PQJA 3FXOA 2P3JA 1BEV2 1KFXL 2DT7B 2MBFA 2I10A 4Y1YA 4RN5A 4AC0A 2IC1A 5FRMA 3V0AB 3ZR5A 1JHFA 4O5VA 2HOEA 2VIXA 3JREA 5A32B 2CG4A 4AI3A 3CO2A 4DZGA 1AF9A 1V4RA 2JDMA 5DDJ1 3H0OA 3C2BA 4CXWA 5GZCA 3FMRA 3UYJA 3HOYJ 1CAVB 1MGTA 3BG9A 1REFA 2LRDA 3O8HA 2N8GA 3ML6A 4MTEA 3BI3A 3NSTA 4E4SA 2B46X 4D6QA 3QPSA 5I91A 1ND3A 1GOGA 1NXMA 3ZOIA 2CRGA 2L7KA 2X85A 5EGOB 5LCWL 3RNSA 4DPNA 4I98B 3VHOA 3IC7A 1RUI1 1R23A 4XKVA 2KIMA 1WVRA 2LFBA 1Q1VA 2NNYA 1HQLA 3IB3A 1FTTA 1RUG2 2Y34A 3ZFEA 5A7WB 1DHKB 2CV0A 3ASNH 2GNDA 2NM1A 1YCIA 2QCOA 2LALA 3FC0A 3KHBA 4IEPA 3HGGA 3OIQA 4K6BA 4DS0A 1SG3A 1GNYA 1TLHB 5IJRA 2GALA 1WW5A 4GB32 1E3PA 3AL0B 4ESBA 3M3IA 3OPTA 3N9MA 3T8TA 1Y0NA 1IG3A 2IBDA 5CYVA 4JX4A 3H8OA 1PJRA 1CWPA 2XF5A 4YW2A 3DPUA 2JIJA 5FZMA 4HKOA 4QPIB 2ZFUA 4RGAA 4XACA 2PHFA 4E4DX 5C7GA 2W7NA 1BMV2 1Z0HA 3TOBA 1ZKGA 5J1YA 1RZ4A 2ZC2A 3DPTA 3JRFA 1GZCA 1TQ5A 3K4BA 1X3WB 1EH8A 1ZRCA 1VBD3 3M70A 2H6CA 1BQPA 1E5IA 3MD2A 2DMNA 5FZGA 5FYIA 5ICCA 3UKGA 4L9JA 5F5IA 4AL9A 4KH9A 3WUCA 5GLWA 1SEUA 5AVAA 1D8KA 3ZLIA 3P5BA 1T98A 5GAGJ 1RUD1 2EBIA 1X1DA 1D8JA 4AIJA 4DINB 5IVVA 1XGMA 4LA2A 4PCQA 3WG7H 4P5OA 3WD5A 2QDNA 3AP6A 3VDDA 4Q8LA 2JENA 5C5UA 5FLMJ 1RUF2 2RS52 4MX3A 4QB1A 1H2KA 3GYHX 3WEZA 1RPWA 3W5MA 1MW7A 2ADDA 3KPHA 2YZ4A 1K61A 4X6RB 3HVDA 4L9TA 2XMLA 4NIGA 2A6WA 4PJ0C 1C3HA 3FLRA 1O7LA 2M30A 4S2DA 2YBKA 2VKEA 5KBFA 4KICA 3NKGA 3OPWA 4LO6B 1FV2A 1UHWA 2HWC2 3HNBM 5CA6A 4IHXA 1XRUA 5J48A 2VBYA 1UXZA 1W2TA 5CB7A 1BIAA 3LB9A 3CLOA 2QGUA 3ZDSA 2A7AA 2WV0A 4A3JJ 2DV9A 3WF0A 3AL5A 3THCA 1HRI2 5LB6A 3FXRA 4NRPA 3I3BA 2LP0A 1N47A 1W8ZA 1AL22 2WWSA 4PQQA 3IDBB 2QJVA 3QQAA 3USSA 1Z7S3 1JMUB 2YV8A 3VD4A 2WN3A 4BY7J 2OU2A 4QHZA 4XLPF 2HWD1 4A3KJ 1GOHA 4MGKE 3ZN6A 4M6VA 3WR0A 1VIWB 2R92J 3DPRB 4ZKTB 4JK1X 2EIBA 2IJLA 3AKTA 2EZKA 3IH3A 1X82A 3DV8A 5F39A 4F83A 2DA6A 1RUE3 1UOBA 3SYTA 2HWVA 3LFMA 4J1XA 2FF4A 1W7PA 3W2WA 1IPKA 4C2UA 1AR92 3T4VA 5LRRA 3NRVA 3SXWA 5D6EA 5IATA 1RITA 2IVMA 1KU7A 2KT0A 5FP8A 2O8KA 2M1BA 4BMEA 2E26A 2KPMA 4RQPB 1LUJB 5FZHA 3I54A 2DYCA 2H1LA 3PMSA 3BUCA 1ZA4A 2EFWA 2DFHA 1D4VB 3A0NA 4UFHA 1FP2A 1I6HJ 3H3UA 4IQ4A 3GDBA 2BBYA 4QKNA 1BI0A 4HOOA 4F52A 1SFOJ 4ZDLA 4NHLA 4HT1T