2FN2A

Solution nmr structure of the glycosylated second type two module of fibronectin, 20 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
59
structure length
59
Chain Sequence
VLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the glycosylated second type 2 module of fibronectin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Glycoprotein
molecule keywords FIBRONECTIN
total genus 6
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1997-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 2fn2A00
1PDCA 3MQLA 1E88A 1H8PA 1CXWA 1GXDA 1CK7A 1EAKA 2V5OA 1J7MA 2FN2A 1L6JA 1KS0A 3M7PA 1E8BA 1QO6A
chains in the Genus database with same CATH superfamily
1PDCA 3WX7A 1W1VA 4OJPA 3L28A 4NZ5A 4Z2KA 2Y2QA 1E6ZA 2Y2JA 4IBDA 4OJLA 3L29A 3WD2A 1YU3A 1W1YA 3KS8A 2FFFB 1CK7A 3WD4A 4IBFA 4LG2A 3M7PA 2D49A 2Y2PA 1YU4A 3N3FA 2Y2OA 1UR8A 2Y2MA 1YU2A 4Z2JA 1OGBA 1GOIA 3FKEA 2JCHA 3KS4A 4GHAA 2Y2LA 3L2AA 3WD0A 3WD1A 4IJFA 1E15A 4OJ6A 1E6NA 2XD1A 2UWXA 3HONA 1W1TA 1GXDA 2BG1A 4IBCA 1E6PA 1H0IA 4MB3A 4NY2A 4NZ3A 2Y2KA 3MQLA 2Y2HA 4GH9A 1OGGA 4HMEA 1L6JA 3WD3A 4MB4A 5BPVA 1ED7A 2V5OA 2Y2IA 1J7MA 2IOUA 4IBGA 4IBJA 1KS0A 4QNLA 1E88A 1YUEA 4HMCA 1UR9A 4NZ4A 4Z2GA 1E8BA 1YU0A 1H0GA 1GPFA 3L27A 3L26A 2Y2GA 4IBBA 2RTSA 4OJOA 2XD5A 4OJ5A 1CXWA 2FN2A 1E6RA 3HSHA 1AIWA 4IBEA 4NYYA 4GHLA 4OUIA 4Z2IA 1W1PA 1H8PA 1EAKA 1YU1A 2JE5A 4NYUA 4Z2LA 1QO6A 4HMDA 4TX8A 4IBKA 4IBIA 1O6IA 3L25A 2Y2NA 4MB5A 4NZ1A 4Z2HA 4IJEA
chains in the Genus database with same CATH topology
1PDCA 3MQLA 1E88A 1H8PA 1CXWA 1GXDA 1CK7A 1EAKA 2V5OA 1J7MA 2FN2A 1L6JA 1KS0A 3M7PA 1E8BA 1QO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PDC A;  3MQL A;  1E88 A;  1H8P A;  1CXW A;  1GXD A;  1CK7 A;  1EAK A;  2V5O A;  1J7M A;  2FN2 A;  1L6J A;  1KS0 A;  3M7P A;  1E8B A;  1QO6 A; 
#chains in the Genus database with same CATH topology
 1PDC A;  3WX7 A;  1W1V A;  4OJP A;  3L28 A;  4NZ5 A;  4Z2K A;  2Y2Q A;  1E6Z A;  2Y2J A;  4IBD A;  4OJL A;  3L29 A;  3WD2 A;  1YU3 A;  1W1Y A;  3KS8 A;  2FFF B;  1CK7 A;  3WD4 A;  4IBF A;  4LG2 A;  3M7P A;  2D49 A;  2Y2P A;  1YU4 A;  3N3F A;  2Y2O A;  1UR8 A;  2Y2M A;  1YU2 A;  4Z2J A;  1OGB A;  1GOI A;  3FKE A;  2JCH A;  3KS4 A;  4GHA A;  2Y2L A;  3L2A A;  3WD0 A;  3WD1 A;  4IJF A;  1E15 A;  4OJ6 A;  1E6N A;  2XD1 A;  2UWX A;  3HON A;  1W1T A;  1GXD A;  2BG1 A;  4IBC A;  1E6P A;  1H0I A;  4MB3 A;  4NY2 A;  4NZ3 A;  2Y2K A;  3MQL A;  2Y2H A;  4GH9 A;  1OGG A;  4HME A;  1L6J A;  3WD3 A;  4MB4 A;  5BPV A;  1ED7 A;  2V5O A;  2Y2I A;  1J7M A;  2IOU A;  4IBG A;  4IBJ A;  1KS0 A;  4QNL A;  1E88 A;  1YUE A;  4HMC A;  1UR9 A;  4NZ4 A;  4Z2G A;  1E8B A;  1YU0 A;  1H0G A;  1GPF A;  3L27 A;  3L26 A;  2Y2G A;  4IBB A;  2RTS A;  4OJO A;  2XD5 A;  4OJ5 A;  1CXW A;  2FN2 A;  1E6R A;  3HSH A;  1AIW A;  4IBE A;  4NYY A;  4GHL A;  4OUI A;  4Z2I A;  1W1P A;  1H8P A;  1EAK A;  1YU1 A;  2JE5 A;  4NYU A;  4Z2L A;  1QO6 A;  4HMD A;  4TX8 A;  4IBK A;  4IBI A;  1O6I A;  3L25 A;  2Y2N A;  4MB5 A;  4NZ1 A;  4Z2H A;  4IJE A; 
#chains in the Genus database with same CATH homology
 1PDC A;  3MQL A;  1E88 A;  1H8P A;  1CXW A;  1GXD A;  1CK7 A;  1EAK A;  2V5O A;  1J7M A;  2FN2 A;  1L6J A;  1KS0 A;  3M7P A;  1E8B A;  1QO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...