2FN2A

Solution nmr structure of the glycosylated second type two module of fibronectin, 20 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
59
structure length
59
Chain Sequence
VLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN
publication title Solution structure of the glycosylated second type 2 module of fibronectin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Glycoprotein
total genus 6
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1997-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 2fn2A00
1H8PA 2FN2A 3MQLA 3M7PA 1E88A 1QO6A 1CK7A 1L6JA 1PDCA 2V5OA 1GXDA 1J7MA 1EAKA 1KS0A 1E8BA 1CXWA
chains in the Genus database with same CATH superfamily
1OGGA 1GPFA 1YU2A 4NYYA 4NZ4A 4GHAA 4MB4A 1OGBA 2BG1A 2Y2KA 3MQLA 2XD1A 1O6IA 3L2AA 1E15A 4IBDA 1L6JA 2RTSA 2Y2GA 4IBGA 3WD2A 2JCHA 1EAKA 2XD5A 4NYUA 3FKEA 3KS4A 4IBCA 4HMEA 4NZ5A 2Y2JA 1W1VA 2FFFB 2Y2NA 1AIWA 4OJ5A 4GH9A 4HMDA 3L27A 4IBKA 2IOUA 1H8PA 3WD1A 2D49A 2Y2PA 1KS0A 4Z2JA 4Z2IA 4MB5A 1E6RA 1PDCA 4NZ1A 1CXWA 2Y2LA 4IBFA 1E6PA 3WD0A 3HONA 1UR8A 2Y2OA 4IBIA 5BPVA 4NZ3A 3KS8A 1YU4A 2FN2A 3M7PA 1YU3A 4Z2LA 1W1PA 2UWXA 2Y2IA 4OJOA 1UR9A 1E88A 4OJLA 4TX8A 3WD4A 3WX7A 4Z2KA 4HMCA 1W1YA 4NY2A 4IBBA 4OJPA 1GOIA 4IJEA 4IJFA 1GXDA 1E6ZA 1E8BA 3L26A 4GHLA 4Z2GA 3N3FA 4IBEA 1W1TA 1H0IA 1YUEA 2Y2QA 3L29A 1E6NA 2Y2MA 1YU1A 2JE5A 4QNLA 3WD3A 4IBJA 4MB3A 1H0GA 4OUIA 2V5OA 3L25A 1ED7A 2Y2HA 3HSHA 3L28A 1QO6A 1CK7A 4LG2A 1J7MA 1YU0A 4Z2HA 4OJ6A
chains in the Genus database with same CATH topology
1H8PA 2FN2A 3MQLA 3M7PA 1E88A 1QO6A 1CK7A 1L6JA 1PDCA 2V5OA 1GXDA 1J7MA 1EAKA 1KS0A 1E8BA 1CXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H8P A;  2FN2 A;  3MQL A;  3M7P A;  1E88 A;  1QO6 A;  1CK7 A;  1L6J A;  1PDC A;  2V5O A;  1GXD A;  1J7M A;  1EAK A;  1KS0 A;  1E8B A;  1CXW A; 
#chains in the Genus database with same CATH topology
 1OGG A;  1GPF A;  1YU2 A;  4NYY A;  4NZ4 A;  4GHA A;  4MB4 A;  1OGB A;  2BG1 A;  2Y2K A;  3MQL A;  2XD1 A;  1O6I A;  3L2A A;  1E15 A;  4IBD A;  1L6J A;  2RTS A;  2Y2G A;  4IBG A;  3WD2 A;  2JCH A;  1EAK A;  2XD5 A;  4NYU A;  3FKE A;  3KS4 A;  4IBC A;  4HME A;  4NZ5 A;  2Y2J A;  1W1V A;  2FFF B;  2Y2N A;  1AIW A;  4OJ5 A;  4GH9 A;  4HMD A;  3L27 A;  4IBK A;  2IOU A;  1H8P A;  3WD1 A;  2D49 A;  2Y2P A;  1KS0 A;  4Z2J A;  4Z2I A;  4MB5 A;  1E6R A;  1PDC A;  4NZ1 A;  1CXW A;  2Y2L A;  4IBF A;  1E6P A;  3WD0 A;  3HON A;  1UR8 A;  2Y2O A;  4IBI A;  5BPV A;  4NZ3 A;  3KS8 A;  1YU4 A;  2FN2 A;  3M7P A;  1YU3 A;  4Z2L A;  1W1P A;  2UWX A;  2Y2I A;  4OJO A;  1UR9 A;  1E88 A;  4OJL A;  4TX8 A;  3WD4 A;  3WX7 A;  4Z2K A;  4HMC A;  1W1Y A;  4NY2 A;  4IBB A;  4OJP A;  1GOI A;  4IJE A;  4IJF A;  1GXD A;  1E6Z A;  1E8B A;  3L26 A;  4GHL A;  4Z2G A;  3N3F A;  4IBE A;  1W1T A;  1H0I A;  1YUE A;  2Y2Q A;  3L29 A;  1E6N A;  2Y2M A;  1YU1 A;  2JE5 A;  4QNL A;  3WD3 A;  4IBJ A;  4MB3 A;  1H0G A;  4OUI A;  2V5O A;  3L25 A;  1ED7 A;  2Y2H A;  3HSH A;  3L28 A;  1QO6 A;  1CK7 A;  4LG2 A;  1J7M A;  1YU0 A;  4Z2H A;  4OJ6 A; 
#chains in the Genus database with same CATH homology
 1H8P A;  2FN2 A;  3MQL A;  3M7P A;  1E88 A;  1QO6 A;  1CK7 A;  1L6J A;  1PDC A;  2V5O A;  1GXD A;  1J7M A;  1EAK A;  1KS0 A;  1E8B A;  1CXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...